3AWYB

Crystal structure of streptomyces tyrosinase in a complex with caddie m84l mutant soaked in a cu(ii)-containing solution for 80 hr
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
73
Chain Sequence
AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVLRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title A molecular mechanism for copper transportation to tyrosinase that is assisted by a metallochaperone, caddie protein
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 16
structure length 73
sequence length 84
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 3awyB01
3AWSB 2ZMZB 2ZWGB 2ZMYB 3AWUB 2AHKB 3AWZB 1WX4B 2AHLB 1WX2B 2ZWEB 1WX5B 3AX0B 2ZMXB 2ZWDB 2ZWFB 1WXCB 3AWTB 3AWYB 3AWVB 2JV8A 3AWWB 3AWXB
chains in the Genus database with same CATH superfamily
3AWSB 2ZMZB 4NBCA 4NBBA 2DE5A 2ZWGB 2ZMYB 1WW9A 4NBEA 3AWUB 2AHKB 3AWZB 3GKQA 1WX4B 2AHLB 4NB8A 1WX2B 2DE6A 2ZWEB 3GCFA 1WX5B 3AX0B 2ZMXB 2ZWDB 2DE7A 1Z01A 2ZWFB 1WXCB 4NBDA 3VMIA 1Z02A 3VMHA 4NB9A 3AWTB 3AWYB 4NBGA 4NBFA 3AWVB 2JV8A 4NBAA 1Z03A 3AWWB 3AWXB 3VMGA 4NBHA
chains in the Genus database with same CATH topology
3AWSB 2ZMZB 2ZWGB 2ZMYB 3AWUB 2AHKB 3AWZB 1WX4B 2AHLB 1WX2B 2ZWEB 1WX5B 3AX0B 2ZMXB 2ZWDB 2ZWFB 1WXCB 3AWTB 3AWYB 3AWVB 2JV8A 3AWWB 3AWXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AWS B;  2ZMZ B;  2ZWG B;  2ZMY B;  3AWU B;  2AHK B;  3AWZ B;  1WX4 B;  2AHL B;  1WX2 B;  2ZWE B;  1WX5 B;  3AX0 B;  2ZMX B;  2ZWD B;  2ZWF B;  1WXC B;  3AWT B;  3AWY B;  3AWV B;  2JV8 A;  3AWW B;  3AWX B; 
#chains in the Genus database with same CATH topology
 3AWS B;  2ZMZ B;  4NBC A;  4NBB A;  2DE5 A;  2ZWG B;  2ZMY B;  1WW9 A;  4NBE A;  3AWU B;  2AHK B;  3AWZ B;  3GKQ A;  1WX4 B;  2AHL B;  4NB8 A;  1WX2 B;  2DE6 A;  2ZWE B;  3GCF A;  1WX5 B;  3AX0 B;  2ZMX B;  2ZWD B;  2DE7 A;  1Z01 A;  2ZWF B;  1WXC B;  4NBD A;  3VMI A;  1Z02 A;  3VMH A;  4NB9 A;  3AWT B;  3AWY B;  4NBG A;  4NBF A;  3AWV B;  2JV8 A;  4NBA A;  1Z03 A;  3AWW B;  3AWX B;  3VMG A;  4NBH A; 
#chains in the Genus database with same CATH homology
 3AWS B;  2ZMZ B;  2ZWG B;  2ZMY B;  3AWU B;  2AHK B;  3AWZ B;  1WX4 B;  2AHL B;  1WX2 B;  2ZWE B;  1WX5 B;  3AX0 B;  2ZMX B;  2ZWD B;  2ZWF B;  1WXC B;  3AWT B;  3AWY B;  3AWV B;  2JV8 A;  3AWW B;  3AWX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...