The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
28
|
sequence length |
70
|
structure length |
70
|
Chain Sequence |
GSDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystallographic snapshots of tom20-mitochondrial presequence interactions with disulfide-stabilized peptides.
pubmed doi rcsb |
molecule tags |
Membrane protein/transport protein
|
source organism |
Rattus norvegicus
|
molecule keywords |
Mitochondrial import receptor subunit TOM20 homolog
|
total genus |
28
|
structure length |
70
|
sequence length |
70
|
chains with identical sequence |
C, E, G
|
ec nomenclature | |
pdb deposition date | 2011-03-28 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Mitochondrial Import Receptor Subunit Tom20; Chain A | Mitochondrial outer membrane translocase complex, subunit Tom20 domain |
#chains in the Genus database with same CATH superfamily 3AWR A; 2V1T A; 3AX2 A; 3AX5 A; 3AX3 A; 2V1S A; 1OM2 A; #chains in the Genus database with same CATH topology 3SFU A; 2D7S A; 2XTD A; 2ILY A; 1TP7 A; 4ZP6 A; 1UUJ A; 4NLY A; 4LQ3 A; 4K4U A; 1XR5 A; 1SH0 A; 3NAI A; 3AX3 A; 4K4S A; 3NAH A; 1WNE A; 3H5X A; 2ILZ A; 2IM0 A; 5F8G A; 4ZPC A; 2XTC A; 3CDU A; 4NRU A; 2XZ2 A; 2D68 A; 3N6N A; 4R0E A; 4WYW A; 4ZP7 A; 3KMS A; 2WK4 A; 4NLS A; 4NZ0 A; 4ZPD A; 4NLO A; 2E9T A; 2V1T A; 2CKW A; 3AX5 A; 4NLX A; 4Y3C A; 3UPF A; 1XR6 A; 4K4V A; 3UQS A; 4WZM A; 4Y2C A; 3N6L A; 3QID A; 1SH2 A; 4NLP A; 3UR0 A; 4ZP9 A; 1KHV A; 4NLQ A; 5JXS A; 4WFZ A; 4NLU A; 2IM2 A; 2V1S A; 1TQL A; 4LQ9 A; 3KOA A; 4WFY A; 3OL7 A; 5F8L A; 4NLR A; 2UUT A; 4O4R A; 4ZP8 A; 1RAJ A; 5F8I A; 4NLT A; 3OLB A; 2EC0 A; 3NMA A; 2IM1 A; 3AX2 A; 4ZPA A; 2IJF A; 4K4W A; 4WFX A; 5F8M A; 4K4Y A; 1KHW A; 3KLV A; 3NKY A; 4NRT A; 4K4T A; 3KMQ A; 4K50 A; 3OLA A; 4QPX A; 3OL6 A; 4ZPB A; 4X2B A; 4K4Z A; 2F8E X; 1U09 A; 3CDW A; 4IKA A; 2E9Z A; 3OL9 A; 4NLV A; 4WZQ A; 4NYZ A; 4IQX A; 3OL8 A; 3KNA A; 2XTE A; 4NLW A; 3SFG A; 5F8N A; 1SH3 A; 2B43 A; 1RA7 A; 1OM2 A; 2UUW A; 4Y2A A; 3DDK A; 5F8H A; 4K4X A; 2E9R X; 3BSO A; 3NL0 A; 2IM3 A; 4Y34 A; 4WYL A; 3AWR A; 1RA6 A; 5F8J A; 3BSN A; 1XR7 A; 3N6M A; 3H5Y A; 1RDR A; #chains in the Genus database with same CATH homology 3AWR A; 2V1T A; 3AX2 A; 3AX5 A; 3AX3 A; 2V1S A; 1OM2 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...