3AXLA

Murine valpha 10 vbeta 8.1 t-cell receptor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
198
structure length
183
Chain Sequence
QVEQSPASLVLQEGENAELQCTYSTTLNSMQWFYQRPGGRLVSLLYEQRGGRLTSSAASRSSLHISSSQITDSGTYLCAIASSSFSKLVFGQGTSLSVVPNIQNPDPAVYQLRDVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Valpha 10
publication title A semi-invariant V(alpha)10(+) T cell antigen receptor defines a population of natural killer T cells with distinct glycolipid antigen-recognition properties
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 32
structure length 183
sequence length 198
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3axlA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3axlA02
3O3BA 2EDEA 3CDGA 4P5MA 3MRRA 4X4ZA 5E5RB 4MXWH 3P0YH 4LLAA 5I73B 1DZBA 1KTRL 2AJSH 3N1MC 4YHOH 1Q8MA 3EYOB 4YFLI 1VPOH 3ZL4L 1HQRB 4HC1A 4LK4A 2CGRL 5TDOA 1B0GA 1I9RL 3DX6A 5D5MF 4M00A 2OI9B 3QHFL 5ILTL 5EC2B 5ID0A 5K9JL 3RU8L 1XGQA 3GMPB 2H3NB 1R5VA 1XF5B 3KHQA 4CDHA 3FHQA 2VE6A 2CIKA 3W11D 3L7EA 4MDIA 2X4NB 1I3UA 1CFBA 1QBBA 3QIUA 4ZXBD 4BFIB 3Q5TA 1F58H 1ZLUH 2ESVA 1W0YT 5I9QB 5DFVC 3TM6A 2BSED 1EO7A 1KCRH 4IRSD 4XP6H 1JYNA 5LJYH 5C6PB 2NTSP 5I15L 3SKOB 4M5ZL 3P30L 1EFXB 3NFNB 4KUCD 4MD0A 4DZ8A 1FVEB 5IVXF 3EFDL 1C5CL 2QL1A 25C8L 2R4RH 1ACYH 5ISZB 4R8WL 4OZIB 3NIDF 1V7NL 3LKSA 4BSJA 1A4JB 3I3DA 5DQJB 3IDXH 2EC9U 5TJWK 5C0ND 3ULVH 4RGNB 3QXDA 1GIGH 1OLLA 4D0DB 5J57B 4I2XE 2AW2A 4GRMB 2DQIH 1S7XA 3UTPE 2IAMC 4QRTA 5JPNA 2DKUA 5F3BA 3QUZB 3KJ6L 3SDAB 5DUML 3CK0H 2YC1A 4JFYA 1A0QL 4HJ0C 3AREC 4YAQB 5IG7B 2APWA 5ACZA 4OCSL 3MJ9L 5FV1L 1BJ1H 5GRUL 3BYYA 2DM2A 4GRWE 5H8DA 5I19L 1RVFH 3DXAD 2V7NB 4NO0D 3Q3GA 5IW3A 1SHMA 3WLWD 3EDFA 4OIBA 3GMLB 3LKOA 3W9DA 3I6KB 4P3CL 3S88L 3P0GB 2IAND 4PJ8D 2FSEA 3OAUL 4APQD 2EDYA 4U1IB 1DFBH 4P4KC 1KN2H 4FNLH 1DLHA 3FO1B 2NPLX 5LWYL 1JZ6A 4Z76A 4ZSOE 4NT6A 1KLUA 3LV3A 4GKNB 4R3SA 4RMVA 4XZUA 1N5AA 4AEIH 1WBXA 5IGXH 4KJQD 1LO5A 3QCTH 3MX0A 3H9SD 2DLGA 1IMHC 2BC4A 1QFUH 2B1HH 2EYSB 5DWUH 1M7IA 3OL2A 1HNGA 4WO4C 2OS7A 5CP3H 3MRIB 2O5ZH 3TO4B 4M1DH 5D1XC 1CFTA 3RWHA 1F11A 4BZ2H 2DQUH 4YPGA 1PBYA 2XWJA 5KVMC 5KBNC 1QSZA 4JKMA 5MERB 5E2VL 1ZA6B 1NLBL 3STZB 2AS5M 4O2FB 1AR1D 3UJJH 1DN2A 3H9HA 2DLEA 3KPSE 4JO1H 4XVSL 3QI9C 1I9JH 4LEOB 4UT7H 4NHCH 3LZFL 3PWLA 5IW6A 1ZOXA 3MNVB 1E0OB 1K6QL 1U58A 5IB5B 2DIAA 1SM3L 1RUQH 1AGBB 1YN7B 4YDKL 3WNNA 4XMPH 1MCFA 1MFCL 4L4TA 5I1AB 4ERSH 3G6AA 1PD6A 1KT2B 1MCBA 3UO1H 3BPLB 3V6ZB 2ITCA 4NRYB 2CJUL 2AXGA 1H3GA 3U4EA 1AJ7H 4UT6H 2GHWB 1CI5A 1WLHA 3T4YB 4G6JH 4M3JA 4XXCC 3L7FB 1A5FH 3OKOB 4QRRB 4S1QH 4NPYB 3PWVB 1UZ6F 3ET9F 2X40A 4M7LL 2C26A 4QRUB 1FFNB 1YQ2A 5DTFB 5E4EB 3VRJB 1FBIL 1D5IL 4OZFA 3BXNA 2EYRB 1R24B 1NBZA 3E3QC 5BV7C 2PR4H 5E8OA 5GS0L 4PRPE 4JO3H 4MSWB 5LGKA 4X80H 2DLTA 1FVCA 4LLQB 1F4AA 1CU4L 4QF1B 4RRPG 2ITDB 4NKMB 1AQDB 4F15C 3WDHA 3SDDD 4HF5L 4KKLD 3D5OF 4J12A 1Q0YH 5JW4M 1AHWB 3AM8A 1PG7W 1S3KL 4JG1H 2Q8AH 3OX8A 4V1DB 4ODVL 1JPFB 2BRRL 4PJ5E 2H2PC 4PLJC 4JRXA 2D7QA 5CIPA 5IK3A 5FO9B 5I17B 1Y0LA 4HX1A 3FQTA 3HAEH 4RMTA 1OGAE 4EDXB 1U8LB 2BSTB 4XPHH 1MRCH 1B0RB 1SY6L 4UOJA 3BUYB 1GOFA 1EHLL 1OF2A 4HK3N 1MCIA 1I8MB 4R0LA 4TNWF 1CLZH 1QFWM 5IBTL 3O9WC 1RHHA 4PB0L 5AYQA 3VFTB 1QR1B 4J4PA 4KZDL 4KQ3H 4ELMA 1IC4L 3ZT6A 4I0CC 4WIQA 3DETC 3CDYA 5I6XB 2DBLH 5FDWA 4HC1L 2QSQA 2VDQH 1UJ3C 2OR7A 5D2NC 1QFHA 4NKDB 1FSKC 4R4FL 1P1ZA 1WIOA 1RK0B 4XCYB 1ZEAH 3CSYA 3V5DA 1FNGA 1X7QB 2A77L 5ID1A 4UOW1 3CUPB 1KJ2H 1FRGH 5IB3A 4HIEA 5D9SB 3RL2B 4PR5B 3QSKB 1NMAH 4PGBB 1FZMB 4NN6C 4PJHB 3RDTC 3KPLB 3HC4H 2BSRB 2YRPA 3VXQB 3TA3B 3E6FA 4Y1AD 5K9OA 2LVCA 4XX1G 2QQKL 3SDCC 1T7VA 4XBPA 1CFNB 3DX7B 4R7DB 3BZFB 4HZAA 2GSGA 1AI1H 2ICES 3ZLQC 1YDPA 1L0XA 5ITBL 1U8QA 5ICYA 5TF1L 4QHKJ 1BVZA 1KB9K 1HOCB 5DT1H 1BPVA 4HKXB 4WI9A 1BBDL 3PWPB 2VL5B 2YMXL 2PTTA 5ADOL 1KIPB 3RZCB 1TZGH 1A6WL 3VWJA 1T0NB 1NMBH 3TJHD 3C60B 1E4XI 1RY7B 5B3JF 3HNVL 4LVOB 3JV4A 4P2CG 2AK4B 4K94H 1FNAA 5SWZE 1QFWI 1XGTA 5LBSH 3NABH 3DURA 1NFDE 4Y88A 2QQNL 3RBSA 2R0KL 2F74B 1A7OL 2Y07L 1CDYA 3FT4A 5FV2A 1PSKL 3HC3L 4PY7B 4ZQKA 1K8IB 4HH8A 1CDCA 5GHWL 2Y6SC 2IPUG 1J86A 2A1WL 4G8FA 1GXEA 4R26H 4G6AD 1AY1H 3WJJC 2V9QA 4X5WA 3ARGB 5DURB 4LCIL 2C3VB 1K4CA 4MX7B 5DF0A 5F1KC 5CD5C 5FA3A 2F54B 3H42H 3CMOH 3GEWB 3AY4A 3U7AA 4U0RC 1P4IL 1N5YL 3MCKA 3BZ4A 1XR9B 4RMRA 4D3CL 2FGWL 3NIFF 5CBEB 2IANE 1FGVH 5EO0A 3MXWL 2A73A 4OD1H 2XZAH 3HI5H 4JY6A 4O5LL 4KJPC 4N8VB 4OLEA 3SPVA 4CN4A 2Y4SA 1T5XB 4HIIB 1OAKH 4LVHC 3CU1A 5HPMB 1ZANH 2PXYD 3TYFA 4OB5H 2B20A 1JWMB 4M03A 4MCZB 4HPOH 4YX2H 4I48B 4UOW0 4HUXB 1JGLL 1ZLVH 1N6QH 3ALXA 3P4MA 3MRMA 3PABA 1BEYL 2OR8A 3CVIL 5DK2A 5GJTL 4HCRA 4JFXB 2DMBA 3MLSL 2ADJB 2XA3A 4NKIH 3LB6C 2WBJB 4KK6D 5F1NB 2DQEH 5HI5C 5DQDH 1D6VL 4KAQH 2DTSA 1U8IA 3BP7B 5HHOA 4Z7WE 3QIWC 3L3OA 4ODWB 4DUXA 5H37H 4LGRB 4ORZC 3DUHA 4WFGE 1IAOA 1T2QH 3CDGB 1JTPA 4JO4H 4P5MB 3MRRB 3MZTA 1IM9A 3NACL 1UWEH 4HDIB 5JHLH 4N8VG 1A21A 5D93B 1HDMA 2R2CA 3EJYC 4POYA 3QUMA 4PJ7F 2HTLC 2ICWI 4UDTA 1S7RA 4WUUB 3WUZA 3MODL 5MENA 5ID0B 2E5EA 3O6FC 1XGQB 3IFLL 3V6OA 5F9JA 1BM3H 1DQQB 5E8DL 3IJSA 2GTZA 1G7LB 1U8OB 1RJYA 1CXLA 4LQFH 4MDIB 3HPLA 5CSZB 4PJ9C 2CK0H 4E41E 2R2HB 3NMEA 4KDWA 2ESVB 2XZZA 3KPTA 5D1QC 3DUSB 4MA7L 3LCYA 2BZDA 5C6TH 3ZKND 2ZUVA 3O4LD 5EUKA 1A1OA 4R2GC 4UUJA 4ZTPL 5F96L 3DV6A 3Q1SH 1VKXA 5DZNA 3RGVD 4KMQA 2VLJB 5CJOL 4OUUB 3UCRA 3ZE1E 4LLVB 4N8PA 1HSAB 4MD4A 1CXKA 3LKSB 3ULUL 4RAVB 4XNZC 5FIEA 2XOTA 3PP4L 4XPFH 2CSPA 4GRLA 4WI8A 5K59F 2UWEF 3KPQA 4ODXA 1BQLL 3BE1H 3EKCA 2FJGB 4NQEE 4TTDC 5D7IE 4QRTB 4MHHG 2HWZH 3F5WB 4JFYB 1VENA 4F2MA 2VERN 4JR9H 4LLYA 5EOCJ 4AYFA 5IHLB 4KPHH 5HPOA 3HZVA 2DD8H 2VXTH 1V5JA 4JM2B 3Q3GB 1TJGL 3EYSH 3UYRL 2BCKB 4L8SA 3HE6D 3T77A 5CHNB 4YUEH 3W9DB 3FFCD 2R23B 2NY4B 4LSSH 3V5KA 1J1OH 3IJHA 4OCWL 5ABDE 4KTEH 1YJDL 3HLAA 5A43C 2OL3H 1R0AH 1A14L 3ARTA 2XNAA 1J8KA 1GGBL 1X9QA 3NFPB 3O41A 4IHOA 4JDVA 1OL0A 1DLHB 3ALPA 3FQRB 1RV6X 1E4KA 3CXHJ 3UZVB 4HJJH 1I1AD 1VSCA 3F58H 3GKZA 2A6KB 2C1OA 3BKYL 2CRZA 4NT6B 1KLUB 3LEVL 2XG5A 2OCFD 4XZUB 1N5AB 2BVQB 3MOAL 4P2YA 2W9DH 3LN4A 4W70A 5CUSL 1UWXH 1U3HA 1C8PA 3BW9B 1FO0B 4HWZB 4TUKL 1MFAL 1PKQE 2CDEB 2YXMA 1D7FA 4G7VH 4D9QE 1CFTB 1IGTA 1F11B 2IH3A 2SEBB 1NGXA 1JMXA 3LY6A 5D6CA 3NPSB 3ZKMC 1BZ7B 1MI5B 3NCMA 4I18A 3GK8H 4Y2DC 1UFUA 3VG9C 5DD5H 5DMYA 3SJVD 2QSTA 2IF7A 3O3AA 3FMGH 4H25A 3GSUB 2UUDH 1AXSA 1T5WB 4OLYL 2B2XL 4G3YH 4YK4C 1NGZA 1E6OH 3GSNH 2PNDA 2GCYB 4CU7A 4FABH 1SJXA 3KYMA 4TSAH 4M43H 2UVFA 4AY0A 4KK5D 4EXPX 4P46C 4DAGH 4JG0L 5FGBA 4XMKL 1NCNA 4LCYB 4JLRB 2LTQC 4Y16C 3IU4H 4WENB 3RVWC 3WS3A 4XWGH 5BRZB 3OKEB 3AXLB 3QPXH 2VKWA 2YA2A 5SV4A 2VWEE 5L7XH 1CT8B 4AM0A 4RDQF 2JK5A 4KU1A 2E7LC 4X9IA 4ZOEA 5DDHB 1MFDH 3KG5A 2DWEA 1CDBA 3SO3C 2X5PA 2LU3A 4XCFH 1Q94B 2OXGA 2X4UB 4IRJA 3OR7B 1FCCA 3O6LH 2ZUQC 1YECH 1WUNT 2BOCA 5E8OB 2HJFA 2YD5A 4OCNC 1ZHKA 1F4WH 4NWTH 4OQTH 2W07A 4JPVL 2KZWA 4QTIH 3T0ED 5CEZD 3TPKA 1WK0A 4DOHB 2YD6A 3IETA 4R4BA 2IG2H 3ARFA 3V4PH 4OFDA 3UPRB 2GJ6B 2MKLC 1KB5A 1N7MH 3N9GH 4K3EL 4LU5H 1LP9B 5B21A 2A9NL 4YGAB 2HT4C 4XNQA 5E56A 1M05A 4NQVB 1QFPA 2ICWJ 4OFYD 4HCRL 1U3ZA 2HVJA 4MWFA 4JRXB 3UDWC 5AUMB 5CIPB 5FYLL 3IDMA 15C8H 1KJ3L 4PJXB 2OZ4H 3T3PF 3VE0A 3MLWL 4LNVA 1IKNC 1LO2L 1C16A 2EH8L 2VXSH 4NDMA 2NY3C 3S96A 2J8UE 1XZ0B 1Z9SA 4X99A 1Y6KR 4QEGA 5D1ZA 2W65A 3HZKB 5C2BL 5IFHH 1HH6A 5SWSD 3QUML 4Y5VA 4HPYL 4HMDA 1WTLA 3G04B 4LSUH 5GSVA 2DQCL 2FDBP 1JHKH 3V5DB 5J7CC 4M8QB 3BDYL 5IB3B 3HG1B 2AKRA 3QDGA 4MNHB 3E2HC 2F5AH 3FB8B 1ED3B 2DI8A 3RA7L 4OIIH 1I8LA 3E6FB 3RZWA 4H1LB 4G8GD 4PJBA 2V7HB 3KPRD 4PGZA 1YEKL 4LLDB 4XBPB 4TRPL 4X6CF 3PJSA 1XIWA 4JQVC 1Q9WA 5CD3A 1YDPB 4X7EC 3FHAA 3KXFB 5HBBA 4LIQL 1IGIL 5C09B 3C5ZD 3S98A 2IPKA 1MREL 3CH8A 4LPCA 4XTRC 5ACMA 3GSXA 3QDMD 2GUOA 2AI0H 3WXWH 1JNJA 4FQLL 3VWJB 3PDDA 4LVNC 1KCLA 1CS6A 3MGOA 2FL5B 3OPZH 4P57B 3UMTA 3OKYA 2X4QB 3PWJB 1TTGA 5I8EA 4X4YB 1T4KA 4KVNH 1JZ3A 3BRDA 2G75B 5FM5O 1B3JA 1OTUC 5TH2B 1QOKA 3UTQA 1QBLL 3MREA 4L4TE 4H1LG 4XPGH 3UBXA 2Y5TB 1DLFH 1QSEA 1Q9KA 4UQ3A 4ZQKB 3QO0A 3QPQD 4KKBC 1BX2B 4QY8B 5J56B 5TGBA 3CFDA 4OZHE 4ZO9A 3TH4T 2NXYD 2CLZA 2FX9L 5E5MA 4X5WB 4JB9L 2JELL 3GJEB 1WCBB 1OCWH 4TPRL 2FBOJ 4U1LA 2Q20A 3VXUB 1A7NL 2H9GB 3T0VA 5BQ7A 4F7MB 1AIFA 3VFRA 4ZD3L 4E42A 3MCKB 2P5EB 5J6GA 1VFBB 1H8NA 1NEZA 3U4BL 3S35L 3MCLH 2D03H 3DGGA 5EO0B 4JANA 4TNWK 3HE7D 3KGRA 1YMMD 2CLVB 4NRXB 4XAKE 5AZEH 3JZ7A 3LQAL 3R1GH 3UTTD 2EO1A 4NQTA 3ULUE 1I3RB 2ZOLA 4LRIC 1WBZB 3FQNB 3B9EA 3PV7A 2CRIA 3L5XH 4OGYL 3VCLA 1TMCB 2OTUA 5DK2B 4HD9A 2LU7A 2EKSA 3QNYA 1K2DA 1MCPH 5IW1A 1KC5H 1J0YA 5GS1B 2A6JA 1U8IB 2JCCA 3IDIB 5CZKA 5IIEA 4GAJH 2GJZA 4WGVB 3HMXH 2NR6C 4ELME 1IAOB 4FXKB 2YA0A 1IM9B 1T83C 4DGYH 4JY4A 3T4AA 4YQXL 5I1HL 2OYPA 3QUMB 2R69L 4K8RL 2X1QA 3MOBL 1A9BB 5LQBH 4UDTB 1HHJB 1MY7A 5ECJE 1PG7H 2CDGA 2R1WB 3LKPA 4DK6A 2VH5L 3S36L 1FJ1B 1MJUL 2P44B 1FORH 3F8UB 3OSKA 3FN9A 2X9WA 4M4PA 1EEUA 4NP4L 3D2UA 1X3DA 3RAJH 2XZCL 3HPLB 3T0XA 4JFDA 4S1RL 3HCVA 2G9HB 4YHLH 1K3IA 2QKIB 3RQ3A 1OD7A 1JIBA 5MEOB 3TCLA 3OBAA 1S9VA 3VD3A 4GMTH 4OM1L 5K9QI 4P49A 2AAVA 1EXUA 5EUKB 1A1OB 4Z7VB 3DV6B 5EZLA 4LLMA 3UTZB 4ZFFA 5MEQB 3S97C 3BYTA 1N6VA 4FP8H 1I7RA 4JZOB 1KB5L 1EVUA 2W9EL 4P2OA 2BY0A 4ZAKD 3T65A 1NMCB 3GHEL 4NM4H 3VI4F 3WNKA 1RIUL 1QSFB 4GRLB 2RB8A 2HA1A 3DRTB 4TNVK 4PV9A 3TPUA 3V95A 3KPQB 4DVRL 3PL6D 1Q9OA 3CVHH 4ODXB 5HHNA 3SKMB 5JW3H 4G6FD 1A6TA 5EU6A 1S7VA 4F58L 1JGDA 4PRBB 2JKXA 4U1GB 4IJ3B 1XF3A 1JV5B 5AAWA 3GKWH 1MSPA 5IFJA 3OXRA 1PJ9A 2BSSA 3GO1L 4K3HA 5C0BD 3EZ8A 3WJLA 3MLVL 2VN7A 4X8JA 4D9LL 5F93C 4FQQA 2NY1C 1GGIH 3QNZA 5IF0B 3GMRB 2NY5C 3HLAB 4CU8A 5J9PB 2OR9L 3GI9L 5E2UH 4X5XB 4HAGA 2XNAB 5EPMA 4BZYA 4U1JB 2IFGA 1CLOL 5EBWB 4JZJA 4WUKL 7FABH 4PJAF 4PRDB 4I0PA 2AJYL 3LPWA 4PUBL 5HY9A 3U46B 1ZV5A 2E7CA 4U2YA 4XHQA 3NAAL 12E8L 2C1OB 3JTTA 2AJZB 3IFOB 1YEFL 5KANG 1PVHA 3UTSA 1RULL 5DMKA 2AABH 2NNAB 3LN4B 4PRHA 3X13A 5IHZA 3ORJA 1CFVH 2E7MA 3IDYC 3UP1A 5F7LB 1HHHB 3MGTA 3WLWC 1JRHI 4ODUA 2IGFH 1FYTD 1IGTB 4IMLA 1ZLUK 2IH3B 2LAAA 5DJ2A 4DKDC 4KXZH 3L95A 5D6DA 2Y1VA 1K4DB 3SE4C 5EOQL 4Y4KC 1A1MA 5FYLE 5CWSA 4H25B 1LO0H 1FNEB 4G6KL 4U49A 4DKFH 3ZKQD 4HUWA 4M02A 5HHOE 1XT5A 1T03H 1TPXB 4PJCF 1BBJA 2FHFA 3VWKB 1UH3A 2X4SA 4YPJA 1CK0H 2QBWA 3CNKA 3C2SA 4DTGH 4OJFL 3O45A 1EFXD 3RWIA 1J9CT 3WXVH 2NX5B 1GVIA 3T3ME 1N3NA 5ISZD 5MENE 3NCFB 1IGYA 3PHSA 1I7UB 4FQ2H 1CR9L 2VMFA 3DX8A 4GKZA 4NQXB 2XA8H 5EFIA 4ONFH 4E9LA 2V2XB 2DWEB 2XI9A 2OQJA 1I75A 2H32H 1RIVL 4KRNA 3MBEB 3SGJC 5T1MA 3PDOA 3QUZD 5HGHB 2HJFB 3SDAD 1ZHKB 5HSFA 1DUZB 3HAEB 4QRPA 1KYOJ 4NFBA 2OLDA 3QQ3B 5F8RC 1F13A 4LIQE 4U05A 1G7MA 3NTCH 5L2KB 4R90L 3UYPA 4PB9H 1TJIL 2BNQA 3HNTL 4XBGA 5D7LA 1MIEH 4JQXC 3QJHA 4RFEA 4U1MA 1KIUA 5JOFB 4DGIH 1PEZA 1AKJA 5E5UB 2KPNA 4Z9KB 1N4XH 5KVEL 4M7JH 2BVOA 4IIQB 4PGEB 5DC4B 3VE0B 1UCBH 1YMME 5CJXC 3C5JB 2EKJA 4I3RH 3V52L 1CVRA 3S96B 1A47A 1LGVA 4NFCA 3MFGB 4LASH 4NCC2 3JVGC 5GGUA 1W0WA 2DI7A 3DMMC 1CE1L 3HAEG 1KENL 1DSFL 4Y4FA 4X4MA 4XNYH 2E8YA 3GRWH 1HH6B 4B7LA 4Y5VB 1KTDA 5T33H 3TO4D 2Z8WC 3RY5A 2C1PA 4BH8A 3QEQA 1AGDB 3VXTA 1I9IL 1RZ7H 2F19L 5DRXA 4U6YA 4V2BA 4NC0B 1IGML 4YDLC 2PYFB 3SBWA 4PP1D 2BJMH 1HHKA 2QHRL 4YNYA 1E4XH 1KTKE 3EIFA 6FABL 3FO0H 3CMGA 1DVFA 3FKUS 4OSUH 1QFWH 2YKLH 1HH9B 3JXAA 4FTVB 5GS3A 4UV7L 4LP4A 4OCXL 4U4BA 1V05A 4HK0A 2X1XR 1ZHNB 3CFEB 5ALBH 1BREA 3ZE0F 4WY7L 3B4NA 2IPKB 2CR3A 3QCUH 1PYWA 1U3YA 1F2XK 3BJ91 2APBA 1NGQL 5IBUB 3QXAA 3PF2A 2WK2A 2R0ZH 4H0HB 5F7EH 4HSQA 3VMPA 5F7DB 4HS8L 4HUUA 4MB4A 1FFOB 5FB8A 1YPZB 5LG1A 5L9DH 3N0PB 3IU3B 1MUJB 3HZMB 3L3GA 4KKAD 4G8IA 4C56B 3U30B 1A4KA 2ORBL 1NCWH 3TYGL 3DPBA 1A22B 1QSEB 3O2WH 1Q9KB 1T7ZA 4QTHA 4EI5B 2QADB 3TGXA 1C08A 4PV8A 2ED7A 2R15A 2AXHA 4W4NA 5FYJL 2VLRA 2ADFL 3CFDB 3HR5B 3V0AC 1AE6H 1Z6JT 3HI6L 4U1SA 5I1KH 4R4ND 5E5MB 3C5SA 2H2SC 5E8NA 2NZIA 3MLXL 3WNMA 3NOIA 4I3GA 1OPGH 35C8L 4XVJH 5C0BE 1DBMH 1UQSA 2ZUWA 2ZCHL 2EIEA 4NRZB 4V1DD 3X3FL 5HHPA 3X11A 2BFVL 5IBUG 2VXQH 5IWLA 1VGEL 1J8HA 1MCRA 1OSPH 2VWEC 3O8XA 3VFRB 3ROOA 4W6XB 1H3PH 5J6GB 1NCAH 5EUOE 3BH9A 2XZQL 1MCWM 4FN0A 4HG4K 3DGGB 3FZUC 5I66A 1JF6A 2W0LA 3GSRA 3RVXC 4PG9A 3VA2C 1UVQA 3S5LB 3QIUC 4CAGA 4C57C 2Z31A 1U8KA 1UCTA 5T3ZH 3U9UA 4TVSa 3F7QA 4MAYA 4R97C 5TE4L 4G6AC 4FMFA 4KDVA 1UGNA 2V5SA 4TSCH 4QHNB 2YN3A 1UH2A 3B9KB 3DSNA 1CCZA 1CDHA 4OIAA 2OTUB 1FL6B 1U93A 2FEEL 3NCCB 3CSPA 3GB7A 4ODHL 4NUJB 2W0KA 2FIKB 3MRDA 4RZCB 1FYTE 2XV6B 2JCCB 4N1EA 4OFPA 1XF4B 5HI3D 4N0CD 1S9YA 4AK1A 4LGPB 4UILH 3TA3D 4YR6A 2GJZB 2P5WE 5J12C 4PTTB 5EULV 2EEAA 4Z7OE 1TTFA 1UM6L 4MGXA 5CBAB 2EECA 1TVDA 1HEZB 1HKLL 2VDRL 3S5LG 4PJDF 5H37G 4B7IA 5D70H 4Z7QE 5KS9B 2IBGA 3BWAA 5LGJB 5JIIA 4OF5A 1C7SA 4R96B 3PWPD 4P2QB 4M48H 4PP2A 3RZCD 2F58H 3MRPB 3IFPB 3INUL 1N26A 1YC8A 5I74B 3QDGE 2WZPD 1AO7A 1UM4H 5J0BA 2AVGA 2VNCA 1KJMA 3D9AH 3ZO0A 4MA1C 1INQB 4PJBE 1LDPH 3BPOB 2AK4D 1VFMA 3MV7B 3R4DA 5E70A 2X4RA 4V2CB 1MPAL 1Z3GL 4I5BB 4XP1L 4OZIE 2EZ0C 5IQ9B 1KXTB 1S9VB 1UA6L 2P7TA 4L1DA 1F3DJ 4MZ3A 4J2XA 2YZ1A 3I02A 4PLNC 3C87A 2EE6A 4WW2C 1TNNA 3L3HB 4FFWC 1E28A 5A2JH 4LLMB 3K2UL 3ULSA 3U82B 5IMLA 3T08A 1E6JL 2WWKT 5JHDD 1AGEA 1UB6A 3JWDC 5I1LB 4G5ZL 5MEPA 2H1PH 1RUMH 4W81A 5F97E 2P8LA 5DURD 5JDSA 4U1HA 2RGSA 5F6IC 2X05A 1UXWA 5HHNB 1T2XA 1IFHH 2BHZA 3DTXA 5JIHA 2F54D 4MDJB 1JGDB 5HI4D 1U92A 1XF3B 1A02N 3HMWH 4RAHA 2J8HA 3OXRB 4BZ1H 2A0LD 5L6YL 3ZKNC 5BXFB 3FRPA 2J6EH 5IR1A 1QHPA 3S37X 1AFVL 3RGVC 4LCCC 1RJLB 4M1GH 2DICA 3QNZB 5TE7H 1P7QB 4DGVH 2HT3C 4YXKH 1WFOA 4QNPE 3GBML 2Q76B 1YEIH 1MHCB 2NY0B 1VEMA 4CDGC 4NJAH 1HN1A 3I75A 2P47B 3HUJA 3LSOA 3JTTB 3OMZA 5A2FA 1DBKL 1NGWA 4M5YH 2WBJD 3G6JF 3H0TB 5CJQL 3UTSB 5IB2B 1S7UB 3B3IB 4FXGB 5IHZB 1T20A 5IUSA 4HUMB 3WHE1 2FEDD 1RHFA 5DEGB 3K80A 2L4OA 3L3KA 4Z7UF 1ZGLB 2Q7NA 4ODUB 3HE6C 3KPOA 5LAXB 3WV0A 4U6XA 3U1SH 2CIIA 2HH0L 2D7MA 3VI3E 1EERB 1QRKA 3CU7A 4M6MH 4GG6E 1TQCB 3FT3A 1CICB 5EU3A 2ZG1A 1ZS8A 3BHBB 4KUCF 4WUUD 4O51A 1SJHA 1NFDF 1MHEB 1ZLSL 1W0VA 5CWSB 1WEJH 2EH7H 2WWMC 3TBSA 2VR5A 1QRNA 3EDEA 1FNSL 4OFIA 3D85D 2XT1B 3ULUC 4NO5A 3TBTA 1KBGH 4HUWB 4J1UB 2Z35A 1HSBB 3MUHL 5KVFH 3WKMH 4TSBH 4NQCA 4PREA 5GZND 4TVPL 5I75C 5TDPA 3MOQA 4G42A 2IQAA 1T6WA 1CE6A 2ARJQ 1G9MC 3BPCA 3BD5A 4XRCB 1DBBL 4R0LC 2VLJD 5CGYD 1IGFH 3QWRD 1N3NB 4J4PC 4Y4HA 3EO0A 3MRNA 2W59A 5DZOA 4GKZB 1LK3L 4HKZB 4XHJD 3OKLB 4RMQA 3WEXB 1MFBH 4JFDE 3M1BB 4WU7A 5I2IA 3QO1B 1J12A 4FS0A 1DN0A 4YHYB 1OAYH 3FB6A 3K3QA 3X3GL 1CBVH 3QXTA 2DDQL 2N1KA 4WFEE 1OGTA 4IDJL 4JFEA 4KK5C 3ARDA 2Y06H 3B2UC 1J0IA 3QZWA 1NGYB 2YBRA 3WHXB 4N0YH 1C12A 4JM2D 1YEJL 5DHVA 5EA0L 3DO7B 2R56H 1V7MH 2E3VA 2OP4H 4LARL 4XBGB 3AS2A 5M95B 4KH2A 3RKPA 2NY4D 4Q6IC 3MFFB 2R39A 3MZGB 3QJHB 4RFEB 4U1MB 5GGSA 3D3VB 2IFFL 1IARB 2V2WA 5EU6E 3WO4B 1MVUB 3OXSB 4Z7WF 2DJUA 1RZFL 1VGKA 4FQXA 3IDUA 3WHE0 4HEME 3RPIA 4GW1B 4JKWA 4PRIA 4ODSL 1EO8L 3MV9A 3BN9D 3CFBB 4XB8A 4ZUUA 3A6CL 3VD7A 3WD5L 1BFSA 5BMFH 2L0DA 1FLTX 4PJ7A 5FYKH 2MKWA 4FZ8L 3SOBH 4PY8I 4N9OB 1NDGB 3AUVA 3JWOL 3UPAA 5D5MB 1Q72H 5FYJE 2Q6WB 2YSSA 1VERA 4LDEB 3D18B 5E03A 3QEQB 2MQ0A 3V7AG 4MQXD 4M93C 1A6ZA 3VMNA 3X12B 4OM0L 1MI5D 4HIHA 3EHBC 3ARWA 1CFSA 2MHAB 2ZG3A 3EGSB 3Q6GL 4FG6C 4GXVH 5F9WC 3C6LB 2PO6D 4UV4H 3QG6B 3ARRA 2BK8A 4PRHE 1JNNL 1UZ8A 3BVNB 2VLLA 4OBRA 2GSIA 5IVXB 1ORQB 2F5BL 2IALA 1U95A 4MVBC 3WSQH 3ZE1F 4NBZB 3QUYD 5GGQH 1AR2A 1OTSD 2UWEA 4BQ8A 1YUHB 4OCYL 4OLUL 4J3WA 5BRZD 2DQHL 4IS6B 3W0WA 2R0LH 5C0EA 4PJFA 5DJXB 1PYWB 1A64A 1MJJB 5MP6L 5CS7A 4EQ3A 4LEXL 2F53D 1TVBA 5D7IF 4EZMA 1JVKA 2XN9B 3DYMA 2WW8A 5I1GL 5F21B 4MHHI 1UKTA 1R3IH 5GGTH 2OM5A 3HFMH 4LP5A 4ZNEA 4OLWL 1A9EB 1MCNA 3L3GB 4LSTH 5JHDE 4OZ4A 4G8IB 3QRGH 5HHMB 1RUPL 4UQ2A 1A4KB 3BX7C 5IROC 2ZKHH 4UIKL 1I85C 4WWKB 4PTUB 2G60L 4G7YH 3SE9H 5GRYA 1T21A 3QIBA 4HS3A 4NKOA 4WHDA 1QYGH 4FFZH 4JAMA 3RL1A 4HW6A 2RCSL 3RWGB 4OV6F 2YOCA 3N1GC 2GJ6D 3MJ7B 2B39A 5DC0A 5C08A 1OAQH 2NY2B 4C4KT 1IQWH 3ARBA 3EFFB 1QKZH 5HHPB 3K1KC 5C07D 1FL5B 1JWUA 3VGDA 2R1XB 4ACPA 1J8HB 3SGKA 3O8XB 4YFEA 1H0DA 4QRPE 3SGDI 1OARL 4UTAL 3EYUH 4L4VA 1B4JH 1EZVY 3BH9B 1AH1A 3SY0A 4WW1A 2H6PA 4HJGA 5AG8A 5C7XL 5I66B 1D5ZB 2K9UA 3M8OL 1UVQB 4G43A 4QOKA 2VDLH 4HXAL 1SEQH 2BNQE 4H88H 3DRQB 4NGHH 3VXMA 1U8KB 5D7LE 5CGMA 3U9UB 4MAYB 4DKAA 1RQ5A 4JFZH 2NXYC 3V5HB 4GMSH 4LPUA 4X6DF 2HLAA 1GPOH 5EBLB 5HJ3A 1RZKC 1FFPA 43CAA 4P4KA 4BQ9A 1U93B 5FDYA 3C8DA 3GB7B 5AEAA 4FQJH 3HG1D 4JM4L 2IPTL 4NM8H 2XXCB 2NY6B 1UB5B 5L0QC 5KSAD 5T1DH 3DSFH 3IDNB 3QUKA 3QAZC 5IFAL 1CG9A 4ETYA 3BJLA 1RFDH 1LO4L 2V5RA 5HGBA 2VO5A 3LVEA 3WIHA 3KXFD 4HFUH 1FL3A 5C09D 3G5ZB 4HXBL 3QBTB 5DJZA 4JGUA 4YE4L 4L8SC 2DL2A 3R8QA 1IZJA 1FAIH 3TIEA 2ICEB 2ICCA 4K9EL 5EU4B 2QEJA 3FCTB 3QI9A 5I71B 5HGDB 5ADPH 1D9KA 2RQ8A 3DWTA 4KRPC 4YHKL 2VAAB 2X4OB 3BAEH 4JFFA 3CVHB 2D7TL 1HXYA 5C0DA 3P77B 2AJUH 3LQZA 4K3JH 5F7WC 1E4KC 3NIDE 2GQHA 4TUOB 3P0YL 5LCVH 1P2CA 3LDBB 4MNQA 5IMLB 1IT9H 1E28B 1KPRB 2PCPB 5GRJL 3ULSB 5C3LD 4PY8J 5ITFB 1V8HA 1NFIA 1FVDB 1J1PH 1WZ1L 3O2DA 2UZIL 3UPCA 5MEPB 3GJFK 3PGDB 2F8OA 4XH2B 3V4UL 5AWNH 4NQDA 5JUEH 2P8LB 1IAIM 5JDSB 2I9LA 5EZOL 5F88A 1IC1A 1MIMH 5BS0A 5FHBH 5ESVA 2J8UF 3OB0H 3VXUD 1BFVH 4I18C 5DQ9B 5T3XH 2Q8BH 3U36B 3MUY1 1A3QA 5E1AA 1U92B 1HHIB 3MRFA 4TVPE 2VZTA 1JWSA 3ESUF 3H8NA 2KH2B 1R3KB 2ATPA 2P5ED 2FX7H 3SQOL 4ALAH 1M6OA 3IKKA 5DS8B 1OP3K 4LHUG 1F45A 3LH2H 1A2YB 5L88H 4M7KH 1ZTXL 2NY7L 1JNHA 2VDML 3RI5K 3SKNB 5IR1B 5L8LB 4UAOB 3BQUA 2R2EB 2VLRE 1P7KA 1C1EH 5E94B 4CNIA 4A2LA 4X7CC 5GZOC 3D69A 1PKOA 3MV8A 2PF6A 4Q7DA 4GFTB 4WW2F 3QFJA 5IM7A 4K8RC 2VZUA 4MJIA 4JPKH 2C3XA 1JZ7A 1KJVA 3I75B 3LSOB 1JMZA 4X6CA 2LVEA 3BGFC 3D25A 5D7JA 3VW3H 4QCIA 4QXGH 5F1IA 4RFNC 4UB0H 5C0AB 1CD8A 4X6FA 5C70A 3DVNA 4NNPL 1H5BA 2KQNA 3MLZH 4H26B 4IRJC 3FFDA 4OZGE 4KKCD 5KZCD 3BP5B 4JY5H 5D4QA 3P4LA 3OAZK 1EA9C 4U6XB 1KCUH 1IAII 3WS6C 1HIMH 1YNKL 4WFHE 4F7PA 3OJDA 1EJ6A 3KPPB 3ZTNL 1X5IA 5HD8D 4IRZH 4U1NA 3K7UA 4NHUB 4TYUA 1ZS8B 1Z2KA 4JN1L 1RIHL 1PLGH 4WJ5A 5IQ7H 1SJHB 3CX5K 3ARFC 2H8PA 3T1WA 3AS1A 1B9ZA 1KIRB 1QRNB 4N90E 1YMHB 3O3UN 3RY6A 5I16B 3TJEH 2XTJE 3TBTB 1H3UA 5CP7B 3WL9A 1A6VL 5IBLD 3ULVD 3MLRH 4X6BA 4ZO7A 1MQ8A 4QYOA 1GAFH 1XGRB 3A0OA 4NQCB 1GL4B 4WTZG 4YDJA 1IJ9A 4XT1C 3FO2B 4NSKB 5TDPB 3TIDB 2F53E 1TJHL 4WU5A 1UZ6E 3TF7C 4OZHF 5J13C 2IH1B 4XNXL 4M1DL 1CGVA 1RZ8A 2UVEA 1MLCA 3BPCB 4GBXA 4KROB 4WHCA 4ZFOB 4LOUC 4PJGE 1NKOA 1KTLB 4GRWH 4DUWA 5I1JL 4EN3A 5DC9B 1OP9A 2HJKA 5D1ZC 3NIGE 2VSCA 1INEH 4XVTL 5DJYA 1BQSA 4OF6A 1T1WA 1AO7E 3G5XA 4Z0XA 5CEXA 1RU9H 1QSFD 1F6FB 4GRLD 5AYUL 1H3WM 2WUCL 1XR8A 3K1DA 4P3WA 4UT7L 1TZIB 1H8SA 5I2IB 3FQXB 5JLZB 1DN0B 4KI5E 5DRNA 2Z8RA 1N6UA 1OGTB 2CKBH 1WQVT 4JFEB 3ARDB 1CDIA 1BF8A 2EXYD 4YC2B 1F3DH 3S7GA 1NUFA 5E6IB 1BVLB 1AD9B 4FQIH 5I0ZA 1I8LC 5MHSE 3PQYA 4XPAH 3T2OA 4ZFGH 1JF5A 5C07E 4MA8L 4RSVA 4UT6L 1N64L 2Z93B 1XIWC 1YY8A 4G6JL 4U1KB 3TBYA 4KQ4H 5B8CB 3WJJA 4OAWB 5DSCB 5HYSA 1WJ3A 3NFSL 4N0UB 5DUBA 1FYHB 4HBCL 4UT9L 1P5UA 2GIYA 1VGKB 3TN0D 4FQXB 2XKNB 2PR4L 5I0DA 4ONHB 4MJ6A 2PN5A 3MMEB 4JO3L 4ZUUB 3HRPA 3V0VB 3GSVA 5C0FA 4PJ7B 4IDLA 2IADB 3HB3C 1HILA 3ILQC 2EDWA 3C8HA 3OZ9L 5T1KB 3ARUA 2QSCL 4TQEL 1L7IH 4XPBL 4XMLH 3WUWA 1QSVA 5FKAA 3BSZL 2WINB 4G8EB 4ORGA 4DQOH 4B53A 3AAZA 1NCCL 1PAMA 1CF8L 1BAFH 4H5SB 5GIRA 1CFSB 2HTKD 3C08L 5TQ2L 1NLDH 3HUJE 1EEQA 4U0QB 3QEUB 4NZRL 5D72L 1AD0B 2GT9A 5F8QC 5SX5K 3W39A 1F02I 1YNTB 2DOCA 2VLLB 2GSIB 1MEXL 5SWQA 2VLKA 3FONB 3QIWA 1U95B 3VWKD 2IQ9H 4EUPA 2COQA 3QUXD 1H15A 1C5BL 4FOMA 5MI0C 3L3IB 3O2DL 1JPTL 4JFHD 3H7BB 4LAQH 4DW2H 2NX5D 4E5XB 5HVFB 3R0NA 1NAMA 3O6FA 4LCWA 4M7ZC 5DK0A 4PP1C 1MF2H 3O2VH 2B4CC 1E27A 3NH7H 1I3VA 2HN7A 4L29A 2AK1H 3BDBA 2GITA 3MBED 5BV7L 2D2OA 1X5YA 4UBDD 1KFAH 5D96C 4PJ9A 5JOPD 1G7QB 5JZ7D 5D1QA 3IS1X 3Q6FA 3MRKB 4L5FL 2D9CA 5FUOH 5CLWA 1FNLA 1MAJA 3V79C 3L3DB 3ARQA 4PJAA 4JQIL 4JKPH 5L2KD 3RL1B 3DROB 3M07A 1NSNL 2OTPA 1SEBA 1VFOA 1N0XL 1NMBL 3S8WA 3LEXB 5DUPL 3NIFE 2HKFH 1I1YB 1HQ4A 1IC7H 1LEIA 5EZIL 2ADIB 5EWIH 4KZEH 5E6ZA 1JWUB 3QH3B 4KK8D 1KCVH 3ISWA 4CBPA 2IAMB 2X4TB 4KKAC 5IKCA 5F6HJ 2EXWD 2HKHL 3G5YA 4L4VB 3NCJL 4P4RA 4LKXA 3AREB 4ZUTB 4Y19B 5IVZA 4HJGB 2ZSVB 3FT2A 3WFDL 2P4AB 2FYYA 4G43B 3UAJC 4NJ9H 3K74B 1AY1L 2OSLA 1F2QA 3IDJA 4PGDA 5DRZA 3TT3L 2W0FB 3REVA 4ZO6A 3FN3A 3EO9L 4PJCA 4P4KB 2XQYG 1VACA 4X0KB 1K8DA 4P2OC 1A3RL 4MJ2A 2P8MA 4PRIE 3MV9E 5ANMB 1J0ZA 2AGJH 5C0CB 3IXAA 1JZ2A 4Q2ZB 1T66D 1BHGA 1F90H 3QUKB 4LLUB 1FGVL 4O2EB 3HI5L 2VXUH 4LBEA 3PV6A 1CG9B 4FTVD 5DHYA 4JHAL 4WO4B 5FO7B 4HPOL 1JCKA 1ERNA 1TQBC 1YEGL 3GGWB 5D1XB 4BJLA 3GHBL 5CZVH 3WJLC 1A6UL 2YD8A 4XGZB 3WFEH 4KUZL 5DD1L 3MNWB 3ZL4H 1RJZA 4LHJB 5K9KA 4YXLL 3MRLB 2G2RB 2CGRH 3S37H 5KSBB 4XWOD 1A6AA 1I9RH 3DHMA 4NKIL 1YEHL 3QHFH 5ILTH 2GKIA 2PW2A 3PNWA 5K33A 5K9JH 3RU8H 3QI9B 5FM5M 1G7HB 3W2DH 3RVUD 3S35X 4JFFB 5D71L 3C8KB 5C0DB 4JZJC 4I0PC 3TBVA 2C9AA 1MOEA 5JNYA 4C56D 5EORL 4EIZC 3P73B 1UWEL 5HHVL 1F4XL 2YK1L 1WSST 3RBGA 5K59E 2UWEE 4G9FB 1P7HL 4EI5D 3L1OL 3LIZH 4RDQG 4W6WB 4Y16A 3W0WE 5I15H 3PP3K 4M5ZH 3P30H 4PJFE 3VFNB 1EV2E 1DQML 2B5IC 3EFDH 1C5CH 1UADC 4YHIA 25C8H 5I18L 1SYSB 3VDAA 1W72A 4R8WH 4CMMA 1YEEL 1V7NH 1CGWA 2I9LB 2XWTA 2X9YA 5BS0B 4Q74A 3P3YA 2Y25A 4U2ZA 1XGPA 5D6DC 5E1AB 1F4YL 1S9WA 4Z77A 1OLZA 2EIDA 4YEEA 3LOWA 2NTFA 4D0CA 1JWSB 5EDXA 4ZTOL 4U6VH 4JPWL 3KJ6H 1D5XA 1MCOL 1S7TB 5DUMH 2D31A 2YPKA 2QHLA 1ND0A 1A0QH 2CMRH 4OCSH 5BZWA 3MJ9H 5GRUH 5I19H 3FAWA 4F15B 4IBLT 4QXUL 1I1CA 4P2RB 3WFHB 1AP2A 2DLFL 1L9MA 3S36X 5C08E 4CNIB 1IQDB 4HK3J 1KACB 4P3CH 4HV8A 1HCVA 4RX4D 3MV8B 3S88H 3P0VL 4UNVA 3B9KD 3QFJB 5KSVA 4WDIB 4F7CB 3OAUH 1G1CA 4MJIB 2B0SL 2HWZL 2XWBB 3C09C 5I8CA 4I3SH 5LWYH 1PFCA 4KFZC 4PJIF 3P4NB 3PHOB 5E95B 3ZKXC 3SDXF 3DVNB 2A0LC 1QPXA 4QOKE 3O9WB 3VXME 1XGUA 4WI7A 2I26N 3WFCH 1J1OL 4MLIA 4ZS7L 2CDFA 2L7UA 1DANU 3S34L 5T5FL 1IL1A 5T5NG 1UJ3B 5D2NB 3BIKB 3FAXA 1FSKB 4U1NB 2A74A 1UYWL 3G9VA 5IEHA 5J6HA 4GS7C 4WJ5B 4P2QD 3KPNB 1NAML 3HRZB 5D7SL 2H8PB 5C0GA 4P5TD 5E2VH 3THML 2F8XC 4PJEB 1NLBH 3DI3B 3TFKD 3VGFA 2Y7QB 3K2MC 2VDOL 2AJ3A 5D2LF 3IFNH 2PTVA 5IMOA 4NN6B 3RDTB 4XVSH 3SCMD 4AG4H 1R3LB 1DQDL 3MV7D 4KWUA 4YDJB 3LZFH 3TP4A 3SDCB 2FEDC 3BIAX 3GJFA 5CINH 2WM0A 5HGGS 4WU5B 1K6QH 4M9PA 2Z91A 1SM3H 1WCQA 3VFVB 4YDKH 1RZ8B 3VH8B 4ZSOA 4HLZH 4M1CD 1MFCH 1OQOA 1RZIA 5DLML 4POUB 2BDNL 2VDNH 1ZT7A 3R06A 3DVGB 4Y4FC 3KS0J 4R7NA 2CJUH 3BGMA 3KLHC 3KWWB 3G5XB 4AT6A 3CSBA 5ENWA 5CEXB 2FBJL 1RZJC 4OLXL 3CGTA 3LS4L 1R5WB 1UENA 2OK0L 3EZJB 3I3EA 1NC2A 5EUOF 1FP5A 3EO1A 4WRLA 1FBIH 1D5IH 5L2KE 5DVLA 4L3CB 4J7RA 3TH3T 1ACZA 2BRQA 5ICZB 3LMJL 1F3JB 2XY2A 1RMFL 5GZNC 2GFBB 4WEMB 3SBWC 5E2WL 4I8DA 2DMKA 4F3FA 1WT5A 5GS0H 4Y5YA 4MNQE 3KPSA 1DVFC 3MRGB 4ZS6D 4XWGL 1CU4H 5HDBE 1XH3A 2VZ3A 4MQ7B 3UJIL 3VH8G 3W5NA 4POZC 5KTEH 1YY8B 4HF5H 3JTSA 3TBYB 4NQDE 1P7QD 1PZ5A 4GSDL 5CMAA 2VISB 3RWFA 5HYSB 4HIJB 5K93A 5GGVY 5DUBB 1JZ8A 2NY0D 5FGCE 2BRRH 3S9DB 1YEDB 4RBPH 3T8XB 4DWHA 4AQOA 4Z7OF 4U0RB 1F4WL 3MV11 8FABA 3LS5L 3K4ZA 2FR4A 1LD9B 1OTTD 3GSVB 4PJDA 5C0FB 3TZVA 1SY6H 3AB0C 3CPLA 1EHLH 1IAKA 2HP4A 2ZUTA 5IBTH 4LMQE 2X89A 4LVHB 4FQCL 1URLA 4KZDH 4LU5L 4Q97A 2FH6A 4FFVD 4L8BA 4F7EA 4BQBA 1K5NB 3MYJB 4HC1H 5GIRB 1CICD 5JA8B 4GQ9L 1KXQE 4R4FH 2NLJA 4ISVB 4X6CE 2CXKA 3DIFB 5HYSG 1G7PB 2A77H 5ETUA 1U6AL 3HC0B 3W39B 1O5DT 4OZIF 4OGAC 4NNXB 3BN9C 4JRYA 5C8JB 1TZHB 5JW4N 5SWQB 2VLKB 3QIWB 1BD2B 2A83A 2LABA 5IWLC 5JMRA 4PJ5A 2QQKH 4JCMA 4KHXL 4OTXL 1DEDA 5C71A 2W60A 3P11L 4J6RL 2NZ9D 1D5MA 1I8IB 1JPSL 1VFAA 4MQXC 4K7PL 5ITBH 5TF1H 1W72L 4X4XA 1KIQA 3HI1A 1TETL 3NA4A 3L5JA 2YMXH 4PRAB 2PO6C 5ADOH 5H35A 1AGFA 1A6WH 4HAFA 2F5AL 1L7TL 4OIIL 1PX4A 1IRAY 1IEHA 2A6DB 1FIEA 5F9OL 4L3EB 4CADB 4EIGB 3QULB 3F7YB 4PJ9B 4HKBB 4XNMA 1FZJA 5D1QB 2QQNH 1DQLL 3QEGL 2R0KH 3V0WL 3GIVA 1A7OH 3SGDH 2ZNXA 2I60L 2Y07H 2EDFA 1LK2A 2XTJC 3QUYC 2E27L 3VFPB 1OTSC 3FQUB 1PSKH 3HC3H 4PBXA 4R2GB 2OMBA 1FG2B 1OY3B 4KK9C 3RUGB 5GHWH 3TNNA 2WBWB 1ZHBA 1CL7L 2A1WH 5EZJB 3JWOC 3WXWL 1SEBB 4CW1A 4XNZB 4HS6A 3G6JA 1WAAF 1HQ4B 3D3VD 4XP9L 4LCIH 2ATKB 5FEBA 2BMKB 5DMGC 3G08A 3A67L 5DJAB 5ACLA 4Z7UA 5IKCB 1JHTB 4PG2C 4ZXBA 3KJ4C 4P4RB 3HN3A 1P4IH 1DLFL 3SHSA 1N5YH 1RPQA 2HMIC 5E9DB 5B39A 3PQYE 4IRSA 4D3CH 2FGWH 2ZNWA 3EAKA 3MXWH 4HT1L 5F7YC 4GG6F 4O5LH 4KI5C 1H3VA 1NFDA 3BD4A 3F12A 1NBYA 2MPAL 3IDJB 1JGEA 2HVKA 1LVEA 3V4VL 4MB5A 1I4FA 2HG5A 3REVB 4LPXA 1G0YR 3EYFA 5IEKA 3MRCB 2BVTA 1JGLH 1VACB 3B43A 3P9LA 1K8DB 3MO1B 3C6LD 2P8MB 2D7OA 2R29L 3CVIH 2P43B 2VTFA 2YPLE 5GJTH 3MLSH 1OSZB 1FZKA 1P4LB 2O61A 5JXED 1G7IB 3PV6B 3DXAA 3OR6A 4NO0A 4QXTA 5DHYB 4HWBA 3EDJA 5KJRL 2X1WL 3BP4A 1NBVH 1VADB 3U7YL 4KJYA 3NACH 4GH7B 4BFBD 5FKPA 3V6BR 3HS0A 3BEVA 2Z4QB 2IANA 4Y2DB 4PJ8A 4UTBL 3VG9B 4APQA 4GQPH 5K9KB 4CVXA 4Q9RL 3SE4A 2VXVH 1EK3A 1A6AB 2XN9D 2NW3A 3VXOB 2FEEI 3MODH 2M8XA 3U0PA 2PW2B 5GRXG 3A6BL 2I9TA 3IFLH 4DVBB 1DUYA 4XC3L 1D5BA 5E8DH 4OZFH 3VFMB 5KSAC 5I76B 2EYTB 4YK4B 5BVJA 1A1NB 1T1YA 4YH6A 3VXPA 3HMXL 3RWEA 3ZZ1A 1RSFA 3H9SA 4I9WD 1OP5H 3NN8A 4LNRB 5HHMD 1R5IB 4P46B 4DGYL 1ZE3C 2AEWA 3ABZA 5JQ6L 4WWKD 3T2NL 2LTQB 4Y16B 4KC3B 2DM7A 3WMSA 1YYML 1G9NL 4ZTPH 1PG7L 4JFQA 4Z7WA 5F96H 2VZVA 4XCNA 5CJOH 3PIQA 4LCWE 1JTOA 1IEAA 3MJGX 3ULUH 1LE5A 4OI7A 3PP4H 5I1IL 3IF1A 3SO3B 1NJ9A 2ADGA 5CFHA 2CR6A 5EIQA 5CIPH 4Z77B 2ZUQB 3CLFH 5HVHC 3O8XD 1EMTL 3VA6A 4N5ED 2NTFB 1X4XA 2ZZUT 3O81A 3OV6A 1D5XB 2C3GA 3IJYB 3DECA 3T1FA 1QO3A 3KYOB 1KB9J 2YD4A 4PJHF 4PJAE 1S7QB 1ZSDB 1LWRA 4FQPA 1TJGH 3UYRH 4WNQA 1S9KC 2JLLA 1OB1A 3IXTA 1HYSD 2EEBA 1IGCL 4HV8B 4JQXA 3X14B 4OCWH 1KLGA 3OKDB 1YJDH 5JW3L 2Y23A 1A14H 2IBZX 4HUVB 1GGBH 1YN6A 3HA0A 4Y4HC 4YDVB 4C83A 3TWCL 3PHQB 4BELD 2NY6D 3BKYH 2NY3B 3TVMD 3LEVH 3NZHL 4K9EC 3MOAH 3JVGA 5GSRB 3LKQA 5CUSH 4KY1L 4YLQT 4I2XB 4RWYL 4NQEA 5FFLA 1XGUB 5D7IA 5J1AA 4LF3A 3SDDA 4YHML 5EG6C 1MFAH 4CVZA 2EDQA 4FQHA 4YO0A 4QHMB 5HDQL 3MRHB 4PJCE 3BGAA 4GRWB 2A74B 4MMZC 5J6HB 3BEWB 1S5HA 3D0VA 4WWID 5J3HC 5C0IB 3E2HB 5IMOB 2C5DC 1BQHA 5FO8A 4OLYH 1CGYA 1ZT4B 4ODTL 4LHUD 3GJFB 1M7DB 3GSWA 1T22A 2CKBB 1M4KA 1DL7L 1B0WA 4JG0H 4X6EA 4ZSOB 4DCQA 3W5MA 4XMKH 1JFQL 5DVMA 1ZT7B 3R06B 2GW5A 4LSRL 1JF1A 3BGMB 5B4MD 3BKJL 5ENWB 1CWVA 1XCQA 4P9HH 5DYOA 4LVNB 3NBNA 3HPJA 2V6HA 1U8HA 1WZLA 4O9HL 1NC2B 4DKFL 1P6FA 5IBLC 1XEDA 5HYEA 4Y1AA 1XGYL 5FF6B 3NA9L 4JHZA 1G9EA 1WWAX 3QHZL 2XPGA 1O7VA 4NO3B 4X6DA 3PGCA 3VXNB 3JV6A 3KPSB 3ZSTA 4JPVH 1CGSL 4AMKL 3WIIL 1XH3B 3P40A 5JO5B 3S4SA 2HFFB 2NY5L 1NQBA 2VJXA 5IV2A 3R0MA 5F1OB 1ZHLB 4HUKB 4K3EH 1E4WL 2A9NH 2YEZB 4X7DC 1INDL 3FRUA 1RUAL 5IJKC 3MCG1 4NFDA 5CKAA 4HCRH 3L6FA 3EOYG 4YHPA 5FYLH 1KJ3H 1EX0A 4QGYA 1ZWIA 3GSQA 3MLWH 3PUCA 4NYLA 1BMGA 4YGVB 1LO2H 4LQ1A 5C0AD 2FR4B 3AU1A 4R9HA 5J8OA 2YUWA 5FOBA 1AQKL 3NTCL 3KLAB 4HWBL 1IAKB 4IOIB 1OM3L 3QJFA 1EAPA 5C2BH 4MXQD 5JTWA 2X6MA 4PRPB 3ROLA 3QUMH 2BY3A 4HPYH 3KDMA 1CD0A 3QIBC 1EGJA 3BUTA 3CIQA 3WO3B 1JJUA 4N1CA 2GAZB 2IBBA 3TN0C 3BPNC 4JZNA 2Z0BA 3C9NA 4PIRF 3ZE0E 3BDYH 1HNFA 2K3TA 4HZLA 5HHXL 5H2BA 3ARBC 2CH8A 5ICXA 3RA7H 2A83B 3TBWA 5HHQA 4PJ5B 2RFXB 1OW0A 3SGKC 1F6LL 4WI5A 3O11B 1YEKH 4JEGB 4N68A 3DX9B 4TRPH 1MCHA 2W60B 4U6HA 1SQ2N 1OGAB 2PXYA 4KROD 1UXSA 1I7TB 4QGTA 1D5MB 3O6KL 1MLBB 1MCEA 3QNXA 2J8UA 4LIQH 4QHKI 4CVWA 1IGIH 5AZ2L 3GMQA 1MREH 5ESAB 1ZLWH 2HTKC 4JM2F 3QA3A 1B88A 1MAML 3LRSA 1FPTL 5ESQB 4FQLH 1I7ZA 3JV0A 3OWEA 3B6SA 2KL6A 1OAXL 3P9MB 5DD6B 3AVEA 1VDGA 4AIXA 2LV4A 4CRPA 3BOVA 5DRWA 2ZSWB 3E8UL 2JJSA 4XNMB 1EHNA 3U0TA 5C2UB 4RQQA 3GIVB 4JFED 4C54A 3QRFM 3TV3H 3ARDD 1CFQB 4GUPA 1QBLH 3IAGC 1LK2B 1ES0B 3GUTA 3QUXC 5E6ID 2PYED 4WW2A 4K7FA 4JHBA 2EE2A 3KS0H 4ZOAA 4L8CB 1ZVHA 4HS6B 1MRDL 2R1YA 3IDGA 1F5WA 5GGRA 2JB6A 2FX9H 3ZT5A 4JB9H 2JELH 4TPRH 3G08B 1M71B 4K71C 1IE5A 4D9RD 4J23A 1A7NH 2JB5L 1PQZA 3MRJA 4OZGF 4D0BA 4RMUA 4UBDC 2NW2A 1I8KA 4WHTB 4RNRA 3FQWB 2ARJB 5DI8B 4BH7B 4ZD3H 3B83A 5B39B 2FZ3B 4KRMB 1R3HB 5EOTA 1D9KC 2XKUA 3U4BH 3S35H 3HKFA 3O4LA 2HFGH 4YHNA 5T1KD 5SWZB 4NNYA 1NFDB 3RGVA 4LCCA 1SJEA 2NY1B 4DN3H 1NBYB 3LQAH 2FO4A 2HG5B 2YWYA 2QJDA 3OKNA 3GMNA 2DKSA 5JORA 4UIMB 3W9EB 1T7YA 1K9TA 1D6EB 3VFUA 2VDPL 4JCLA 5EIIB 4KXZI 4OGYH 5I8KL 5TF0A 1T1ZA 1H3PL 4OZHA 1DCLA 1YZZA 2EXWC 3VU2A 4PJDE 4DN4L 3M17A 4GW4A 2OTWA 4PJGF 3IDYB 5A3ID 2CUIA 4NZTL 2XIDA 5TDNB 3RTQC 5B39G 5I30L 3NIGF 3BP4B 3F7VB 4YXHL 3HE6A 2B1AL 1J11A 3FFCA 1T0PB 3HS0B 4Q0XL 3LRHA 4CL7A 2C7UA 2R69H 2IANB 3BQUC 4O2CA 3MOBH 3RNQB 1NCBL 3RKDD 1BIIA 2DYPD 2IMMA 4Y4KB 1QLEL 4KI5F 1PGRB 3QDJD 4WFFD 2P24A 3U0PB 3S36H 1I1AA 4H8WL 3V2AR 1MJUH 4JRYE 4JDTL 5DJCA 1IGJB 2H26A 1LP9F 4NP4H 4UILL 4GAGL 5DJ8B 3VFGL 2VSDA 1T1YB 3VXPB 3RWEB 3VXSD 3LN5A 4S1RH 3NN8B 3V9FA 4K94C 5D7JC 5FK9B 3G6DL 3WYRA 5DFVD 5E8EB 4PJXF 1I1RA 1BLNA 4JPIA 4ZYKB 3JUZA 1ZA3A 4OM1H 1P84K 1H5BC 1SMAA 1BFOA 4JFQB 3QQNA 4Z7WB 3RVTC 3MBXL 4JDZA 4XCNB 5FHAL 3BP6A 1KELL 3PIQB 1KB5H 2W9EH 4K23L 5T3ZD 2FHBA 1IEAB 5FCUL 4UU9A 3GHEH 1BZ9A 3SJVA 1RIUH 3C2AL 3EOBA 5E6YA 4PRNA 2J88L 2WIIB 3D0LB 2ADGB 4DVRH 3U48A 2MTPA 2A6IB 2IAMD 2XFXB 4NOFA 4F58H 1IM3B 3RY6C 2GK0B 3ARED 1MH5A 2O93L 1ETZB 3VGAC 4Y19D 4EDWH 4B0MM 1NAKL 4N9GA 3VG0L 4NWUL 4O02L 3OGCB 3GO1H 2FJFB 3G5VA 5C9JB 2W92A 3MLVH 3KYKL 5BJTB 3MR9B 1T80A 3MA7A 4E41B 1VA9A 4F7TA 3HUJF 4D9LH 3G6JE 3H9YA 1OB1B 3IXTB 4Q6IA 4QHLA 1DTUA 3MUGB 4XC1L 4U7MA 4TOYH 4GBXC 5E8PA 1EGJL 2OR9H 3GI9H 4EN3C 5GGTA 3MTRA 3TNMA 1JGVL 3QDAA 1YN6B 3OHXB 1CLOH 4Z7UE 3A6OA 4WUKH 1EEZB 2AJYH 4PUBH 1V3LA 3NAAH 12E8H 5C0CD 4LSVH 1CIDA 1A7QL 1FV1A 1NDMB 1YEFH 2DKMA 3ESVF 3MLTB 3T0EA 3DMMB 3GMMB 4LCUB 3BISA 1S9XA 4NQEB 1C5DA 5D7IB 2DS4A 3CLEH 4MJ4A 5E00A 4WO4D 4DGVL 1JYVA 4CVZB 4PYHA 5D1XD 4DEPC 3U0WH 3EYVA 5CJBA 4YO0B 1YEIL 5D7KD 5IMMB 1CN4A 3IVKB 5E0QA 3I3BA 4IOFC 4OFYA 3IT8D 4PLKC 4BM7A 2VN4A 4YDLB 5IJVA 5IB1B 5EOQH 3GIZL 1S7WB 5E08L 1WC7A 1OAUL 5CILL 1CDUA 2DQTL 1BQHB 1FN4A 4G6KH 1L0YA 4TNVF 4UINH 1MJ7L 4P23D 4YWGL 4BFEA 3DXAE 1RURL 3B5HA 4QHUA 4E0RA 4AIZA 5F3HB 4RAUA 3U1SL 4G9FD 5SWSA 1Z5LB 32C2A 4S0TD 4DZBB 2Q87A 1IC5H 4OJFH 3JWDL 3FTGA 2D4FA 5KG9A 3PE9A 4HLZG 1A7RL 5EBMA 1XCQB 2DTML 2EH7L 4P5TC 3HPJB 4QRSB 1B6UA 1PKQB 5AG9A 1CR9H 1U8HB 2APXA 3RVVC 3SO5A 2CO7B 2PYEE 3SCMC 2AV1B 3H9SE 1RIVH 4G8GA 2W9LA 1BQHG 2V2TB 3JWNC 2P45B 3KPRA 4PGCA 5IROA 3CFIC 5HVWA 1N0LA 1I85A 3JV6B 3STLA 1BOGA 2Q7YB 4I0KA 4XI5D 4XXDB 5T1LD 5HYQA 3C5ZA 5FUZL 4AH2B 2GTWA 2VITA 2KQMA 3QDMA 4JFPA 3O3BB 1TJIH 4P2RD 3OAYK 4R90H 4MNGE 5IHUH 3SKJL 4Z5RA 3HNTH 1MELA 5HYJD 3B5GA 4C55A 4H20H 5AD0A 3S3PA 2IPUK 2VQ1A 3FRUB 4OFVA 5TDOB 4AL8L 4PLJD 1KCKA 3JSSA 1B0GB 3DX6B 3MJ8A 4F57H 4YHPB 1KG0A 5KVEH 2DB8A 1ZWIB 1G6RA 2Y06L 1R5VB 2AV7A 1CQYA 3V52H 2PETA 1KEML 3NCYP 1MHPL 2CRMA 2EE3A 3WLBA 2VE6B 4P9MH 2CIKB 5BZDA 3L7EB 3NCEB 3O9WD 3ULVF 1V7ML 4F37F 1CE1H 1KENH 3QIUB 5A2KH 1EAPB 3D1MC 4LL9A 2BOBA 3V6FA 4R97B 3T2QA 3QR2A 4JJ5A 3U9PH 4HIXL 1N8ZA 4LVEA 4MD0B 4DZ8B 1I9IH 4Z7VF 1HXMA 2AQ2A 2NY0C 1JUFA 2F19H 1G7JA 1P4BL 4GW5A 2XRAL 4JZNB 4CUCA 2CUHA 3BN3B 5EB9A 4HZLB 1LO3L 5KN5A 3RDTD 1TITA 2ERJC 3FB7A 5ICXB 1OTTC 6FABH 3QXDB 4B5EA 4L8DA 3CFKA 5B3NA 3P2TA 2QSVA 3DUUA 1LNUA 3SDCD 4EI6A 5J12B 3BI9X 1S7XB 4PJFF 5JPNB 3HE7A 5F3BB 1WWWX 3Q5YA 5I8OL 3DBXA 1YMMA 1G9ML 4YDIL 5CSGA 3QDJE 4WFFE 2YC1B 4UV7H 3UTTA 1UXSB 5ACZB 3PGFL 4JFOA 3J8F7 1XF1A 2J8UB 1NEUA 2AEQL 4WY7H 4FFYL 4Y2OA 5E2JA 5EO9A 3J7HA 3VXSE 2E6JA 4OCRL 3LKOB 3FOLA 4G6ML 1NGQH 1QEWA 1B2WL 2AJXL 3CDFA 2FSEB 4FXLA 3HNSL 4HS8H 1AXIB 4Q9BA 1JL8A 2QR0A 4Z76B 4GUPB 4RBPK 2ORBH 4NBXB 2V5MA 3QQ9D 3TYGH 3LV3B 4YBQC 1ZT1A 4R3SB 1WBXB 2EO9A 4WW2B 3ZHLA 3QG7L 1LO5B 1VEPA 2ZJSL 4K7FB 4O4YL 3IGAA 5FYKD 2BC4B 1CD9B 1YQVL 1RZGA 4KV5F 4ZPVA 5FYJH 2CXGA 2ADFH 4KTDH 1M7IB 2R1YB 3HI6H 4PJIA 2R8SL 3MNZA 3UC0L 3RWHB 3SDXA 4YPGB 5F6IB 5GGTL 2XWJB 3K8KA 3MLXH 4EBQL 2DWDA 35C8H 1LEKA 2YPVL 2ZCHH 1MWAA 4LSTL 4Y1AE 4QRQA 5DA4A 1PQZB 1VGEH 3QRGL 5KSUA 3GSOA 1NGPL 3BRGC 2HFEA 4RNRB 4X6DE 3QXWA 4F9PA 3H9HB 3VMOA 3CCHA 5CEZL 1IKFL 1FAKT 1CLYL 2QLVB 3PWLB 5IW6B 1Q9LA 4HWEL 3L9RA 4PGJA 1QQDA 3RGVB 4LCCB 1A7BA 1U58B 4J3OC 4BKLA 1ZMYA 4NO2A 3K46A 1RK1A 2J12B 1KCSH 2MNUA 4WEBL 4ZAKA 4L4TB 5D2LA 5TE4H 4RGOL 1J0KA 3ARXA 4TTGA 3G6AB 5JORB 3VXRD 4IM8A 5TPWL 3PL6A 4O58L 2ITCB 3BZEA 2AXGB 3U4EB 5TQ0L 4Q58C 4Z8FL 4ZDHA 4OZHB 1G6VK 3DOSA 1FZOA 3M17B 5C0JA 4GW4B 4ENED 1EEYA 2ZWLT 2OTWB 1NANI 4OZFB 3BXNB 2YR3A 1BD2D 5C0BA 2VDLL 1NBZB 4NGHL 3WFZA 3HE6B 4JHWL 3WS6A 1FVCB 5EUOA 1HKLH 1OAZL 1T3FA 2VDRH 1HZHL 2C7UB 3PDGA 1JN6A 4O2CB 1IZKA 1U8PA 1FG9C 1BIIB 3UZQA 2W38A 1KOAA 5GISH 1DE4A 4A6YA 2ZG2A 3N1PC 3OX8B 4HMCA 4L3ED 3NZ8A 5E1HB 1RUKL 5HDBF 3H3KA 2I5YL 5IK3B 1RFDL 5I75B 2B7DT 1Y0LB 4HWNA 1DBAH 5LVEA 4HX1B 3FQTB 1MPAH 1Z3GH 4OZFG 4XP1H 2NXZC 1BLNB 8CGTA 1FYTA 1OF2B 3L5IA 4XAWL 4R0LB 1FHGA 1RHHB 1E6JH 3OGOE 3BT2L 1HQRA 2P5WA 1GZPA 4K3GA 1WFUA 4ELMB 3UROR 4G5ZH 4ETQA 1BZ9B 5EC2A 5FDWB 4XBEL 1XF5A 4OD2A 1P1ZB 1X6LA 3N1QC 4TTDD 3CSYB 1FNGB 1G6RL 1ZK9A 4DFIA 5ID1B 2X4NA 4EOWL 5J11C 4BFIA 4OI9A 4HIEB 5HYJE 3BZDA 3STBA 1DQJA 5E9DD 4N9GB 5ERWA 1JGUL 1X4ZA 4A2MA 5L6YH 1IAMA 4S1SL 5K9OB 1EFXA 1J1PL 1Z9MA 1Q0XL 3MA7B 1AFVH 4Q6IB 4QHLB 5ISZA 2GSGB 4OZIA 2HAZA 2EC9T 4MD5A 1U8QB 5ICYB 1MIML 4ZUSA 1GCFA 1RZKL 4TULL 3GBMH 3FO9A 2VKXA 4UDUA 2DMCA 2DQJL 2PTTB 4GRMA 3I2CH 4BUGA 3QUZA 2DQGL 1DBKH 3SDAA 4DKEL 5IG7A 5CJQH 3JV4B 4DK3A 1UH4A 3ZDYE 3O4LE 1V3JA 1YPZF 1S9XB 1XGTB 3DURB 1C5DB 2DQDH 3MYZA 2V7NA 1JRHL 3ZHKA 5DFTA 2VABA 3GMLA 2V5YA 3QHTC 4B41A 1OP5K 3FT4B 1WT5C 3I6KA 4Y5YC 7CGTA 4RWHA 1HYSC 4M93B 2OJEA 2HH0H 4Y2DD 4AQ1B 4G8FB 4U1IA 5F9WB 1BGXH 1G9NC 3DNKA 3VW3L 2QV2A 2DLIA 3BKCL 5ALCL 1ZLSH 4HG4J 1MFNA 4UNUA 4ONGL 1WISA 4GKNA 1K4CB 3TVMC 3EOTL 3EJZD 2FB4L 5FA3B 5T3XD 3ZSSA 2F9BT 3CZFA 4LFHG 4P46D 2EYSA 4TVPH 4RAUB 4WCYL 3FFCE 3BZ4B 1WAAA 1FLRL 3MUZ1 3TO4A 3TZVC 5CZXC 3VGHA 2BXZA 2A73B 3FTGB 4JY6B 5I1CH 3SPVB 5MERA 4EXKA 3KNBA 1ZA6A 3TYFB 2BNRD 4O2FA 2J5LC 3SDYL 1LK3H 4FQ1L 4Z7NF 2P48B 1MWAL 4LEOA 3LHPH 5FYKE 4M62L 2O26U 3P4MB 3MRMB 3PABB 5IP4A 4GG6A 1P69B 5JXAL 3MNVA 3X3GH 5IB5A 1XCTA 5CJ5A 1AGBA 1YN7A 4IDJH 4RRPA 2C3WA 2X42A 5I1AA 1PDKA 1WBYA 1IEBA 3ZT7A 5HHOB 5F7FA 3L3OB 5HYQB 3V6ZA 1YEJH 1INEL 1YA5A 2VITB 1W2KT 4NRYA 5EA0H 4Z5RB 5B4MC 5EU7E 4LARH 1ADQA 2AJVL 1RU9L 4U33A 3SJVE 4OLZL 5CCKL 3L7FA 3MQIA 1HDMB 2HT4D 4NPYA 3PWVA 4W4OA 2VQ1B 2JIXD 1MCQA 2IFFH 3CC5A 4F8TA 1FFNA 3VRJA 5DTFA 5KS9F 3MJ8B 1S7RB 2XG4A 5HYIA 1KN4H 1RZFH 5MENB 2DLHA 1OHQA 2V5TA 3KYAA 4MA3A 5F9JB 2NY3D 5JOEA 4ODSH 4MSWA 3WD5H 3IJSB 2GTZB 2MSPA 3A6CH 4NCC1 3WLBB 3VXRE 1RJYB 4LLQA 5BZDB 4QF1A 4FZ8H 3RIFF 3BKML 2ITDA 1YY9D 3CH1A 3JWOH 3V6FB 4S0SD 2NXYB 3D39D 4X98A 1AHWA 4F8QA 4XPTL 2GEEA 1N8ZB 1A7PL 4UUJB 1J7VR 2C4FT 2HJLA 4OM0H 2BY1A 5DJ0A 1VKXB 4V1DA 1JPFA 3UYOD 4MD4B 3Q6GH 5DJ6A 1LHZA 2P1YA 1ZVYA 4A6YL 3U7WL 3GI8L 5KN5B 2AXJA 4EDXA 2BSTA 1CQKA 5L0QB 3FB7B 1J0HA 1B0RA 2YS4A 3T0EE 5CEZE 1JNNH 3BUYA 3QAZB 4YJZL 1LNUB 4EI6B 1I8MA 2F5BH 3EOAA 3W11C 5F89A 2V9TA 4OF7A 3VFTA 1QR1A 1YMMB 4ZXBC 1T0MA 4F2MB 2BERA 4LLYB 4BUHA 4IRSC 3HZVB 4XTRD 4OCYH 4OLUH 5EO9B 1FDLL 2DQHH 4L8SB 1RK0A 2ZUXA 4XCYA 3T77B 3FOLB 1NC4D 5MP6H 1DJSA 2Z8VC 3V5KB 1QEWB 3IJHB 3CUPA 4P59L 1YNLL 5D9SA 4PR5A 4PGBA 4KRPB 1FZMA 4PJHA 5KOMC 5C0NC 3KPLA 4GKOA 1MCKA 2BSRA 5DD3H 3ZDZF 3O41B 4IHOB 4OLWH 3TA3A 4JDVB 1OTUD 2EDJA 1EUUA 3DX7A 4R7DA 1RUPH 2EDXA 3BZFA 5SWSE 3CFJA 1ZT1B 3MV01 2O5XL 3QEHA 4UIKH 2G60H 3IGAB 4KKBD 4TN9A 3DARA 3GFUA 1U3HB 4DW2L 1Z9OA 1HOCA 1NL0L 4J3UA 2ZCKL 3PWPA 2RCSH 1KIPA 3DLQR 3RZCA 3F6IA 1EO5A 1MQKL 2OXHA 3DHJA 1NGXB 3VDBA 5D6CB 5JIKA 4JVUA 4I18B 1MWAB 4PJ8C 4APQC 4G8GE 2AK4A 5DK3A 3KPRE 1VESA 2HFEB 4S1DD 4EVNA 2F74A 3O3AB 2ZOKA 1QR4A 2CPCA 1AXSB 4MAUL 3CCHB 1OARH 4UTAH 5KOVC 4PY7A 3ZDXF 5C7XH 3F65A 4K7PX 4KJQC 4JKPL 1NGZB 4PD4K 3M8OH 3L9RB 3QDME 4F37K 1MRFL 2XQBL 1F00I 4JVWA 3X17A 4I1NB 5JHDA 3KYMB 2E7BA 1X44A 1RK1B 1CL7I 5LXGL 4PRPD 5BVPL 1GC1L 1J5OL 3WS3B 2VL4A 4P48A 5I1EL 2C3VA 1EUTA 4RFOL 3BZEB 4ELKA 4MX7A 4ZDHB 1KSRA 2F54A 1G0XA 1M1SA 4AM0B 5LGHL 3BGFB 2D7NA 4LRNL 4X7SL 2JK5B 1DDHA 2LQRA 4RFNB 1AR1C 4JM4H 4RGND 4N0FA 3P4OA 1XF2A 5C0BB 5J06A 3NVQA 1ITBB 2BHYA 4IRJB 2NR6D 4JO2H 5IFAH 4N8VA 5E2TL 2BOCB 1JI2A 1T5XA 4HIIA 1FIGL 3UJTL 1LO4H 5HPMA 1OGAD 2DIJA 4NZJA 2FO1A 1JWMA 4MCZA 1A6PA 5EUOB 4LHQB 1T3FB 3I50L 3GNML 2IMNA 4HUXA 3IETB 1U8PB 2E9JA 3I9GL 4R4BB 4M61A 3ARFB 2P49B 1KB5B 3DI2B 4JFXA 4N8CH 1QBML 3VDCA 2ADJA 2B4CL 5GRZA 1OD9A 2WBJA 5F1NA 4K9EH 2Y36L 4XNQB 1M05B 3NZ8B 1UM5L 2FLBT 3RWDA 4YHKH 2HVJB 3BP7A 3ZTJG 4MWFB 3NCYS 3KHOA 5A3IC 2D7TH 3IDMB 4ODWA 3CFCL 1UWGL 1C16B 1DP0A 2BNRE 3AMKA 3RJQB 3UTTE 1SMOA 5J13B 1G84A 3GBNL 4NDMB 1FYTB 4HDIA 5EOCH 5CZVL 5DHVH 5KVGH 3WFEL 4X99B 4KJWD 5GRJH 5D1ZB 2P5WB 2W65B 3WN5C 1GZPB 1ADQL 4YIQA 1WZ1H 3S37L 2UZIH 3SDDC 4KKLC 3RKDC 4ETQB 1DBJH 4WUUA 5DD0L 3V4UH 3V8OA 2VC2L 3W2DL 5JR1L 1DQQA 5GSVB 3EDKA 5EZOH 3D85A 4OD2B 1G7LA 1U8OA 3SQBA 5CSZA 4OD3L 5A16A 1QP1A 2R2HA 3MA9H 2VZSA 3DUSA 2AKRB 3QDGB 2YWZA 1DQJB 5ERWB 4F9LC 3SQOH 3LIZL 4NN5C 5CSBA 1UACL 2OJZL 2E8ZA 4PJBB 4KDTA 1ZTXH 2NY7H 2VDMH 5SWZD 3RHWK 1NCDL 2VLJA 3MLYL 4OUUA 5CEYA 3QWRA 4LLVA 2NY1D 3PJSB 1XIWB 1HSAA 4KI1A 1FQ9C 4NZUL 4PJIE 1Q9WB 5CD3B 4MD5B 3SDXE 1HWHB 4RAVA 3K81A 2YUXA 4ZUSB 5JW5A 3FO9B 3GSXB 1TCMA 1X5HA 1KLFA 4UDUB 2GUOB 4XCEA 3QCVL 2FJGA 2E7HA 4OGZA 1NFKA 4U6VL 4QRRD 3F5WA 3MGOB 3D39E 2CMRL 2WMPA 1F8TL 4H8WC 2ZCLL 3VGEA 2WLYA 4NNPH 5I8EB 1T4KB 3ARVA 1PG7X 4JM2A 1GSMA 3ZYJA 2BCKA 2VABB 3UTQB 3MREB 2HFTA 5CHNA 5D2LE 2X2YA 3UBXB 2R23A 1EAJA 3MLPA 3BWUC 4UQ3B 1TIUA 3QO0B 2OJEB 1YNKH 4QO1A 2VQTA 5TGBB 2FD6L 3ZTNH 3BIBX 4OF3A 3NFPA 4Y4KD 4I3SL 1RIHH 4JN1H 3FQRA 2CLZB 4AENA 1T1XA 5TFSL 2N56A 2A6KA 3EJJX 3E0GA 3TJHC 1K85A 4U1LB 2BVQA 4NZDA 1A6VH 3ARPA 2WQRA 3VGGA 5BQ7B 2R4SL 4YFLF 1W8NA 1FC1A 3CZFB 1AIFB 4LSQL 3BW9A 1FO0A 4HWZA 4E42B 3WFCL 2FATL 1TJHH 3TLRA 2J8OA 1NEZB 2CDEA 1XMWA 5MI0B 4XNXH 2SEBA 1TNMA 3RI5F 4JANB 3UBXG 1BZ7A 1MI5A 5H94A 5I1JH 1P9MA 1ONQA 4HUNB 3KNBB 4OZGA 1A3LL 4WFGD 4AEHL 4KTYA 1JPST 4XVTH 2WLZA 2PO6A 4M7ZB 4I13B 3IFNL 2ZOLB 3D87B 3GSUA 4RA3A 4AG4L 1T5WA 5AYUH 2WUCH 1WFTA 2O5YL 2JJVA 2KZ1B 4I4WA 3VCLB 1CD1A 4GG6B 4P23C 3K8LA 5D96B 5CINL 4KVCL 4MMXC 2GCYA 3OQ3B 3MRQA 1XCTB 2EKSB 3QNYB 5C0RL 1K2DB 1SBSL 5IW1B 2A6JB 4CMHC 3QUYA 4ZODA 1WBYB 3N50A 1IEBB 4LCYA 4JLRA 4M6NL 2VDNL 3OKKA 5IIEB 2AEPH 5BRZA 2YXFA 3AXLA 1NEZG 1OW0C 3OKEA 4MA8H 4E41D 1CT8A 1N64H 3IAQA 3BD3A 2F53A 4JY4B 3T4AB 4Q9QL 2PXYC 5INDA 3B9VA 3PWNA 4Y5XC 5DDHA 4KHTL 3CC5B 1HINL 4PJGA 2FX8L 3NFSH 1Q94A 2CDGB 4HBCH 3LKPB 4CJ0A 2X4UA 4UT9H 4U7KA 3OR7A 4PG2A 4MA3B 4U3XA 3C60D 2FIRT 3D2UB 4KK6C 4Y8AA 1BZQK 5EC1A 3DMMD 4I77L 4JFDB 2PTUA 4Z0BH 5CJ8A 4XI5C 4NQED 3CH1B 3HCVB 3LD8C 4OT1L 2JJSC 5KTEL 1YYLL 3OZ9H 5FM4A 5ISZE 4XVUD 5KVDL 2QSCH 1KXVC 1FFQA 4TQEH 3TCLB 3WIHH 4X98B 4XPBH 3UPRA 2GJ6A 2I24N 1AXTL 1LP9A 1EXUB 5JPMA 4RGNE 3BSZH 2V9RA 3NGBC 5EZLB 4ZFFB 5KAQG 3MSPA 2HJLB 3DVFA 5DJ0B 1NCCH 4NQVA 1CF8H 5C07A 1I7RB 3C08H 4P2OB 2C4FU 5TQ2H 5DJ6B 1QLFA 5AUMA 3T65B 5IESL 4PJXA 4NZRH 1I3GL 5D72H 3ARGD 1L6ZA 4PV9B 3TPUB 1F3RB 1Q9OB 3SE8L 3KR3L 1XZ0A 1A6TB 5EU6B 1S7VB 1MEXH 4WV1C 1Y18A 3EOAB 5F89B 1ZLVK 3HZKA 2EDLA 1T0MB 4L9LC 5IFJB 1TQBB 1QNZL 2BSSB 5GS0D 3G04A 1C5BH 4X9GA 2QQQA 2NMSA 3O2DH 1EH9A 1JPTH 1MJ8L 2FECL 1Q1JL 4OUOA 3LPGA 4XCCL 4X8JB 1RZJL 4M8QA 4FQQB 5GGVH 3MXVH 4D9QD 2QQLL 5IMKA 2APVA 3HG1A 4KGJA 4MNHA 3ES6A 3FB8A 5EPMB 1EJOL 1ED3A 2WBKA 5KSAA 5E99L 4JZJB 1GGTA 2EDHA 4I0PB 4H1LA 2V7HA 2XKSA 5BV7H 5HY9B 4LLDA 1PY4A 1WAAE 3CFJB 1GGCL 3QEHB 4M6OL 1UG9A 4L5FH 4CGTA 5DMKB 4PRHB 3KXFA 3X13B 1KGCD 5C09A 3O3DA 3CX5J 4JQIH 4BYHA 3MGTB 2B5IB 4XP5L 2Y72A 5FYKU 1NSNH 2H2SD 3KVQA 4IMLB 1ORSA 1N0XH 4ZG1A 5DUPH 2FL5A 3CXDL 5F9AC 4P57A 2R0WL 3BH8A 5EZIH 5DJ2B 2W1NA 5DR5L 3WFBL 3L95B 2X4QA 5FCSH 3PWJA 1J88A 1J1XL 2BVYA 4MYWB 4C59B 4X4YA 4O00A 4PPTA 1IBGL 4YBLC 4FRWA 3FN0L 4EVNB 1A1MB 2G75A 2OX5A 2UV3A 2ZOKB 5TH2A 1I1AC 2HKHH 5D8JL 3K8MA 3NCJH 3QQ9C 2Y5TA 3FZUD 1NANH 3WFDH 3RVXD 1SJVA 3C6SA 3EUUA 1CLCA 1O7SA 1BBJB 1BX2A 3RIFK 5JA9A 4QY8A 4DFHA 3QIUD 5JHDB 4IMKC 2ESVD 2X4SB 2ZUYA 3OKMA 1QACA 4YZFE 5IOPA 3N85L 4QRRE 1S78D 5M94B 3TT3H 3O45B 3GJEA 1WCBA 3UEZA 2WUBL 3RWIB 4HFWA 4ELKB 3FL7A 1ZAGA 4NC1E 3RRQA 5J1SC 3EO9H 4HQQL 3VXUA 2H9GA 3C09B 1IGYB 3TO2A 1DDHB 4F7MA 3DX8B 1A3RH 4RGMC 5EU7C 5EFIB 2HRPL 2P5EA 3ZKXB 1VFBA 4N0FB 3P4OB 2OQJB 1XF2B 3IAPA 1MCCA 4KMTL 5T1MB 2R9HD 1FO0L 4J3TA 4WVRA 1XFPA 3O6ML 3PDOB 4XP4L 1U8JA 3D6GA 5DVKA 3RX7A 2CLVA 4NRXA 2NQCA 3BO8A 4JHAH 4OBSA 4QRPB 2VDKL 1GHFL 2X70A 1YEGH 1I3RA 3P9WB 1WBZA 2AQ3A 3FQNA 3GHBH 1G7MB 1A6UH 4V1DE 5IT2L 3HHRB 4GS7B 4KUZH 4M61B 5DD1H 3ZYOA 1FGNL 2BNQB 2ZP0T 4YXLH 1CZ8L 1UWXK 5D7LB 3AFLA 1YEHH 4WI2A 4XX1E 5GS1A 1U42A 3RWDB 4ENEC 4NKQB 2JTDA 3IDIA 1AKJB 5D71H 2BVOB 3L5WA 4FMKA 1S5IL 1NBVL 2EZ0D 4FXKA 3O0RL 5EORH 1CDGA 5DEFA 5HHVH 1F4XH 2YK1H 1DEEA 4FFWD 2UUDK 3WIFA 3L1OH 5GGUB 1W0WB 3T0EC 5FM8A