3AWYB

Crystal structure of streptomyces tyrosinase in a complex with caddie m84l mutant soaked in a cu(ii)-containing solution for 80 hr
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
73
Chain Sequence
b'AAPESFDEVYKGRRIQGRPAGYEVFVDGVQLHVLRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title A molecular mechanism for copper transportation to tyrosinase that is assisted by a metallochaperone, caddie protein
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 16
structure length 73
sequence length 84
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 3awyB01
2ZWDB 2AHLB 3AWTB 2ZMZB 1WXCB 2AHKB 3AX0B 2JV8A 3AWUB 2ZWFB 3AWYB 3AWWB 2ZWGB 3AWSB 1WX2B 1WX4B 2ZWEB 2ZMYB 2ZMXB 3AWZB 1WX5B 3AWVB 3AWXB
chains in the Genus database with same CATH superfamily
3GKQA 2ZWDB 2DE7A 3VMHA 4NBHA 1WW9A 2AHLB 4NBEA 3AWTB 1Z03A 2ZMZB 1WXCB 2AHKB 3AX0B 1Z01A 4NB9A 2DE5A 3GCFA 4NBGA 2JV8A 3AWUB 2ZWFB 3VMGA 4NBCA 3AWYB 3AWWB 4NB8A 2ZWGB 2DE6A 3AWSB 4NBAA 4NBDA 3VMIA 1WX4B 4NBBA 2ZWEB 2ZMYB 2ZMXB 3AWXB 3AWZB 1Z02A 1WX5B 3AWVB 4NBFA 1WX2B
chains in the Genus database with same CATH topology
2ZWDB 2AHLB 3AWTB 2ZMZB 1WXCB 2AHKB 3AX0B 2JV8A 3AWUB 2ZWFB 3AWYB 3AWWB 2ZWGB 3AWSB 1WX2B 1WX4B 2ZWEB 2ZMYB 2ZMXB 3AWZB 1WX5B 3AWVB 3AWXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZWD B;  2AHL B;  3AWT B;  2ZMZ B;  1WXC B;  2AHK B;  3AX0 B;  2JV8 A;  3AWU B;  2ZWF B;  3AWY B;  3AWW B;  2ZWG B;  3AWS B;  1WX2 B;  1WX4 B;  2ZWE B;  2ZMY B;  2ZMX B;  3AWZ B;  1WX5 B;  3AWV B;  3AWX B; 
#chains in the Genus database with same CATH topology
 3GKQ A;  2ZWD B;  2DE7 A;  3VMH A;  4NBH A;  1WW9 A;  2AHL B;  4NBE A;  3AWT B;  1Z03 A;  2ZMZ B;  1WXC B;  2AHK B;  3AX0 B;  1Z01 A;  4NB9 A;  2DE5 A;  3GCF A;  4NBG A;  2JV8 A;  3AWU B;  2ZWF B;  3VMG A;  4NBC A;  3AWY B;  3AWW B;  4NB8 A;  2ZWG B;  2DE6 A;  3AWS B;  4NBA A;  4NBD A;  3VMI A;  1WX4 B;  4NBB A;  2ZWE B;  2ZMY B;  2ZMX B;  3AWX B;  3AWZ B;  1Z02 A;  1WX5 B;  3AWV B;  4NBF A;  1WX2 B; 
#chains in the Genus database with same CATH homology
 2ZWD B;  2AHL B;  3AWT B;  2ZMZ B;  1WXC B;  2AHK B;  3AX0 B;  2JV8 A;  3AWU B;  2ZWF B;  3AWY B;  3AWW B;  2ZWG B;  3AWS B;  1WX2 B;  1WX4 B;  2ZWE B;  2ZMY B;  2ZMX B;  3AWZ B;  1WX5 B;  3AWV B;  3AWX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...