3AX0B

Crystal structure of streptomyces tyrosinase in a complex with caddie y98f mutant soaked in a cu(ii)-containing solution for 80 hr
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
78
Chain Sequence
AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHFDPVPTPRAAARAAVDELQGAPLLPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title A molecular mechanism for copper transportation to tyrosinase that is assisted by a metallochaperone, caddie protein
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 17
structure length 78
sequence length 84
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 3ax0B01
2ZWGB 3AX0B 2ZWFB 1WX2B 3AWYB 3AWSB 1WX5B 3AWUB 3AWZB 2ZWEB 2ZWDB 3AWVB 1WXCB 3AWWB 2AHLB 2ZMYB 2AHKB 3AWTB 1WX4B 3AWXB 2JV8A 2ZMXB 2ZMZB
chains in the Genus database with same CATH superfamily
4NBBA 2ZWGB 4NBEA 3GCFA 1WW9A 3AX0B 2ZWFB 4NB9A 1WX2B 3GKQA 4NB8A 3AWYB 3AWSB 4NBHA 1WX5B 3VMHA 3AWUB 3VMGA 3VMIA 2DE7A 3AWZB 4NBGA 2ZWEB 2ZWDB 3AWVB 4NBCA 1WXCB 1Z02A 1Z01A 3AWWB 2AHLB 4NBDA 2ZMYB 2DE5A 1Z03A 4NBFA 2AHKB 2DE6A 3AWTB 1WX4B 3AWXB 2JV8A 4NBAA 2ZMXB 2ZMZB
chains in the Genus database with same CATH topology
2ZWGB 3AX0B 2ZWFB 1WX2B 3AWYB 3AWSB 1WX5B 3AWUB 3AWZB 2ZWEB 2ZWDB 3AWVB 1WXCB 3AWWB 2AHLB 2ZMYB 2AHKB 3AWTB 1WX4B 3AWXB 2JV8A 2ZMXB 2ZMZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZWG B;  3AX0 B;  2ZWF B;  1WX2 B;  3AWY B;  3AWS B;  1WX5 B;  3AWU B;  3AWZ B;  2ZWE B;  2ZWD B;  3AWV B;  1WXC B;  3AWW B;  2AHL B;  2ZMY B;  2AHK B;  3AWT B;  1WX4 B;  3AWX B;  2JV8 A;  2ZMX B;  2ZMZ B; 
#chains in the Genus database with same CATH topology
 4NBB A;  2ZWG B;  4NBE A;  3GCF A;  1WW9 A;  3AX0 B;  2ZWF B;  4NB9 A;  1WX2 B;  3GKQ A;  4NB8 A;  3AWY B;  3AWS B;  4NBH A;  1WX5 B;  3VMH A;  3AWU B;  3VMG A;  3VMI A;  2DE7 A;  3AWZ B;  4NBG A;  2ZWE B;  2ZWD B;  3AWV B;  4NBC A;  1WXC B;  1Z02 A;  1Z01 A;  3AWW B;  2AHL B;  4NBD A;  2ZMY B;  2DE5 A;  1Z03 A;  4NBF A;  2AHK B;  2DE6 A;  3AWT B;  1WX4 B;  3AWX B;  2JV8 A;  4NBA A;  2ZMX B;  2ZMZ B; 
#chains in the Genus database with same CATH homology
 2ZWG B;  3AX0 B;  2ZWF B;  1WX2 B;  3AWY B;  3AWS B;  1WX5 B;  3AWU B;  3AWZ B;  2ZWE B;  2ZWD B;  3AWV B;  1WXC B;  3AWW B;  2AHL B;  2ZMY B;  2AHK B;  3AWT B;  1WX4 B;  3AWX B;  2JV8 A;  2ZMX B;  2ZMZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...