3AX5A

Crystal structure of rat tom20-aldh presequence complex: a complex (form1) between tom20 and a disulfide-bridged presequence peptide containing d-cys and l-cys at the i and i+3 positions.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
69
structure length
69
Chain Sequence
SDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic snapshots of tom20-mitochondrial presequence interactions with disulfide-stabilized peptides.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein/transport protein
molecule keywords Mitochondrial import receptor subunit TOM20 homolog
total genus 28
structure length 69
sequence length 69
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.10 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial outer membrane translocase complex, subunit Tom20 domain 3ax5A00
3AX5A 1OM2A 2V1SA 3AX2A 3AX3A 3AWRA 2V1TA
chains in the Genus database with same CATH superfamily
4NRTA 4X2BA 3KMSA 4ZPAA 3N6MA 3OL7A 4WZQA 2IM2A 1U09A 2XTDA 4NRUA 1TQLA 4NLPA 3OLBA 2IM1A 2V1SA 3KNAA 1SH0A 4Y2AA 3AX3A 4K4WA 4Y34A 4NZ0A 4IKAA 4NLVA 4NLQA 1RDRA 4NLOA 2CKWA 4ZPDA 4QPXA 3AX5A 2UUTA 4WYLA 4NLSA 1XR5A 2B43A 3OL8A 4ZPCA 4O4RA 4ZP7A 3OL6A 4K4SA 3NAHA 4IQXA 4NLRA 5F8HA 4R0EA 4WZMA 3N6NA 2XTCA 5F8MA 4WFYA 1XR6A 2E9TA 5F8IA 3SFUA 2IM3A 3QIDA 1RAJA 2WK4A 4K4TA 5F8NA 1SH2A 1TP7A 4ZP8A 5JXSA 4K4YA 3OL9A 3KMQA 2E9ZA 2IJFA 3NL0A 3CDUA 3BSNA 3NAIA 3CDWA 4K4ZA 3AWRA 2V1TA 2D7SA 4NLTA 1KHWA 1XR7A 4WFXA 2D68A 4WFZA 4K4UA 1KHVA 4WYWA 3AX2A 3N6LA 3DDKA 3OLAA 1SH3A 3NMAA 3NKYA 4ZPBA 3H5YA 3UPFA 3KOAA 4ZP9A 4K50A 4LQ9A 1UUJA 4ZP6A 2ILZA 2UUWA 1OM2A 4Y3CA 3BSOA 2ILYA 4NLUA 2E9RX 5F8JA 3UQSA 4Y2CA 4LQ3A 4NLWA 2XZ2A 4NLYA 5F8LA 1RA7A 2IM0A 2XTEA 4K4VA 2F8EX 2EC0A 4NLXA 4NYZA 3SFGA 3UR0A 4K4XA 1RA6A 5F8GA 1WNEA 3H5XA 3KLVA
chains in the Genus database with same CATH topology
3AX5A 1OM2A 2V1SA 3AX2A 3AX3A 3AWRA 2V1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AX5 A;  1OM2 A;  2V1S A;  3AX2 A;  3AX3 A;  3AWR A;  2V1T A; 
#chains in the Genus database with same CATH topology
 4NRT A;  4X2B A;  3KMS A;  4ZPA A;  3N6M A;  3OL7 A;  4WZQ A;  2IM2 A;  1U09 A;  2XTD A;  4NRU A;  1TQL A;  4NLP A;  3OLB A;  2IM1 A;  2V1S A;  3KNA A;  1SH0 A;  4Y2A A;  3AX3 A;  4K4W A;  4Y34 A;  4NZ0 A;  4IKA A;  4NLV A;  4NLQ A;  1RDR A;  4NLO A;  2CKW A;  4ZPD A;  4QPX A;  3AX5 A;  2UUT A;  4WYL A;  4NLS A;  1XR5 A;  2B43 A;  3OL8 A;  4ZPC A;  4O4R A;  4ZP7 A;  3OL6 A;  4K4S A;  3NAH A;  4IQX A;  4NLR A;  5F8H A;  4R0E A;  4WZM A;  3N6N A;  2XTC A;  5F8M A;  4WFY A;  1XR6 A;  2E9T A;  5F8I A;  3SFU A;  2IM3 A;  3QID A;  1RAJ A;  2WK4 A;  4K4T A;  5F8N A;  1SH2 A;  1TP7 A;  4ZP8 A;  5JXS A;  4K4Y A;  3OL9 A;  3KMQ A;  2E9Z A;  2IJF A;  3NL0 A;  3CDU A;  3BSN A;  3NAI A;  3CDW A;  4K4Z A;  3AWR A;  2V1T A;  2D7S A;  4NLT A;  1KHW A;  1XR7 A;  4WFX A;  2D68 A;  4WFZ A;  4K4U A;  1KHV A;  4WYW A;  3AX2 A;  3N6L A;  3DDK A;  3OLA A;  1SH3 A;  3NMA A;  3NKY A;  4ZPB A;  3H5Y A;  3UPF A;  3KOA A;  4ZP9 A;  4K50 A;  4LQ9 A;  1UUJ A;  4ZP6 A;  2ILZ A;  2UUW A;  1OM2 A;  4Y3C A;  3BSO A;  2ILY A;  4NLU A;  2E9R X;  5F8J A;  3UQS A;  4Y2C A;  4LQ3 A;  4NLW A;  2XZ2 A;  4NLY A;  5F8L A;  1RA7 A;  2IM0 A;  2XTE A;  4K4V A;  2F8E X;  2EC0 A;  4NLX A;  4NYZ A;  3SFG A;  3UR0 A;  4K4X A;  1RA6 A;  5F8G A;  1WNE A;  3H5X A;  3KLV A; 
#chains in the Genus database with same CATH homology
 3AX5 A;  1OM2 A;  2V1S A;  3AX2 A;  3AX3 A;  3AWR A;  2V1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...