3AXSA

Complex structure of trna methyltransferase trm1 from aquifex aeolicus with sinefungin
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
387
structure length
387
Chain Sequence
MEIVQEGIAKIIVPEIPKTVSSDMPVFYNPRMRVNRDLAVLGLEYLCKKLGRPVKVADPLSASGIRAIRFLLETSCVEKAYANDISSKAIEIMKENFKLNNIPEDRYEIHGMEANFFLRKEWGFGFDYVDLDPFGTPVPFIESVALSMKRGGILSLTATDTAPLSGTYPKTCMRRYMARPLRNEFKHEVGIRILIKKVIELAAQYDIAMIPIFAYSHLHYFKLFFVKERGVEKVDKLIEQFGYIQYCFNCMNREVVTDLYKFKEKCPHCGSKFHIGGPLWIGKLWDEEFTNFLYEEAQKREEIEKETKRILKLIKEESQLQTVGFYVLSKLAEKVKLPAQPPIRIAVKFFNGVRTHFVGDGFRTNLSFEEVMKKMEELKEKQKEFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable N(2),N(2)-dimethylguanosine tRNA methyltransferase
publication title Substrate tRNA recognition mechanism of a multisite-specific tRNA methyltransferase, Aquifex aeolicus Trm1, based on the X-ray crystal structure
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 141
structure length 387
sequence length 387
ec nomenclature ec 2.1.1.215: tRNA (guanine(26)-N(2)/guanine(27)-N(2))-dimethyltransferase.
pdb deposition date 2011-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02005 TRM N2,N2-dimethylguanosine tRNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.56.70 Alpha Beta 2-Layer Sandwich Phenylalanyl-tRNA Synthetase; Chain B, domain 1 Phenylalanyl-tRNA Synthetase; Chain B, domain 1 3axsA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3axsA01
1H1DA 4MQ4A 4HGYA 1L3CA 2P3LA 1XTPA 4U7PB 3CJTA 4GQBA 3KQOA 3UJ6A 4C08A 3NWBA 2B2CA 3P9IA 5DX1A 2Z6AA 1U2ZA 1SUSA 2IDKA 1KPHA 3LDUA 3OPNA 3DLCA 3FTDA 2VDUE 3QV2A 4PYQA 3ELYA 1YUBA 3B5IA 3HA5A 1JTFA 1VBFA 3E23A 3THSA 3VSEA 4GBED 4CXMA 2ZIFA 5EEGA 4EKIA 4RTRA 4QPNA 4JXJA 3THRA 3HM2A 2O06A 2AS0A 1ORHA 5FADA 2PX4A 3M6WA 2GB4A 3FPJA 1RJDA 1RI2A 3KPUA 4Z2YA 3UWPA 2XVAA 2FCAA 5G02A 4MHTA 3NTVA 3P9NA 4YUZA 1JQEA 3G89A 3LGAA 3FPFA 4M7RA 2OYRA 2QE6A 3EPPA 1JQ3A 2G70A 4QDKA 5EEHA 1R6AA 2AOVA 2PX2A 2XYQA 3TKYA 5K01A 3KQSA 1KPIA 1XCJA 1N7JA 2V74B 3G2PA 3M6UA 2PLWA 4PWYA 2NNWB 5DSXA 5HIMA 3LDGA 5DRTA 5E9QA 1N2XA 3G7UA 1ZKDA 5KVAA 3BZBA 3TM4A 5D1HA 2G8NA 2H00A 2ZBPA 2A14A 5CVDA 2Z6QA 4DMGA 3IYLW 1X1CA 2P1DA 4OBWA 4EQZA 5FQOA 4PYLA 1NW7A 4PINA 3UA4A 2UYOA 3UJDA 4CTJA 3DOUA 1QAQA 2AVNA 2BR3A 4F86A 1QAOA 3HCAA 4QVGA 3EMBA 2NP7A 1B42A 1RJGA 3LCUA 4FSXA 2QRVA 1Z3CA 10MHA 3R3HA 1F3LA 5K0JA 4ER3A 3RW9A 1O54A 2GS9A 3B89A 4RWZA 4RVHA 1VP3A 2PT9A 3LL7A 4KIFA 5FA5A 5DPMA 4E30A 1AQJA 4C05A 4DCGA 5EHIA 3LX6A 5LSAA 2JH9A 1NV9A 2ZZMA 3AWIA 4BY9E 3GWZA 3M6XA 3SSOA 1JG2A 1FP2A 1XDZA 3R24A 4HC4A 3A27A 1AF7A 1X1AA 3HNRA 3KQMA 2YQZA 1KIAA 3PFHA 4FT2A 5BP7A 1YFJA 5EZQA 1PRYA 2P35A 3U81A 4GC5A 8MHTA 3EVDA 3UZUA 2CMGA 2VZ9A 4ER0A 4AZTA 3SMQA 5HZMA 3IV6A 3KKZA 3BWBA 4M36A 2VP3A 3PX3A 2OB1A 3ID6C 5E1OA 1F38A 2FYTA 4CKBA 3EVGA 5E2BA 5HIJA 3SGLA 4EK9A 4MTLA 3CC8A 1ZQ9A 1IY9A 4QTTB 2C7PA 2UYQA 5KYGA 2FK8A 1D2GA 1VE3A 1X1DA 3HCDA 5E1MA 1ZG3A 3SSMA 4UOEA 3DXYA 3PTAA 4DKJA 1X19A 2C7QA 5T6BA 1O9HA 2F8LA 3R0QA 2O05A 3EVCA 4PGHA 3DH0A 5C0OE 4CWAA 4HSGA 5EOVA 5MHTA 4PYNA 1VLMA 4EVIA 1QAMA 3GRZA 1SUIA 5CVVA 2YVLA 4M38A 1RI3A 1TW2A 1YZHA 3F4KA 3I53A 5E1DA 3SX0A 2OKCA 5T67A 3T7TA 3P9KA 5LQJA 2C7OA 1FJXA 3C6MA 2PWYA 5K0BA 5HFJA 3TPZA 3Q7EA 2OY0A 3BKXA 4GOOD 3MQ2A 4GOMD 3UA3A 5E8RA 4RX1A 4AZWA 3ER9A 1AV6A 3FUVA 4GC9A 3DP7A 3JWGA 3KQTA 3ME5A 1NV8A 5DM2A 5ERGB 5GM1A 2NXCA 4E2YA 2ZBQA 1IM8A 3PLAE 3K0BA 1IXKA 3P8ZA 3B3JA 3H2BA 4P58A 1JQDA 3TM5A 3OZSA 4MIKA 4KRGA 5FUBA 3LPMA 4YUWA 3HCCA 2O57A 4PYKA 4OQDA 4Y30A 3VC2A 5K0GA 1L3IA 1JG3A 1O9GA 4RYLA 4YUYA 2ESRA 1HNNA 1JSXA 2HV9A 3LBFA 3LSTA 3E8SA 3EGEA 3EGVA 2AOUB 3FZGA 4QVKA 3JWJA 4C07A 2ZIGA 2ZCJA 3FYCA 3SM3A 5IH3A 3FPHA 1BHJA 3MGGA 5FHRA 1DCTA 5EG5A 3KQQA 4CTKA 3A25A 1KYZA 2GLUA 4HTFA 4X60A 3D2LA 4XUEA 1G8AA 4QPPA 4QTUB 5DX8A 5ICFA 3SR4A 1YF3A 4OX9Y 3UJAA 4LG1A 4LWPA 3M6VA 5LQRA 1P39A 5EZSA 2YTZA 5FQNA 3ANXA 3C6KA 4F85A 5D1NA 3TR6A 5C1IA 4ATNA 5K03A 3EGIA 3DMHA 3A26A 5EMJA 4WXHA 4PYMA 5LQAA 4MWZA 3FTFA 5K8VA 3KQPA 1KP9A 2QM3A 2ZVJA 4ISCA 5K05A 1EQAA 5KQRA 3UJCA 1EIZA 2GH1A 5FWAA 3CVOA 2GAFA 3UJ7A 3B3GA 3SXJA 2CKDA 2ZTHA 3HTXA 1EJ0A 3TQSA 5C9ZA 1SKMA 7MHTA 3S68A 3EVEA 5LQCA 2PX5A 3NVMB 5FHQA 4PNEA 5HIKA 3HCFA 3KU1A 2NXEA 3KPVA 1EG2A 1P1BA 2KW5A 5E2AA 4KWCA 5T64A 3LBYA 3RODA 5BW4A 5DRYA 4FP9A 2P40A 3GRRA 4BLVA 2DPMA 3BT7A 3MCZA 1XXLA 4DF3A 1VQ1A 2BH2A 4CKEA 3PB3A 2IBTA 4ER7A 4F84A 1OR8A 4YV1A 5FTWA 5GP1A 2PXAA 2R6ZA 1ZGJA 3KQWA 5FA8A 5FCDA 2HTEA 4R6WA 5EKXA 1UFKA 3G5LA 4RV9A 2V7EA 2P8JA 2GPYA 2IH4A 3UJ8A 1RI5A 3KPYA 3GIWA 3UJ9A 1R8YA 2BM8A 2CMHA 1VIDA 3OFJA 4A6DA 3GGDA 4YUXA 4A6EA 5LQKA 1NBIA 3OE5A 4RTMA 3R9XB 2XYRA 2IGTA 4E70A 4PONA 4YMGA 1TPYA 2IP2A 2P3OA 2P41A 3C0KA 3HCEA 1RJFA 2CL5A 3QOWA 4DZRA 1QZZA 1VPTA 4GOLD 5M5BA 5EPEA 2UYCA 3LDFA 4RTOA 2IH2A 5CVJA 2YR0A 1DL5A 5U4XA 4DA4A 2AR0A 3OZTA 1JG4A 3OZRA 3P2KA 4C06A 1Y8CA 5KQSA 1NT2A 2PX8A 3MTIA 3NJRA 3WSTA 1ZHFA 2QY6A 4G56A 2AOUA 3FPGA 3KPJA 4HRAA 4X61A 5HOQA 1FP1D 2H1RA 2AN4A 3OU2A 1WXWA 5K0LA 1D2HA 1G8SA 1I9GA 3T7SA 2E5WA 3K6RA 5EMKA 3M4XA 5CM2Z 3A4TA 1ORIA 4IV0A 5ICCA 2ZZNA 3M70A 5EIFA 1DUSA 1SG9A 4PYOA 2Y1XA 3NDJA 3PVCA 5EMLA 1NBHA 2C7RA 2JG3A 1M6EX 4C04A 2FRXA 2HR1A 1WY7A 1G6Q1 2OXTA 1I4WA 4X1OA 5BW5A 4RTNA 2WA2A 2EJUA 2ZWVA 2N47A 3R6TA 2B25A 3EVZA 3G88A 3GDHA 3LKDA 1I1NA 4KDRA 2IBSA 3P97A 2JHCA 3GRUA 3LCVB 2YUIA 3OFKA 4XUDA 4V0QA 5DTQA 5DWQA 1NW6A 5P8WA 3TLJA 3FUWA 1Q0TA 3DTNA 2OB2A 3KPWA 2PXCA 3CCFA 3TKAA 5GOZA 1FBNA 1NW3A 1KR5A 4E33A 1R00A 3UJBA 3PS9A 3DXZA 4IWNA 1G55A 4DM3A 2P7IA 3FTCA 3GNLA 1P91A 5K0CA 5KS2A 1XVAA 3C3YA 5FWDA 3DMGA 3VYWA 3O7WA 4L7VA 2OPBA 2UYHA 4YV0A 2ZFUA 1YFLA 1HMYA 4FT4A 2ZWAA 4QQKA 5E9WA 3QOXA 1KYWA 2PJDA 2Y1WA 2G71A 3CJRA 3EMDA 3NW9A 4R8RA 3T0IA 4YMHA 1NKVA 2B78A 4LECA 2WA1A 1XDUA 2ZZKA 1VP9A 3GO4A 3L8DA 4KW7A 4QQNA 1FPQA 4RTKA 3LKZA 5LQNA 2YXEA 4P7KA 3SVZA 2JH8A 4ZTBA 3EVBA 1KPGA 3FUTA 5CVEA 5B1SA 2BZGA 4RTLA 1MHTA 3ELUA 2JJQA 2P7HA 3RIEA 5ICGA 4HH4A 2H11A 3TMAA 4FS8A 3V8VA 1Q0SA 2EG5A 2ERCA 3KR1A 4RTJA 3HCBA 3CGGA 5DM0A 2HNKA 3DULA 1JG1A 4PGGA 2YXDA 2BR5A 4HG2A 2NXNA 1YZ3A 5EKUA 2R3SA 4X41A 2AVDA 3LECA 1ZGAA 3NVKI 2BR4A 4ER5A 2YXLA 3HVHA 5CCXA 3UBTA 1WZNA 3LCCA 3MTEA 2ZULA 2IFTA 5EC8A 3SSNA 4Y2HA 1XCLA 2NP6A 3AY0A 3DUWA 3G5TA 2AN5A 1G60A 1KHHA 3AXTA 3KQYA 5GIOE 2AOTB 4X63A 3UFBA 3CKKA 3EVFA 4PIPA 1PJZA 1RJEA 1EAMA 3E05A 3EEYA 2I7CA 3I64A 1L3BA 1WXXA 3BGDA 3I5UA 4GUAA 4AUKA 5EVJA 2I9KA 3IHTA 3AJDA 2AN3A 3HA3A 1BOOA 5DXJA 3HA7A 2PY6A 2EJTA 2I6GA 3VC1A 1P1CA 3CJQA 1R74A 2GA9A 3FRHA 1TW3A 2G72A 4R8SA 5K0EA 1NE2A 1QANA 2HWKA 1L9KA 5GWXA 4R05A 4FGZA 5K0NA 4BP1A 4CKCA 4GOND 2ONYA 3FRIA 5DTRA 3O31A 5F2OA 4FSDA 4PCLA 4EMSA 3B7PA 4IV8A 1M0EA 3G8AA 2OZVA 1R18A 3FYDA 2OO3A 5DT2A 3TRKA 1M6YA 4V0RA 4POOA 4AZSA 1UWVA 1BKYA 2PV0A 4XUCA 4P7GA 4YUVA 4AX8A 4E32A 3V97A 4RVFA 1WS6A 2UZ4A 1KXZA 3NWEA 4IKPA 1SQGA 3I58A 4BLUA 2B9EA 2K4MA 5ICEA 3ORHA 5CD1A 2WK1A 2YX1A 3NDIA 2B3TA 3B3FA 3DXXA 4LWOA 3G2OA 2PWPA 1RI4A 3OCJA 2JHPA 2FPOA 3C3PA 1X1BA 2IIPA 2VS1A 4M37A 4ER6A 1R8XA 2Q41A 2IDJA 1SQFA 5HILA 4R6XA 1JTEA 3I9FA 1QYRA 3X0DA 4U7TB 2P3QA 4OA8A 5CIYA 2O0LA 3ERCA 3DR5A 2LD4A 4P7JA 4HGZA 4KDCA 4E2XA 3GXOA 1VL5A 5CCBA 4FZVA 5GINE 5DSTA 4PYIA 5H02A 4B17A 4OA5A 2PT6A 3OU6A 3Q87B 3PT9A 3JWHA 4HTFB 4K6MA 2VDVE 5DX0A 2PVCA 2DULA 2ZW9A 5LQUA 4EKGA 3MAGA 2ONZA 4GEKA 3G2QA 3OU7A 3HVKA 2AOWA 2NXJA 3REOA 2PGXA 3ELWA 2ZLBA 4WVLA 5EGSA 5EHGA 2FHPA 5DLYA 1XDSA 3E7PA 4OBXA 5EIWA 5DTMA 3FUXA 4E2ZA 2IPXA 3GRVA 5GM2A 3BWCA 1SVUA 1YB2A 3BWMA 2AZTA 3LHDA 4E2WA 5K09A 3HEMA 3GJYA 3KR0A 2HMYB 2AOTA 3BWYA 5HEKA 1JSZA 3JWIA 3TFWA 4PIMA 1RI1A 2Z6UA 3A7DA 5EMMA 3P2IA 4RSRA 9MHTA 3FTEA 3CBGA 2AOXA 2EFJA 1D2CA 3AXSA 2PXXA 3HVIA 3P2EA 3ELDA 2QYOA 4DQ0A 5JUWA 5BXYA 4RTPA 3OE4A 2EX4A 2G1PA 1XJ5A 3P71T 1EJ6A 2ADMA 3EVAA 1L1EA 4BP3A 5FULA 1N7IA 1UIRA 2JHAA 3M33A 1INLA 5DXAA 1NW8A 5E8JA 5IKMA 3NMUF 1NW5A 1V39A 4XCXA 4PYJA 4FR0A 5CUQA 4YV2A 1G38A 2PKWA 3BKWA 1AQIA 3DMFA 3PX2A 3IEIA 4DCMA 2XVMA 3MCTA 4E31A 4NECA 4RTQA 2ORED 3KR2A 3FUUA 3GU3A 1MJFA 2IH5A 3BUSA 5F2NA 4AZVA 1JR4A 3MERA 4GF5A 4H0NA 4OQEA 2PSSA 2NYUA 3GRYA 2ZIEA 3KHKA 5K0FA 2PBFA 4RTSA 3HP7A 3TOSA 3P9CA 5DM4A 2QRVB 3PFGA 1WG8A 3BXOA 4P7FA 4KVZA 5JR3A 3G8BA 5DM1A 5E1BA 5EQJB 4C03A 4PCAA 4QDJA 5F2KA 4C4AA 3MHTA 2O07A 2XBMA 3ER8A 3KR9A 3BGVA 5GIPE 4BLWA 3FPEA 3HVJA 4RVDA 3T7RA 1BC5A 2CWWA 4RVGA 3A7EA 1T43A 2VDWA 2ZBRA 5LR6A 3DLIA 4KIGA 3G2MA 2ZSUA 3MB5A 3KQVA 3EEOA 3GCZA 4O29A 5HIIA 2BM9A 5CVUA 2OBFA 2FK7A 3BGIA 5E9JA 2I62A 3O4FA 2XYVA
chains in the Genus database with same CATH superfamily
1YS7A 5FNVF 1PNVA 2E87A 1UMBB 4DYDA 4KLZA 2PZFA 1X7DA 1SIWA 2Z6AA 3O0DA 4F4JA 1SUSA 1AO0A 3E2PA 1FU4A 4E0BA 1XMIA 1OBFO 3S27A 1O89A 4RVCA 5B12A 4GBED 2ZEJA 3GJXC 5LMUB 4P0QB 1V16B 5EEGA 3PYMA 4GWKA 4B6GA 1QLWA 5EN4A 3QZUA 4FFNA 2I7DA 3DM5A 1YDFA 2GPAA 1I3LA 3JYQA 3L4GB 3ECSA 1W1WA 3DBIA 4JJFA 3F9CA 1BE1A 3TCKA 5AMXA 2R1TA 2EP7A 4Y0AA 2QROA 4DUPA 2FCAA 4MHTA 1R0WA 4P0PB 1V47A 1E6WA 1MO5A 3LW7A 3ZKWA 1D2MA 5DM60 2PZBA 3A04A 4IXMA 1M2HA 2QM8A 3EUEA 4UHEA 1R6AA 4BRZA 3KQSA 3UT5B 3G2PA 2PQMA 1J8VA 3KZCA 4Y1RB 4BQNA 4IY1A 1QQTA 3USCS 2CW5A 4MS4B 4UVEA 1R2QA 5E9QA 2Q8QA 3VR4A 2GM5A 1ENOA 5M7EA 4GRAA 3PV0A 5D1HA 4BV2A 3MF4A 3UY4A 2B4RO 3ZOKA 4Y9DA 3VC3A 2WD7B 2C31A 1NJ1A 5FQOA 2D00A 3ZX4A 4DIBA 1BEUB 4A4DA 1OPXA 1JJVA 1ZH8A 3CS3A 3RVDA 4TX1A 4KFSA 4J49A 4GXQA 4U2KA 5D7NA 4W7HA 3ICWA 1RAHA 3T12A 3UFXB 3WBKA 3GA7A 3OUUA 2A9RA 4PG5A 2YFYA 3HDQA 5EIBD 1Y5MA 4EX6A 4L0DA 5JH7F 1W47A 3RW9A 2J9RA 4C7BA 2WM2A 1SPBS 2QGZA 4E5PA 3TIFA 1AQJA 1E0SA 3BE5A 5EHIA 1SQSA 1CUZA 1PWZA 1XF1A 2HCJB 2FVYA 1RJWA 3ZGNA 5BXQC 2X9VA 1ZH4A 4NYIQ 1VKJA 2YV5A 4UU8A 4J0HA 3M4ZA 2HXYA 1JG2A 4HAYA 1U7UA 3U6BA 1DQPA 1X1AA 3HNRA 4B3XA 4FB4A 5CB4B 4CL0A 2P69A 5EZQA 4MWEA 3U81A 2XUOA 3UK6A 3C7CB 1RBMA 3GT3A 4P3YA 4M54A 2V59A 1QH0A 4NARA 3MUFA 1RC0A 2YRFA 3SMQA 1G5IA 3KKZA 4G5XA 5BNIA 5IXJA 3ZCQA 2R2AA 2PD4A 7ABPA 1CULC 3SQWA 1ZD3A 3U9TA 3GG9A 1ZN9A 3SGLA 2FY8A 2AG6A 4M46A 3RRFA 3DBOB 5F35A 2C7PA 1FUEA 4O3MA 2PU7A 4J2OA 3ADKA 5CT6A 2AMVA 1VE3A 2E4ZA 3GFGA 2WNHA 2OHVA 3FMPB 5JXJA 2AXNA 3KYBA 3BHMA 2ZYTX 4UOEA 1HT0A 2O1XA 3I5XA 1FC0A 4BKOA 3EIHA 4FGLA 1EU1A 3ETNA 4XGNA 3U16A 2CNOA 4DMHA 2QBYB 5EOVA 4FYHA 1X7GA 2HU8A 1K5HA 5ER6A 2BIFA 5CBPA 2HK7A 4CIWA 4KR3A 1MJGA 3UB3A 2B3DA 2QVLA 3EPLA 4JEHA 4H1TA 1SCBA 1XL1A 2QY9A 3Q2IA 1RI3A 1Y6JA 2H17A 3BIOA 3DYVA 4OXXA 3EXFA 4A0GA 5HUJA 1VIVA 3HXTA 1H1LA 4Q00A 1K06A 2VJYA 2ZK7A 1IYZA 1Y6RA 3N0XA 1CETA 3O3OB 4PZCA 5K0BA 4GHWA 4IIFA 3B1YA 4Y6SA 1I8TA 4LYGA 4QBFA 4EITA 2O4UX 3MWFA 4FS3A 4TQAA 4YRJA 2JATA 2SKDA 4LXYA 4BNJA 5JCOC 1X80A 2CLHB 3ESRA 3NIGB 4JWTA 1BX0A 4PS0A 4D9KA 2CV0A 1CNFA 2GZ2A 3ETLA 2J6IA 2PSFA 4OM8A 1U63A 4LCJA 4L9SA 3G8DA 4JLSA 1IXKA 6GPBA 1Y89A 5FF9A 1DUVG 1F4VA 4WQMA 1HFWA 3M82A 4G9GA 2PEZA 4OHBA 4US1R 4ZI7B 2HJRA 5LYJF 2KWIA 2W5UA 4WFIA 3X43A 1GKUB 1UL1X 4OQDA 3H1EA 3ZLJA 1JFRA 2DLNA 2E0IA 2VAPA 3M1YA 1S7GA 2Z3ZA 1QOPB 2BGNA 4II7A 3IR6A 4OLHA 4QIHA 1MQAA 1VE9A 2EZUA 1O5TA 2WTMA 2CLFB 3AW9A 3FOBA 4PRKA 1KGSA 2H1WA 2Z3WA 2W2KA 1XMSA 3ZJ5A 2RKBA 2GPSA 2VKTA 1RM4A 4YHHB 3N59A 1YZFA 2X8JA 1SIBE 1Y9JA 1S96A 2JFVA 5AK3A 5EG5A 3V1TC 3OJXA 4FIDA 1GNVA 3RNLA 3P32A 1YZQA 1QV9A 221PA 3H0EA 5DX8A 4PBRA 1TK2A 3N3AC 1LW6E 4YRLA 3ZBPA 1TZCA 2VF5X 1T34A 4XVQA 3PI6A 4MVCA 2GVDC 3N05A 2UYGA 4IH1A 2K7ZA 1KI7A 5FTMA 1R9NA 2IHNA 2FR1A 3SLRA 3ZD8A 4OV6B 3RVQA 2QQ5A 4R16A 2SKCA 1XWIA 2XE4A 1O94A 3LX4A 3X2FA 2Q2NA 5FWYB 2GBLA 2VPXA 4PYMA 4OXIA 3TLGB 5IPFA 1I7NA 3VAYA 1QIKA 3RVPA 5IXSA 2OGTA 1J7JA 1IE3A 1PJ2A 1DAHA 1YRQA 2NAFA 2SKEA 1HDGO 4RNDB 1LNGA 2NO5A 4C20A 5FEUA 4LNUA 2YRWA 1C1XB 4GQAA 4U9UA 5JS2A 2XTAA 1YFZA 2PUJA 5T64A 3WV4A 2AN9A 4GMHA 1DKOA 3KVVA 5FFNA 1CUFA 1P29A 1XOIA 3RODA 4V0MA 4BYGA 2P40A 4YJ3F 4Z9YA 3L0YA 4CCAA 5IDXA 2ZS8A 3RANA 2CC2A 2AGVA 5JVDB 1CIVA 2J4CA 1XMQB 1HOXA 4F84A 2VZ0A 1NUSA 3CLTC 1U0HC 4W99A 1XO1A 2P65A 5AI0A 2R4QA 1HYGA 1ECCA 1L5HB 2H1SA 4R6WA 4QNNA 2FSHA 3UICA 2VTBA 3ZDEA 1CZNA 4RZ3A 1P3JA 3B1JA 4DAOA 1OUMA 3C1TA 1XXHA 4G41A 1SBNE 2IH4A 1AKTA 1HDZA 2I6TA 3MJTA 1HE3A 5CW1A 4ZT2A 4B85A 4EHNA 1QS0B 2QI9C 1CB0A 4JJEA 1GHTA 4TPKA 4GGOA 5LQKA 2WM9B 1MMFB 4L5CA 2H9IA 4E70A 5C8YB 1SXQA 4C4SA 4P3PA 1RXWA 4XZ3A 5BQPA 1E77A 2R1UA 4RS4A 4ZQBA 1DRWA 2HM7A 6REQA 1QZZA 4W5NA 1XPRA 1TYAE 4GOLD 4LMPA 2WINI 1ML4A 3VZPA 4HF7A 1RACA 3L5KA 4LZNA 1HLDA 4O0LA 1G5PA 4AT1A 2CDCA 1GUBA 4C06A 5AJHA 3JD0A 5FKJA 2W0MA 2DRIA 4CETA 1FXUA 5DXFA 1T9ZA 2O4CA 2O2XA 3A9VA 3RVNA 2CF5A 4UEKA 1DUIA 1FP1D 2IUSA 3GRPA 5BRAA 2ZYSA 3K4QA 5HQJA 5EWLA 5ED4A 2FTKE 4U2GA 4C14A 3W77A 1EXDA 3E9CA 4E5UA 1N2HA 1J1UA 1DNPA 3A4VA 3HBLA 1SG9A 1IBSA 1V45E 2IW1A 2XUQA 3LTEA 3Q7IA 4J76A 3WGLA 8ABPA 2Y0EA 2XDQB 4YJHB 2C9ZA 3LOUA 2QX6A 1J2EA 4WASA 2HR1A 3W0LB 2W2MA 2IPNA 1LB1B 1KSJA 4UCXA 3ZZMA 4G5SA 2WA2A 4U39A 5HTOA 4FFWA 1W48A 5IVIA 1IHYA 4PG8A 2HLPA 1T13A 3NALA 1HEUA 3EHEA 2ZQZA 3L7CA 2F67A 1WXFA 3JS5A 1MB2A 3F46A 2WF6A 4N12A 3NTXA 1NW6A 3QK7A 1T36B 3MINA 4QBGB 1S8OA 5J1SB 5EI5A 4EG4A 2ZANA 1D2RA 1H22A 3BMQA 1R4AA 2RGBA 4NESA 3BMOB 4NK5A 1QTQA 5GOZA 3E18A 2MINB 2HTFA 4R1OA 2WJPA 1XZCA 1WP9A 4Y9TA 5BSVA 4CLDA 4XDZA 3FI9A 3DXZA 4U02A 3SR0A 3WKAA 4JQZA 4BDSA 1ZNQO 4FIZA 4TN5A 3OOWA 1L1QA 1VKRA 4XXHA 3FMVA 4DQUA 5T57A 3GLIB 3O7WA 3N87A 1JQKA 2OPBA 2EU8A 5EP2A 4YV0A 1MIOA 5K2MA 4JLPA 3NM4A 4J07A 1QO9A 2GN0A 3W5CA 3WHIA 1TFUA 3IT2A 1LSOA 3T0IA 3C24A 4DLWA 3UQZA 4EHLA 4JLAA 4KXYA 1YAHA 3LKZA 3LT5A 3PFCA 2Q46A 4HNSA 4C7VA 1U7DA 4DCUA 4EFNA 1V43A 4DW8A 1KPGA 1KJIA 1OBHA 4EA6A 2WLSA 4MVJE 4GOJA 4Q4AA 4DCNA 3GB9A 3M6FA 3S81A 3EBPA 2B36A 2R7AA 4PR0A 3VKVA 1JHPA 4ENRA 3EH2A 4IYRA 1U7PA 1ISHA 2AUTA 3PEEA 5JS6A 2OILA 3EDQA 1EMDA 3IAM1 4KHZA 1IWPB 4MLZA 4ZGBA 4WNCA 4E11A 1P2BA 3OZ7A 4J9VA 2NV6A 4MQEA 1Y4ZA 4YQEA 1WZ2A 2FWMX 4G26A 4LJ5A 1DARA 2IWRA 1P31A 2QR3A 4AYXA 1XCLA 2OVBA 2JGNA 3VXKA 2J5XA 2QN9A 4BCCA 2AOTB 5HM8A 1XLTA 3FFAA 3WBBA 5JAPA 2J45A 2YC2C 3SKVA 1XQWA 2ZATA 3HLKA 3L4EA 3CW2A 1PTKA 3EMKA 3MRVA 3QUCA 2F43A 2Y1FA 4PQYA 2VDRB 1Q22A 2XCRB 2X6QA 3U4QB 1LW7A 3TEJA 3E3MA 4JLUA 4ZAYA 4WN3A 1MPTA 3PZRA 4DV3B 3S1SA 2I6GA 3NHZA 5HZKA 2WABA 1RMTA 1RHRA 4IOMA 4I50A 1KTVA 5MN4A 2GLXA 4AKEA 2FMUA 4CLRB 2YKGA 4LF6B 1QANA 4EWLA 4NULA 2FF5A 3H4IA 4XE5A 3FCUB 1Z16A 3RF7A 5JXWA 4M22A 5L6MB 3IUNA 4IQFA 1CS4C 1M34B 2GKOA 3ETHA 3IOCA 1GZ5A 4OMDA 4IIHA 3F90A 5E2IA 1R18A 3M7IA 1WSDA 4UTNA 3UAZA 4KX3A 2C9MA 3PP8A 1FFHA 3LKBA 5EE9A 2OR3A 3ZR4B 4II2A 4NBSA 4X3PA 2OHFA 3UKOA 3LUBA 4UTVA 2KLBA 1U7TA 4CQMB 5HPYB 5BUZA 4YQFA 1OAAA 3EXIA 4Q0MA 5G0UA 4XGQA 2AMYA 2HMAA 1UAYA 2IDJA 3KG2A 3KLNA 2JLAA 1QYRA 3EF0A 3I9FA 3E9YA 4YWJA 3BSSA 1HQCA 2QRLA 3B48A 3FD8A 4HH0A 4WY8A 1QHFA 1JMKC 3DZGA 3WDMA 4M1SA 4RD4A 3RLIA 4AP9A 2G9VA 3NHJA 4N8SA 1OGYA 3NHYA 1N36B 4B3TB 1EDBA 1RXSA 4U6SA 3O9MA 2VPZA 3L6BA 1LS6A 4I4LA 1DJLA 4LZPA 2VBIA 4UBIA 2PBRA 2O5CA 2ZTMA 3H3FA 4LJYA 3C41J 3MBOA 2PVCA 2X9GA 4QZVA 3NIDB 4YQZA 4GH5A 4V0LA 2C4KA 4FJ0A 4EGQA 4D9HA 1JI0A 4GO1A 1CUIA 1ZFNA 5JMOA 2ZLBA 3N0WA 2CXRA 1W49A 1J4AA 2R8PA 1UR5A 4B7CA 1MV5A 2ACKA 4MQMA 2IPXA 3GRVA 3GQBB 4E2WA 2H4ZA 4YJGA 5MFPA 4K6GA 1KQOA 3A8TA 2PKYX 3U9SA 4ZT4A 3EZGA 1L7VC 4NS1A 1XP8A 2V7GA 1FSGA 1P73A 2WWRA 4NYMQ 5TF0A 3HYLA 3PL1A 1O4WA 1OFIA 2Y1CA 4A2CA 4E03A 9MHTA 9ATCA 1Z12A 4KBYA 4NQRA 3X1JA 1A82A 1ECGA 1EGHA 2AC7A 2FEOA 2FSFA 2JGDB 4MAMA 3RQSA 2AFVA 1QV7A 3L7OA 1C4KA 3L40A 1GGVA 1NI4B 2XIQA 2XECA 3Q7RA 4PLGA 1L1EA 4HADA 3GZNA 4M9CA 1THZA 4NJEB 4RDIA 2ZVDA 4BL5A 2QZ9A 1UIRA 4RZSA 4KQEA 4C7XA 2VSYA 4MWOA 1TC2A 4CM4B 2LCQA 3MJFA 1AHIA 4YROA 2AFHB 1JALA 4J43A 4Q3BA 1ZXXA 4BECA 4P2BA 4E31A 3QEBZ 4N41A 1JBQA 2TMKA 1WCXA 3O8OB 4G8CA 5E7JA 3PGVA 1TMYA 4FXOA 4E51A 4MS1A 3VU1A 3ZE6A 2YNMD 4GF5A 2O7SA 2WT8A 4EY7A 1TD1A 1O8CA 5E3JA 3C3XA 3STVA 1UJ2A 4E5NA 3DCJA 2DG2A 3D2AA 3UXMA 1NBMA 4HLQB 1N1DA 2AX4A 4DCCA 3R3JA 4NMWA 2FPPA 5JANA 3W1WA 4KVZA 1TGVA 3H13A 1XZAA 2GWHA 3A2NA 5ALSA 3WA6A 4KYVA 4BZXA 3K6KA 1RKQA 2QRHA 4X71A 4BP9A 3O1LA 5A0TA 5FR2A 1E1NA 4GR4A 2G80A 2IA5A 2JJ1D 5LLSA 4BLTA 4EOGA 3IJEB 4HFNA 1BGXT 3WKCA 4FNOA 4C4ZA 4BDTA 4NFSA 3OSUA 4CIAA 1WDTA 3DCNA 5JWRA 3SVTA 2CYAA 2JEZA 4YFVA 2EJVA 3VDQA 2C5BA 5B30A 1E1DA 5IMSA 4KGDA 3QFHA 1UEXC 1WLYA 1N6IA 1X0VA 2AC2A 1BS2A 2DBVO 4HDKA 4I66A 3IODA 3QIAA 1HH4A 4G1CA 3W5SA 2GSDA 4DLAA 2NIPA 4I9UA 4ND8B 4MV0A 1HO3A 2RHTA 5JSHA 3CW9A 1M2FA 1PKXA 4BLOA 3A1NA 4F6RA 1DZIA 2X9QA 4KE8A 4BTVA 1M2JA 2PL3A 4N7BA 5I45A 1ZHHA 1ADGA 3X2SA 1PYSB 2VF4X 3A6PC 2P9JA 3HY3A 3NHRA 3QV2A 1Y7PA 4KE6A 3AP1A 5D6OA 1ZRNA 3DO8A 3VSEA 3BC1A 1MC1A 3L8ZA 2XUIA 4DIFA 1ID8A 3HU3A 1PFQA 3ZQJA 2A78A 2Z57A 2C3YA 3ESCA 4I3HA 3P20A 4E46A 4OLFA 2Z8YM 1W4LA 1KO4A 2NXWA 3GN1A 3TCNA 2W8BB 2VXYA 2UXCB 2P6OA 3P9QA 5CDSA 1XTTA 5IN5A 3PGJA 4EKEA 2UUPA 1OXUA 2Z43A 5CIQA 3VTFA 4YUZA 3KKNA 4QDKA 3T3DA 4BMNA 1E1KA 2DYKA 3IT3A 4DR5B 2AOVA 3IP8A 2H7XA 4WAUA 3DQZA 3ZLUA 3W5BA 1XNQB 2D59A 1RQNA 1CIJA 1SURA 3RFCA 4IKOA 4Y67A 1G0OA 1KBOA 2JCYA 1TVKA 1RZ3A 2WYUA 2XI4A 1OLXA 3W2HA 3AI3A 3GFFA 5FL7A 2O0KA 3R8CA 3WK8A 1J0AA 3O4VA 3H6KA 2VAWA 2I7VA 4K9NA 2XNSA 1ADJA 1E5TA 1PFGA 3UAWA 3IYLW 1OCEA 1T5BA 3VNRA 2OOKA 4JELA 4IQGA 4DXHA 4FHZA 2BRUC 4Y2TA 1N5JA 3IT0A 2WZQA 1H05A 2CSUA 2Z5LA 1JA0A 4G8DA 4HRVA 3F74A 1OYWA 2JD1A 1AXEA 1JHZA 2OO5A 1LQTA 5KJEA 1WCV1 2A0WA 1HPLA 1MTOA 2CJWB 4ILKA 1WDMA 4D57A 4Q4CA 5EQTA 2FP4A 1Y3CE 3GIDA 3EGOA 2R1ZA 2ZU6A 1ZOOA 4KFRA 4URXR 3AHGA 3UH1A 3KZVA 1LWNA 1I4DD 3LX6A 4QUBA 2M9MA 3FG9A 3U7GA 2GEUA 3CF6R 1ZI9A 2CDBA 3PLNA 1GLGA 5AKKA 3DE5X 1GPKA 1PT6A 3L92A 5F51A 1XLVA 1JHXA 1MEOA 2QB5A 521PA 3T4EA 4IIJA 4ZVUA 2JAHA 1HA3A 2IKSA 3ANTA 3H2ZA 2EKLA 2IITA 1NXQA 1WUYA 1VPLA 2DY1A 2I4LA 4M99A 4MQ6A 3BA1A 4O63O 2OBMA 3EXHC 2ZKLA 3ETCA 2XGJA 2OMKA 4QG7A 4CM7A 2HQ1A 1IZ0A 5JBQA 4G3XA 3KYIB 2QYSA 3STXA 3B2QA 2UVPB 4WVFA 5BN3A 2B82A 4IWYA 5CAEA 2XCSB 4NE2A 1OKKA 2X8BA 2HO5A 3K0FA 4P53A 2WD9A 4QUEA 1G7TA 5D5HA 1L0BA 3WIDA 3ZTTA 4D6YA 1RYZA 1ZG3A 3DVAA 4J90A 2WJJA 2WMOB 5IYZF 3FLAA 3UBMA 5IWCA 4P3XA 1C1DB 4QOEA 5HG0A 3AF0A 4AY3A 5FUQA 1VMDA 5JXHA 4BBAA 1FDWA 4RPHA 5ALYA 2JLUA 3IR5A 2F3TA 3UOAB 3NRBA 5AM2A 2B83A 4AECA 1UZUA 3D5EA 5CVVA 1IBMB 1UBLS 1ZZEA 2OUIA 2RG7A 2ZROA 3PUJA 4W9NA 1WVIA 5BSEA 2AN1A 2HV8A 2C7OA 1V4BA 4MWGA 4QLBA 2YOGA 3HU2A 2ZXEA 2Q5JA 3TPZA 1CRZA 1UDWA 5CCDA 2I2FA 2NTVA 2AF3C 2AV6A 2VQ6A 3AL3A 1VE1A 3EXG1 4GOOD 2PH1A 3EXEB 3QKRB 4S1VA 5E8RA 1M33A 4MQ5A 1B0PA 4II3A 4RO0A 2GEDA 2XR1A 4FU0A 5IX8A 1OTYA 3V7NA 4ZYLA 3M5CA 1GG9A 5GM1A 1A5SB 1Z2DA 3AH8A 2ZBQA 1ZAYA 3OHMA 2C83A 1X2EA 3KQUA 2FPLA 2XZPA 4BX9A 5ENZA 1SUBA 1HEIA 4UU0A 4QXMA 5LP6B 1PFWA 2W2LA 3V4ZA 1EIYB 1LUAA 4U6NA 4F12A 1OH6A 4OSEA 3L7LA 3EGCA 1B1AA 1T8TA 4YUWA 1ZRMA 4B1FA 1OC2A 4R4JA 4TYYA 2P8SA 1PYDA 1WW8A 1QORA 3LLCA 4GPIB 1HNNA 2D1SA 1DKRA 1KOJA 4LRSB 4RE6A 2Q3JA 3EGEA 2FQYA 3RJ9A 4L7QA 5DBFA 2FVXA 1FUIA 1VLLA 2FSSA 4R1QA 2RBGA 4V02A 2DTDA 3BEOA 4UM7A 2VXBA 5F76A 2POCA 4BNWA 1KYZA 3PA6A 5KTOA 1N1GA 4QPPA 4R5MA 4EAAA 4ENPA 3KJGA 5D3QA 1EFRD 4LG1A 4CL2A 2QSZA 2OHIA 3NT5A 2CCJA 2GF0A 2YTZA 3TJZA 4DQXA 2HOQA 4W7IA 4ZA2A 4YLYA 2BEJA 3K8QA 3MQ4A 5J47A 4DJ5X 1JEYA 4J0JA 4PAGA 2E5LB 1VC2A 5DP2A 4D5EA 2G77B 4I50F 4OIMA 4H3SA 3TS1A 4BC1A 1L4UA 3MRXA 3DMPA 4O2AB 1BO6A 1M6VB 1PJ8A 4N3AA 5LQAA 1RYEA 2BSAA 1LA2A 3QX8A 4C21A 2QX8A 1FTQA 2GKGA 3JQ8A 4JL8A 3R1IA 4DLYA 3PPXA 4HI0E 2ZBEA 5DLPA 1YBMA 1IXSB 1EJ0A 2R6DA 5ICSA 1AQNA 5C53B 4AY6A 2EDCA 1I36A 3HBNA 2NT4A 3V4RA 2ZUEA 1G21E 2NXEA 2XUFA 1ITZA 4K9DA 4O4JF 4EM6A 1UKYA 3L8FA 4N3GA 5JECA 3GRRA 1JF8A 1S02A 4XFKA 4C0AC 2HAEA 3A31A 4BLVA 1VHDA 2WMNB 3E58A 2FEPA 4YA6A 4G37A 1HNXB 1FFEA 4PC2A 5M04A 4IOKA 4YIHA 1Y1TA 5CX1B 5FTWA 4N3NA 4C0LA 3TG8A 4HTAA 3KDAA 1UFKA 2DF8A 4F2DA 1M72A 3Q2KA 1NMZA 3E0XA 3QELB 1RXVA 3M49A 4WECA 4ENTA 2OLKA 4QGSA 3IFSA 4KACA 1R8YA 4POAA 5F1PA 1VIDA 1EP2B 3GA0A 1BCRA 1S8AA 2ZIXB 1E98A 3AHFA 1PL7A 3E9NA 5FO1A 4HZUB 1KS9A 3R9XB 4ILEA 3PRYA 1S3SA 2VT3A 4JOBA 1PR4A 1ML3A 2PT5A 3C0KA 2R8RA 4LDPA 4G85A 2KYRA 4S0ZA 4UQPA 2GK3A 4MUGA 2M1ZA 2UUOA 3RSGA 3RS0A 1MF7A 4YTEA 2KX7A 3J81k 2VKQA 1QNLA 5A5DA 4DNOA 2JLVA 1ZESA 4U7FA 2FXIA 2AR0A 3WGJA 4M55A 2H29A 1JG4A 1Z6TA 2BMDA 4JGBA 1QWSA 4LCBA 1TUIA 2XSZA 1TJ5A 2Z9CA 4WIAA 2P4HX 1GEEA 2QY6A 4JFAA 3OD1A 1CNEA 3PUYA 4KO4S 4JI5B 4BIMA 5KYVA 1T0UA 2AG0A 2JIOA 3IA2A 4UUBA 5K0LA 3ZBQA 2ZR8A 1P7YA 3EIUA 1IONA 3Q1LA 5ES4B 1ORRA 2GBIA 1WW3A 2EARA 2A0FA 3Q5EA 5EE3A 4EL5A 1E4EA 1EBBA 4YMUA 1YQTA 1DLJA 4D0GA 3BG5A 2G1JA 2RB4A 1F48A 2X7XA 3Q88A 2E6UX 5IABA 5KYWB 2IP1A 3A1DA 4V38A 1P75A 3BJIC 5J5CA 2V7VA 4MQLA 5JAZA 2GYWA 3JSXA 5T7BA 4W9MC 3GA5A 1Q0UA 5PNTA 1VHJA 4L3OA 2IBSA 2V3WA 1GPDG 2ZSEA 1I1NA 3NOOA 4PHFA 4W8OA 1TTQB 3KSDO 3G6WA 3V8NA 4BNNA 2GA8A 3OFKA 1QYXA 3RR2A 4KWIA 3UAXA 3V8EA 1E2MA 3OT1A 1W88A 3U56A 2M32A 3ZD7A 5IK2A 3PHHA 3CCFA 4F3RA 5BUSA 3JTEA 5AUQA 3LOPA 4TUYB 1K8XB 4B4OA 1J2YA 1N0HA 1XRPA 4R8LA 1IB0A 1M8GA 4NNOA 3FNRA 5AOBA 3IDFA 2PJRA 3VYWA 3RM3A 3JATB 3JQCA 4Q12A 4BO5A 7MDHA 3HB5X 4MKZA 1OYVA 2JIDA 4QHYA 5KO2A 3EOBI 3VKUA 2BW0A 2O8CA 3TZEA 2VHUA 2P4SA 3CJRA 1W94A 3SQNA 4BFXA 2CSXA 3CNEA 2WFMA 3BH7A 4S2UA 4RTKA 3C6BA 2RC5A 4YO8A 4YBRA 1FVFA 4DC9A 1YI8A 1VPVA 5AUNB 4U0KA 2YZKA 4U2CA 4B81A 4OQFA 3RUDA 3PNVA 2HYIC 3LC2O 1UBSB 1I80A 2JJQA 2KBFA 1KSFX 2WYWA 3I9JA 3L0DA 3LA6A 4FW9A 1CRQA 3L77A 3U3JA 4CM9A 2H11A 4IM7A 4BMPB 1C9NA 3CLUC 3S7ZA 3FF1A 4BWYA 3N58A 4D4KA 1A77A 3DULA 3ZXXA 3BN3A 5A1JA 1CZHA 2ATCA 2P9BA 2R3SA 4X41A 3E27A 1PAUA 5AI9A 4JQOA 1E4VA 4LJAA 4C2BA 2QTMA 2WNSA 4HXYA 3SF0A 4BNZA 1QHYA 2FE1A 4H3VA 5ALWA 4L0CA 3TRDA 1CRWG 4N5DA 2HG7A 4LOIA 4DPMA 2BV3A 4QQRA 3QG5A 4REQB 4XDHA 3R7WA 1EK6A 5AKEA 3EVFA 3HDTA 5CHYA 5EQFA 5AYVA 1XF9A 4FQ7A 4GLBA 5F23A 3FBGA 4AAYA 2WQ7A 1KO1A 4XOIA 5CDGA 2IYXA 3F1KA 1OX4A 4ZWNA 2AN3A 4WE3A 3GVIA 5IDYA 1ZVQA 4X8HA 13PKA 3VJRA 1Z4PX 3U3OA 4R8SA 1E5LA 2VHEA 5AKZA 3AYXB 1FEZA 4CV0A 3CUUA 1TTTA 4JLBA 4LPSA 3WJAA 1XZBA 3AEZA 1HR0B 2C4NA 3H17A 4GOND 3B12A 3B85A 2QA5A 2I4NA 3VU0A 5SICE 2E18A 4EMSA 1XYYA 1UC9A 2PQ6A 2YZNA 4K03A 4F2HA 4WCFB 1AK1A 3DOEA 4XUCA 3W90A 3BJRA 4DM4A 1H8HA 1DRUA 4HRXA 4WLVA 4RVFA 3WL6A 3KXKA 2IEZA 4ITRC 3WNBA 2X42A 4MJ7A 4HQKA 4Y3UA 3ZW8A 1KYXA 4HLCA 1GZHB 3OUTA 5ALOA 4C6TA 2YV4A 3GF4A 9LDTA 1SCUB 4KR7A 1DBIA 4IP0A 3OQMA 1DMSA 2G6BA 2HA3A 2AJCA 3DFUA 1RAFA 1E6KA 2GZDA 2VS1A 3F3SA 3GP3A 3NO4A 4RH0A 5K8LA 2WG0A 3HY4A 1A9PA 4KXNA 4ENSA 2UVDA 3UMMA 1D6JA 2I78A 3PVZA 5KWEA 1PQ4A 4PV7A 4QVIA 1B74A 1DDIA 2ORIA 5KOIA 4HGZA 2OZLA 5FFMA 1N32B 2HA5A 1VPEA 5CCBA 2JHFA 1X1QA 1N5MA 4KQJA 4E22A 2DOKA 4FWBA 4OUDB 5EZYB 4IG9A 1E9SA 3VHXA 5SY4A 3G0IA 3FX2A 1W36C 2GBPA 2Y0PA 1P0FA 1U7ZA 2F90A 3DWIA 2ONZA 4GEKA 4REOA 3VDNB 1Y9ZA 3NNDA 1OXMA 2IX9A 1II9A 2NU6B 3KAKA 5G1OA 2WC1A 1PGJA 2AXPA 3AW8A 2ACVA 3D4BA 3K2BA 3K09C 4FBLA 5F9MA 1ZN2A 2WVHA 3MFQA 1SXPA 2NAPA 3T1QA 1NUQA 2RHOA 4JK3A 4JEMA 3D6AA 2AZTA 1JIUA 1BJRE 1I14A 2ZTUA 3M5WA 5DIFA 3N9IA 3OJCA 4CQLA 4FEEA 2D8MA 3L1UA 5BPHA 4ZCSA 1A4XA 3ANLA 1USWA 3L2OB 1GD1O 4RSRA 4BO0A 3CBGA 2X0FA 2PXXA 3ASVA 3PNMA 4L5BA 4UVIA 1SIOA 3K9BA 3EA4A 5GPBA 2FEWB 1P0QA 1EG7A 3OTGA 3OTOB 2CXUA 1G6HA 2CXOA 4QBTA 2C5EA 1GQSA 3LOQA 3U44A 4D3ZA 1INLA 1LSJA 1NZDA 1THMA 1UXKA 2WIKA 2Z04A 3OQVA 4TLLB 2X1HA 3A6FA 3FTPA 3H4VA 4UHCA 3M3DA 2HQSA 4C4YA 3VV3A 1UCFA 3RSCA 4DCMA 2O5EA 3CPJB 4DLZA 2Z2JA 4K81B 4L4ZA 3PXEA 1JVNA 3AUXA 1EX7A 4A8JA 3Q0TA 4C0KA 4WACA 2ZAOA 4B09A 3ROEA 3ROFA 2R2GA 3DOCA 2VDOB 3N8IA 3NATA 4URFA 3NXKA 4OQEA 3MJRA 4UJ3A 3P9PA 1JZQA 3R9WA 3KVRA 2X7JA 4O6VA 1B8PA 4W9RA 1Y5IA 2YWEA 4RYDA 3RKRA 1GCUA 4DHEA 3AUUA 3BQNB 1ZNWA 5L3SA 1XZGA 5ELXA 3W05A 3U19A 2K7FA 2H1VA 3IUQA 3TI9A 3WDKA 1DBRA 3EG9B 1G0NA 2DH6A 1LBSA 1I9CA 4I0WB 1FZQA 1CUAA 3WIUA 2H7CA 1ORVA 4LGCA 3ZGVA 3L1VA 1ANKA 1WVMA 4LI0A 2ECOA 3WGNA 3T9EA 3OPQA 2J9ZB 4NL4H 1K7SN 1SR8A 4IHAA 1KYIA 4B71A 1PZXA 3K30A 1FQOA 4OHFA 5I7EA 1DKNA 2AFRA 2QMUA 5BQ5A 3TZKA 1ADFA 3T7KA 1ID1A 2HF9A 4JP2A 1KRHA 3FM9A 5ESXA 5DN6D 3SQXA 1ZVVA 1L3CA 2G63A 4ZHQB 2W4IA 2YOFA 3P9IA 4QPJC 1Z2NX 2OV1A 1U2ZA 2I3BA 1KPHA 3I9V1 4B3CA 4CI0B 2XMBA 3IIEA 3K5IA 3ORRA 5EXPA 5HOEA 1JP7A 4P80A 5CU7A 1H8ED 4F21A 1LV8A 4QFDA 4S1WA 5T5QA 3W3ZB 4D4GA 3LL4A 1FF9A 1RJDA 1FSZA 1C3VA 1TQHA 4UDOA 4YT2A 3BJEA 3JQAB 1KMHB 2ZSFA 1FYFA 5JD5A 3DTVB 2LRHA 2YHUA 3TVDA 2BEVA 1P0CA 4DVJA 1TNDA 1B14A 1KI3A 1PZNA 2H16A 3DE3X 1JLLA 1LDBA 4O2BA 4CFZA 4F5EA 5M34A 4R9RA 2OYRA 2V03A 4HDSB 1NYQA 4WLUA 5TEVA 1VMEA 5J9FA 4HUQB 4IXDA 4WT7A 3JQQA 1KFJB 3B20A 1Z6XA 3AKYA 4Q18A 5AHOA 2CXNA 3T9AA 3E3LA 3KJFA 4P83A 1NW9B 2CNDA 4UCQA 4AS3A 2LNDA 3QNMA 2CBZA 5JFGA 1N0UA 5YASA 2PANA 2PIDA 2A58A 5AM3A 2RARA 4HZIA 1F6BA 1FFGA 1X38A 4NZPA 4PCUA 4U8HA 2O3UA 2R8XA 3GH1A 3NOQA 3P27A 5A06A 1D0IA 5JHHB 1B8VA 2O7RA 2ZSAA 3R3YA 2PWAA 3EUWA 2PR7A 1M5TA 1B2RA 1P5HA 2P1DA 3IRUA 4HL6A 1ZSVA 3D6VA 1WCIB 1QFSA 3J80A 3G59A 4OU5A 2ANCA 3DOUA 5JDCC 1TIPA 1S3FA 1S4MA 1ZZGA 2VDKB 3K94A 1G3MA 4MR9B 4QPCA 5JSZA 1JKFA 2P6MA 3DPSA 1JIXA 2V4UA 1OF1A 2F8SA 3DV0B 5ELLA 1NU8A 3BQMB 4C30A 4U1RA 5JSQA 3DBLB 2Y6UA 2OBYA 3B89A 4DDTA 3G17A 4KIFA 4E30A 1WX1A 1WXDA 1EGQA 2J7PD 1Z5UA 1HC7A 4K9QA 4P32A 4Y0NA 3RYFB 4EKYA 4FGKA 4C4TA 1YE8A 2SCUA 2WJAA 4TZ6A 4GMDA 2Z30A 3R24A 2B2XA 1PZFA 3AGQA 3IP6A 1QP0A 4U7WA 1V35A 4ZYXA 3B1XA 1MO3A 3WI7A 1E1CA 4FE3A 1LJUA 1SCQA 1H2RS 1KU0A 3D3KA 3ICVA 2GVZC 4KXXA 4DRXB 5A03A 3IV6A 4FHEA 2P27A 2V4ZA 1UZNA 3IO5A 4M36A 2IEBA 4IGIA 1YDGA 2HMUA 1KEUA 2WSYB 3DW1X 3GP5A 1PJ3A 1KS2A 2C9DA 2QS9A 1RYMA 2WT9A 4EYQA 1PFKA 4JV5B 3ZHBA 2FK8A 4CE6A 1UMKA 4OJYA 3IVAA 3G5AA 1G5TA 1T5SA 1IN8A 1X1DA 2WHXA 1A04A 4P81A 3QHAA 5ALZA 2DXIA 1FFXA 5E95A 2C7QA 1JFLA 2GD6A 4CEIB 3O90A 3R0QA 2O05A 4B4WA 4KXQA 3VTZA 3V6LA 2ZSHA 2HRZA 2IOFA 1KEZA 1HYEA 1W85A 1E2KA 2CK3A 3WGGA 2MR5A 2YDYA 1AKMA 1LKZA 2WQZA 3PDIB 4YJFA 1E3IA 1W0KD 2EP8A 2VJMA 5F52A 4TMVA 3F4KA 1K98A 1QKIA 2Q2QA 2VHXA 1XMXA 2AKAB 2Z5FA 2LTAA 2RSLA 2XNKA 3CLHA 1X70A 4NCIA 3EZ2A 4ITUA 2A0YA 1S3IA 2WHQA 4MO9A 1SRRA 2J08A 4JS0A 1EM8A 3CQ9A 3M6AA 4FW8A 4Q3OA 1M1YE 4FC7A 3OZIA 3EAQA 3PCOB 4BZZA 1XG5A 2ZJ6A 1TC1A 1JEQB 3A3YA 3LPCA 3QVXA 1IM8A 3PNPA 3C1AA 4IIVA 3SYTA 3TX2A 3NU1A 1GG8A 1SD2A 4FFSA 5FBKA 2YOHA 1N75A 4Z2AA 1PUIA 1FDVA 4FOSA 2GO1A 3T94A 3OZSA 1B23P 3D0KA 3NQ41 5IVDA 4BJ5A 3U7QA 4EHIA 4FFBB 1N7HA 4R69A 3DUFB 1Z6GA 1K3TA 1YL5A 5JEDA 1IHXA 2CHQA 3V1KA 1CUHA 1PR5A 1UANA 4HAOA 1RPTA 3ANMA 3LSTA 5EHNA 1I3KA 4IQ0A 4UAUA 3TXAA 3VJLA 3IO3A 2XXAB 2MHCA 1DO0A 1QQ6A 4JBNA 4CR8A 3A2KA 1ACLA 1JR3E 2H2GA 3KQQA 4CTKA 4MVJH 4NI5A 1TF7A 3S70A 4DT1B 4WXMA 3ORSA 5B64A 4BXOA 4ED9A 1KK2A 3QFRA 1G8AA 4EJ0A 4OX9Y 5HKKD 3DMNA 4C4OA 4OXNA 5A6VA 2D1YA 3CIFA 3UJAA 2I76A 4CCSA 2VXCA 1E1LA 2X5OA 1CHDA 2CHUA 2O8DB 4RKQA 1UINA 1N2CB 2C58A 2Q9AA 3KE8A 4G0QA 2NZJA 4FMDB 3SLGA 3WXMA 3QX3A 4Z4IA 4I19A 4CMGA 5KJ6A 4CQJA 1MEJA 1TRKA 3N0VA 3BMNA 3ZCPA 5AR1A 4IW3B 1VIMA 3BYZA 4JP1A 5B58T 3PVSA 4HEA6 5C18A 3UJCA 4YGXB 2DERA 4ZO7A 2HPHA 3TH5A 1TX4B 4BB6A 1C9JA 4J0GA 1BFKA 4Z0TA 3LX8A 2A1UA 3T15A 3WKDA 2VIIA 4JC0A 1QP7A 2C54A 4ASUD 2FMXA 1U3DA 2Q99A 3JQ7A 4G1UC 3T1NA 3PNYA 4DR2B 3URKA 4ZYVA 3DEYX 3JR7A 4Z3OA 1WZEA 3DZHA 3C2QA 4NKRA 3U31A 4IJWA 3W5IA 4BFTA 2C0QA 2V4MA 3AFOA 1A7AA 2CB0A 4JL6A 4MPJA 5LCXA 4BFZA 2E9SA 5KKNB 3OPMA 3Q7SA 1M76A 4ZZ2A 1D6MA 3HFSA 2M1XA 1KIMA 1QZXA 2G28A 4DR3B 1QQBA 2BHSA 4QT0A 2H7VA 3R0JA 1DXHA 1MNAA 2WILA 3JASA 1E6EA 4AZTA 4F1WA 1GFIA 1FTWA 1Y3IA 3CUVA 2FR8C 3FI0A 2H4WA 2V7EA 2EZTA 3LQ4A 2NO0A 3HR7A 1QCYA 2GHTA 3ECAA 4RY0A 4YJ2F 1PBTA 1DE0A 1P2DA 3DKIA 5ER9A 5D6NA 4AWAA 5AJXA 4OB8A 4A6EA 1PS8A 2J6CA 4NYIR 1MJNA 4IHJA 5DBGA 2GAJA 3K2EA 2C04A 1CY0A 3R0IA 1JFSA 1WSBA 3WBFA 3RRJA 1EWTA 3VVBA 3PEVA 4I4TA 3VSBA 2IV2X 2MJLA 2BP7B 2V0CA 5H3HA 3VPAA 5ABPA 3Q9UA 1U65A 4RD1A 2INGX 1QTRA 1WSWA 2MYNA 4X93A 4XD7D 3VAAA 2P11A 3W4KA 1RRPA 3TE7A 2IGBA 4IZHA 2LIPA 3BDIA 3VZSA 2P9TA 3F8TA 4O4IB 1ND6A 2B8TA 1MB9A 2AN4A 3MG9A 1IJBA 1EUCB 1D2HA 1WXWA 2FQWA 1U6IA 4OQZA 5F33A 3KTOA 5EUBA 3A1EA 4Y2YA 5HE8A 4IV0A 1KSHA 4LIPD 5CK5A 1LNQA 2I7XA 2XMSA 4LRQA 4JLMA 3ZWQA 1TYDE 2XKBA 1NBHA 1G8YA 3L1IA 1JIJA 5JYDA 1AMUA 1PV1A 1SUAA 1G6Q1 2WM3A 4K0KB 2O23A 3NH9A 5FBZA 3K35A 2ZRAA 3RARA 2AT1A 3ONDA 4H18A 3T54A 1EM6A 4AN4A 3MS4A 3V4FA 1AK9A 1X3SA 1XEAA 2ATXA 3DAGA 2JHCA 1PR0A 3PNBA 1GGHA 1NQXA 1PZGA 2IYRA 1GRQA 2YUIA 1XTSA 3OQPA 3VR6A 1IBCA 3K7EA 5AI8A 2JNWA 3FR8A 4FYYA 4GYKA 3FIUA 4B43A 1V7QA 1EEHA 1PF7E 2OCXA 4U9HS 5KNDH 2YJ6A 4D9EA 4IDAA 4G2TA 5K0TA 1YCDA 2BGUA 3HJNA 4FGJA 2PPLA 3HYNA 3FTCA 3JQGA 6NULA 1JFFB 4HWPA 4ZT3A 1H65A 4OIFA 1NTOA 5C7LO 4D9BA 3X1YA 4D4LA 4QQKA 1Z8NA 3PA8A 1YI1A 3HC7A 2GFHA 2ZI7A 1MVOA 2XUZA 1WXQA 4J0CA 4JA0A 1ZGHA 2Q1XA 4QEDA 2HU7A 1ZJWA 2BI8A 1ELOA 1XHEA 1W5TA 5GQSA 3BGSA 1DBPA 3HWX1 5DEOA 5BY2A 2XW6A 1DOHA 1FDRA 1U04A 3DAFA 2W9XA 4BB5A 2HT1A 5I9LA 3AV3A 3V1UA 2ZI3A 1T3SA 2HL6A 1B16A 1BMTA 3CWCA 3DMTA 3GBVA 1P0PA 3HB7A 3MS7A 4YWHA 3R7LA 5HR5A 5DM0A 4D46A 1JG1A 1WUJS 3RC1A 1ENPA 4YC7A 4B9AA 1Z7BA 4X6UA 5EKUA 3LH5A 1RCTE 3T35A 3VJKA 4BRUA 1DU4A 3TR5A 3KSUA 3G82C 1TO1E 2BFFA 4G25A 2ZUSA 4OATA 1Z75A 2QLLA 1V3VA 2J9GA 3AY0A 4Q3KA 1KHHA 1WUIS 2C0PA 2DZDA 4N47A 1TM7E 3IQDB 2J59A 1N1MA 2BKXA 3DL4A 3DWFA 2ETXA 1Y33E 2BGKA 2EQ5A 3B60A 5K3OA 4D3FA 1U5AA 1Z4LA 4BBJA 1Y8QA 3TOZA 5KBYA 1CLUA 2I2AA 2IELA 1JG6A 3AHCA 3I12A 5KMGA 2H9AA 3HA3A 2MSDB 3SX2A 5L51A 4EI9A 4I1PA 2V3VA 2NUTB 2HU5A 4MHSA 4ZU1X 3LGXA 3GUUA 4O2BF 2FPRA 3O74A 4B2PA 3F3KA 5KOHB 4E15A 2EF0A 3IVCA 4IMJB 5BSHA 1T2NA 3HJHA 3LWNA 4R05A 3OX2A 1WULS 4B6EA 1IOZA 3DT8A 3L8YA 3AIOA 4GVPA 4AO8A 4G0YA 1C8KA 3N5CA 1ZINA 3NV7A 2OTCA 3FYDA 5CA0A 2IOHA 2OAP1 3CX8A 1U7HA 1BKYA 2Y0DA 4HDCA 4MW5A 5AH0A 5EKSA 2GK6A 3UK2A 2ZRJA 3D4NA 2UZ4A 1MO6A 3FN4A 4F4FA 3SDBA 1GYQA 4QEZA 3LXRA 3DE0X 2NYAA 1PGOA 5H4HA 1R0CA 1ZVJA 1RXCA 3KFVA 5IC6A 5A5EA 3IV7A 3NDIA 4NCAA 5FI5A 2C5AA 2BYTA 1QFXA 4QULA 4M37A 4LF5B 4I6EA 3W9SA 1TEZA 2QMOA 1G5QA 1LEHA 3ZWNA 1ACMA 2CVZA 1RWVA 4M7OA 4MUBA 4XQEA 4Z1OA 4GWLA 1YR7A 2BAGA 3E6AA 2BM1A 1FRZA 3PQ2A 1OMOA 3ZVNA 3EHDA 1YVUA 2Y67A 3R6GA 4L4YA 2IPAB 5KSWB 4BS9A 3W79A 3IESA 1VMKA 2FN3A 3IURA 3OU6A 1ONOA 1A2BA 4A92A 4M9ZA 4AULA 1LVGA 4IWXA 4JYCA 4RFVA 1SBCA 1ZD5A 2GPBA 1ZUWA 1YFKA 2ASVA 3GPIA 4AO7A 5JC8A 4O4LB 4PN7A 1Z83A 1TM4E 3KLOA 1ZC3A 3SS7X 4NRDA 2B61A 3EBLA 3I9OA 4KWHA 2XVZA 2PZAA 3HK2A 2GWRA 3H3XA 4MW7A 3OWOA 3OZDA 3JSAA 1DEHA 5KZMB 5AHRA 3TAHA 5CDTA 1SVUA 1SQ6A 2GX6A 4TLBA 3A36A 5K09A 3TW8B 4DADA 5AI6A 1CY4A 5LC1A 1CZLA 2AZ4A 3REGA 3ZCSA 2LCFA 2XB2A 5C3MA 5K6AC 3EWIA 1PG5A 2OO7A 2WU4A 3VHLB 1MG5A 4CGZA 3O5AA 1AU9A 1ZONA 3N0RA 2MR6A 4RTPA 2XEDA 3D8SA 3ENQA 1F2DA 1X9IA 1VE6A 5CB8A 2ATVA 5KU7A 1WHSB 1PZMA 5CJ2A 2FAXA 2NM0A 1K4YA 3I52A 3E81A 3ZY3A 2MTBA 1XAGA 3MLBA 3M33A 3VYRB 2I29A 5H9VA 3B3AA 5ALJA 3PIIA 3TGLA 5CUQA 1WZCA 2V8OA 3PE6A 4N5MA 1E3SA 1QPGA 1E79A 3DMFA 3NNSA 4IDNA 2VHJA 2HYDA 1OFHA 4RIFA 5E6SA 4AJNA 5LNK1 3A05A 3C14C 4YAUA 3BUSA 3HJFA 4I8DA 1M2OA 3AF1A 3L06A 4NZ9A 4OJKA 5FLKA 1ST2A 3O8LA 4YCAA 1C8BA 5E9AA 1KNQA 1SVWA 3UKJA 3VYTB 3K9HA 1U6KA 3USZA 3SXPA 2BEUB 1FUYB 1SC6A 3NUGA 1SKAA 2HA0A 3AEKA 3QU2A 5D3KA 5B53A 2O2HA 3CUSA 3SFZA 3PFGA 3UC9A 1JSLA 4I55B 1U3TA 2H8KA 3TJRA 3KZKA 2BTQB 1I6MA 5LBUA 1F5SA 4FX5A 4C03A 3MHTA 3CY6A 4CF3A 1N78A 5JLAA 3MWDB 4KQXA 2QUKA 2BLLA 4FWTA 1Z7YA 1YKSA 2BH9A 2CT8A 2GT1A 4QTXA 3VU3A 4QUDA 5HBRA 4AY5A 4DF3A 1Z36A 1N3BA 4BX3A 2AEEA 3NYWA 2BH2A 2ZBDA 2IZ0A 5G0SA 4O8ZA 4DQDA 1UPUA 2BM9A 4UMFA 1YUMA 5JT1A 1J42A 4TV8F 3MCAA 4Q5IA 4Q39A 2C5GA 4B3IA 4D7AA 5AXCA 1DEOA 1XVVA 3VR1A 2XITA 5FV7A 1V8OA 2PL9A 2QXYA 4H08A 3PC2A 3OPYA 3EZLA 3USES 5EXSA 4GOKA 4TMXA 4H0FA 2OD2A 3Q6IA 4XCQA 3BIFA 3QJ5A 2A3NA 4LJ8A 1SXJA 1QTIA 4CCYB 1LU9A 1R10A 2QT1A 3BVPA 4RM3A 4UBJA 3V2IA 1DTWB 3BL8A 3MM4A 4CG1A 3LFHA 7AT1A 5FX2A 4LF9B 1QBKC 5FADA 3VPXA 1DDOA 1VCMA 3NZEA 4DUYB 3L6RA 3LU1A 4G0XA 1W93A 1AUPA 1PTJA 3IEMA 5EMNA 3VISA 5GJVC 1FOEB 3PUXA 5MGBA 4G5QA 5LMNB 2R8EA 3DLPX 1PR3A 2M98A 4KIJA 1JQEA 1QMPA 3SC4A 4EY3A 3B6KA 3N2GA 4QDUA 4R1MA 1VOTA 1P9WA 4NAVA 4AJ4A 4BNGA 2LXNA 2OK7A 2AX3A 2VR1A 2YHIA 3CX7A 4FHGA 1ZJZA 3OY2A 4L15A 1NAHA 1PGNA 2BFBA 3OIYA 5ALNA 1KQNA 3U3XA 3VR3A 1AHNA 4EZEA 3K9QO 5DRTA 3DTTA 2JRCA 4XYLA 5KIAA 2R0QC 1TIKA 2R6AA 2XGOA 4JQYA 2QPLA 3JZMA 3ST7A 3BL5A 5MF6A 3Q5DA 1KI2A 3C7KA 2BCEA 1VIYA 1DX6A 3R77A 4LZJA 1MOPA 3VNSA 3SKYA 3WLEA 3ZE7A 1AJEA 1OAOA 1YD7A 2PQ0A 3W5JA 1OXBB 1TJYA 4RC9A 1MP0A 4DABA 3K31A 1E3TA 3GJTA 3M9LA 3FKJA 3QHQA 4LRUA 3UGTA 2X5JO 5ISMA 1BCSB 1LC3A 4J9UE 3VO8A 2WZCA 3JARA 1LGYA 1NVEA 3N5KA 3W1EA 2AVNA 4J16A 4BMSA 1QAOA 2BGWA 4MV7A 1RM0A 1BE0A 2JLCA 5IAJA 5BNFA 2VJDA 3KT6A 2ZB2A 1L2TA 2IC5A 2ZI5A 3NTUA 4OLJA 4PEVA 4XOUA 7REQB 2A6PA 2F9LA 1QCCA 4TKVB 3DS8A 1N6PA 3TQRA 2RC6A 1AM4D 4K6CA 4K40A 4ER3A 1THTA 2Y4OA 4RWZA 5F7OA 3BXGA 1ZW1A 2GF2A 1B6GA 1HRDA 2BOVA 3LP6A 4GBMA 4TRMA 4WOKA 3SE7A 3TLAA 1JKMA 5LN1A 1TO2E 3NWJA 3I1JA 5A9SA 3C8DA 2A57A 4GP6A 1GZ6A 3ROGA 1WBDA 3THYA 2JEOA 2GBFA 5FNVB 3WADA 3V33A 1DT5A 4HLUC 2C9OA 2PX0A 3B38A 5TGDA 4PGAA 1G20B 1JHMA 4NYMR 1LJLA 3ZIUA 1IOVA 5AXDA 4BE9A 1YKFA 3OJ0A 3C7DB 3MRTA 1GFZA 5TPZD 2CL7X 5HZMA 3LXUX 2ES4A 2VP3A 5TQ0A 1R8QA 1KYVA 1SHTX 1ZH0A 2FU5C 2W2PA 3G0BA 4J4TA 4MX8A 3WDSA 3WLSA 4B73A 4EH1A 3FDIA 1CU1A 1E2NA 1EIWA 2D2EA 4BOYA 1V48A 1V5EA 2DWOA 2QYTA 4ANFA 2L69A 4OMUA 5CEEA 1T3TA 2A9QA 1E99A 1RZUA 1U9IA 1E1RA 2WE7A 3JQDA 4UARA 5IC5A 1KI1A 2CFRA 1XMPA 3DVQX 5TF4A 1XALA 4LF8B 2VHCA 3KZMA 3K5PA 4W5RA 4FGUA 2OC9A 2WICA 1TMOA 1WU7A 1SA0A 2QU8A 4MDYA 5G0WA 3Q6MA 3KJNA 4C7JA 3OCWA 1QO0A 1C1HA 1X7WA 1XDWA 2J5RA 2P2GA 2WJ6A 3KSZO 4JJ4A 2JFWA 3DOIA 2XYHA 4PZYA 4WBSA 4EKNB 4EVIA 3NYIA 4BNYA 3OZUA 5HKAA 3OTWA 3I01A 4HJXA 1KJ9A 4NXMB 4DA9A 2AYXA 1H4TA 4FFPA 5EJ5A 2P0EA 3SZ3A 1IUPA 1BQ4A 1VHLA 3UMGA 5ULLA 4B6JA 4DR4B 3PJRA 3E0QA 1LLFA 2FUG6 2V5UA 3NIBA 3MTAA 1QQ7A 4GX0A 3DF7A 5C1BA 5DM2A 3CF0A 3IPAA 3LE8A 2EKDA 5FPHA 5TGZA 5BSFA 1W0JD 3AVOA 3R6DA 5JVDA 2AK3A 5H1YA 2FI1A 2Q3LA 3AESB 1H2EA 4QJ5A 1DG9A 2QD3A 3H2BA 4BVGA 5JH7B 4I1RA 4H35A 4L6CA 2QDKA 1SZJG 1N5IA 1GSAA 3SICE 1XTQA 5ALDA 4ND6A 4G1MB 1JG3A 4RYLA 2VYVA 1L4GA 1I7PA 1YQXA 1C30A 1P5JA 4H7FA 1UPXA 3WP1B 4C07A 1JDBB 1UAAA 2DLDA 3UW3A 1OWOA 3E2IA 4UHJA 3TBKA 2OAGA 2YVAA 4WADA 4HVCA 5I3CA 5BOVA 1KH1A 1OBVA 2X0IA 3JR3A 3R44A 2JLXA 1M1ZA 1Z6YA 1C3XA 1DTEA 4HSEA 4N1AA 1DAOA 1D4ZA 3ANSA 3KUDA 4S1TA 4ZK6A 1YF3A 5LD2B 2V58A 4J3JA 1NJ5A 5CDFA 3ZZNA 3EEFA 1OXVA 1BYIA 1WL8A 3F71A 3ZI0A 4Q1CA 1TM5E 3RVMA 3ZY4A 4F85A 5E6UB 5AVWA 1WZIA 2YWRA 4JQSA 1CZRA 2N3ZA 4YP6A 3RRXA 3LUGA 3K9GA 3DMHA 4KVGA 2TS1A 2WJ3A 3QY0A 2C88A 3NRCA 4LRWA 3L7DA 4PPFA 3VI3B 1OREA 5CYFA 5TE9A 2XF2A 2VT7A 2FW9A 4N6GA 1FFSA 4L5JA 1HQDA 4LWQA 621PA 3KOYA 1C9KA 2GH1A 1U3WA 3A1CA 4BKRA 4CODB 3N2IA 5AK5A 4ZICA 3A4MA 5GMOA 1RQGA 2WB4A 4R7ZA 4PM4A 3TQSA 5C9ZA 3B9RA 1YNOA 3QGMA 4CN9A 4P3EB 3S3TA 2Y93A 4G81A 4YJHA 4ZKEA 5DHFA 3KPVA 3QKUA 2OCYC 2CKMA 1S2IA 3H8WA 4U3JA 3SBDA 4B87A 3ITDA 1SVSA 2P5SA 2R62A 2ZTLA 3LNCA 4ZPXA 3OURA 1X7XB 1MAAA 4MV6A 3N2NA 4EJSA 2AFIE 3DJYA 3MCZA 3CN9A 1Z6ZA 4MVXA 4ND2A 4F9TA 3BT7A 4MRNA 2IBTA 1QFYA 3EGWA 4FOLA 4RCZA 1FLNA 4Y9RA 2XWQA 2GEJA 3W2FA 3HUDA 5FUYA 3WK7A 4R71A 3WYGA 1EXWA 1ZGJA 3AY6A 3IKTA 3K70C 1K7FB 2YHBA 3SWWA 2VFAA 4RV9A 2MINA 2Y2UA 3OICA 2A0XA 4OOEA 2QRJA 1E4YA 1M6WA 2DGDA 3KXDA 3IR7A 4K9SA 4RPCA 4B74A 4IVPA 2Y71A 3ENKA 1YS2X 1NHWA 2BM8A 3EGXA 3GLIA 2ZJAA 2Q45A 1W25A 3KXPA 1MU0A 1NBIA 2OWEA 4UASA 4YRKA 1LXCA 1K08A 1RM5A 2W22A 3R5KA 1GRVA 2QUBA 1FNDA 1L4FA 2I3ZA 2O5RA 3Q2OA 2SECE 4UW9A 3QKSB 1P6XA 3P0HA 4PQFA 1PR2A 1I33A 4B2LA 2BEWA 4OXYA 1YR2A 4IIDA 3I04M 1GZ3A 1GZ7A 2AH5A 1CCWA 2PVPA 1R5BA 4FSHA 1DSSG 1HSOA 1ONNA 2C2BA 3IC5A 2FWAA 4X6LA 3X2EA 3WSTA 4JJAA 4Q9HA 4LHYA 1QNFA 2DHDA 4FQ5A 2HCRA 4PX2A 1ICIA 4E5MA 5HOQA 3OU2A 4FE4A 4OB7A 2JDID 4FMBB 4EO4A 2E5WA 3KJZA 2FPIA 2RJOA 3DMRA 3MC1A 2KM1A 3EY4A 1F4LA 5B6JA 4OJTA 1X6VA 3C7TA 4ZJPA 1BWQA 5TR9A 3BA6A 1M6EX 1YRLA 4LTDA 1U80A 4MYUA 5AJYA 5JTTA 1TJPB 4BLPA 1W96A 4X1OA 3IHKA 4CKCB 4KU4A 2QTCA 4UZEA 3GMSA 4QDZA 3RGWS 1ILWA 5CURA 1VBNA 2C7VA 2HRQA 5K8TA 2WUVA 3GDHA 5I8ZA 4LQCA 1P45A 5B4UA 3NTOA 2REXB 1NN1A 3Q85A 3W7BA 1SCJA 3N6VA 5SYMA 4GLJA 3U4QA 3DTNA 4ID3A 3ZYZA 5KJ1A 2G9RA 3V4VB 1L7PA 2OD9A 3GC6A 4RLHA 3TKAA 4G4SO 4YJ3B 1BMQA 2BMWA 3LBAA 4H6VA 4CLRA 3NNNA 2F7SA 1W9MA 4H15A 2P7IA 3OZCA 4CIVA 5M73B 1TU3A 3K5WA 4QWWA 5FWDA 2CZQA 2YZGA 5H68A 1KFKB 4PRLA 3WFJA 1O4VA 2NX2A 4GLLA 1QFZA 1ZRSA 3I23A 1IFXA 1AC5A 2Q1SA 2RH9B 1CS0B 3MCWA 3PC4A 5TQ2B 2CHEA 3ISVA 3WA7A 2WUFA 4IFBA 5J2UB 4QQNA 1WPRA 1Q1GA 3O2JA 1VP9A 2D3WA 3O26A 4DN6A 3RI3A 5A1TA 1T5IA 2H1FA 2ZRGA 3BE8A 2VCHA 4IRXA 4Y2UA 4YRZA 3FDZB 4RTLA 2CXIA 3M6IA 1LDMA 1XWWA 2M6RA 1J33A 1USVA 1D9XA 1N25A 4TYMA 3V8VA 2J9YB 4D98A 2FETA 4MP6A 4MP8A 3DCIA 5BSWA 1QH1B 4OQPA 5IAGA 2PZ8A 4RKFA 1PWYE 1ZK2A 1T2AA 2L18A 4X95A 4BQFA 3HDJA 2A86A 4LHVA 3EISA 4C89A 1CVLA 1Q7GA 5KQPA 1GNQA 3C70A 3NLLA 4QU5A 1DPGA 4YDSA 3SSNA 1JNYA 3LBIA 3QWAA 2R85A 3RSHA 4YT4A 1QK5A 2QT0A 1SB8A 3HGMA 1IQUA 3KFXA 2VRCD 4NAUA 1EVEA 2JFQA 4QBHA 1DKMA 3GLKA 3ICEA 3ZIAD 1P17A 4TKUB 3EGDB 4CEJB 5IF9A 5K6RA 2NMVA 2GJKA 4TKLA 2HF2A 3FWZA 1T0PA 5COBA 3R74A 2GN6A 3ROTA 3UHPA 1RYFA 3ESYA 2JI9A 1JPUA 4DJJA 1S01A 3EWNA 2D0OB 2PLAA 5JSFA 5F7XA 2EFGA 2JI8A 1OLUB 4JOQA 3SI7A 1KQFA 3Q8MA 2J87A 3HFJA 1G4AE 2IHKA 2NVWA 1UXJA 1GKYA 3DZBA 3L5OA 3QVWA 1LF0A 4N40A 1MB4A 3VYUB 1DEKA 2YYSA 4UQOA 3WWZA 4ESOA 2ONYA 5JASA 3VKHA 1BXZA 1PLKA 3M4JA 3IUBA 4GXNA 4YMTA 5JS8A 4DUGD 4CQNA 3NDBB 4X7MA 1OV4A 1QUFA 3I9NA 3TD9A 1M6YA 1Z2CA 2V5VA 3PDJA 4WOJA 5ALIA 1DAIA 2QTAA 4X8LA 2D06A 3AERB 1QGOA 2PZKA 4MICA 4E32A 2JGDA 1TCCA 3T9DA 5A6SB 4MUAA 1VZ2A 4NEQA 3G2NA 1EDEA 3LY8A 4A0FA 3C74A 1J1IA 1FSSA 3F5MA 1YC2A 4MEAA 1OLSB 2A94A 2BELA 2QKYA 1OFUX 4QJ3A 4ZFNA 5CB0A 4TQGA 3H1AA 4GIBA 4MRMA 4CM4A 4XYEA 3BXEA 3P4XA 2AFHA 3C8MA 4ER6A 1JIKA 1YDHA 3GLGA 1ZCZA 5F7ZA 3L6CA 1B6RA 1M8PA 1RE0A 1UFQA 2BDUA 3D3WA 3O8OA 4FI3F 4TMKA 4L73A 4XSGA 3TIXB 3ZZTA 3CG0A 4G5GA 3RUCA 3N0TA 2YIDA 3IAM6 1XTRA 2FKNA 2FPGA 3CR3C 1ZMBA 4HQLA 5SZIA 3PR3A 3OFNA 4KDCA 3H9UA 4K9OA 5KOYA 5A9RA 4WY2A 4RK6A 1ESMA 1SU6A 3I0MA 4OG2A 4NJMB 3PUZA 1VJCA 2PSEA 2JFHA 2X5XA 4MGZR 1P4HA 3GT4A 2PKQO 1VKHA 1RWKA 4YAEA 1CT9A 2E4WA 5FB3A 4GDMA 1UC4B 4KNWA 3TTWA 5COQA 2RAUA 5EE5B 4YMVA 4F3YA 2WIFA 5EA2A 3K8YA 2X15A 5FOSA 5CFOA 3I9LA 4ZI7F 2J33A 4X44A 4EYGA 2GJAA 3CZ9A 4FDTA 2M6KA 3DWEX 2AOWA 3T3NA 2HO4A 1KVQA 3FYHA 2P1ZA 5G40A 3AR8A 3JVVA 5EGSA 1KQGA 1XDSA 1X87A 1QKKA 1F17A 4JIGA 5HA5A 2GILA 4WKOA 3Q5GA 2RHBA 3LHDA 4Y9UA 1FSFA 2OUKA 2EFDB 2GJ4A 4XM2A 1KKMA 3ZQ6A 3ZHSA 2I4IA 1Q7RA 4YMWA 3QA3E 3TFWA 1QRSA 4OFXA 4E94A 2OV6A 4QXAA 5I4CA 3BE6A 2R1TB 4S12A 4A5SA 2H07A 4BATA 1NOIA 1F2UA 2WHYA 3ZKWB 3ZW9A 2JK0A 1F60A 2QYOA 5IMBA 1KMCA 3NFRA 3O1HB 4W5WA 1UT6A 3PJEA 1WQ4A 1JNXX 2WKSA 2ZUVA 1ZIYA 4BP3A 7GPBA 3LUJA 3W3AD 2I4RA 1JT2A 3GEMA 5CCEA 1KEKA 3WYFA 4RPKA 2XRZA 4GRDA 1NW5A 3W9YA 3X1ZA 4O25A 3MCVA 1G38A 1B73A 1NRWA 3RUEA 3BFXA 4R41A 4W5JA 2ON6A 4A91A 1I2AA 1HTBA 4PO1A 4BQOA 5LPNA 6CHYA 1OBCA 1AH2A 1H0HA 2QK4A 4BNVA 3PTZA 1NKTA 2C2WA 2VPYA 1DFGA 4KN8A 1D2EA 2P0YA 4MW4A 3V4SA 2GM4A 3GJ5A 4KOAA 2XMQA 1U0EA 4NBVA 2HK8A 1U0JA 3R6WA 4Q9KA 4YASA 3UMYA 2JGIA 5JVDF 3DAYA 3G8BA 3G5UA 4WOCA 2XNDA 1U31A 3NR2A 5FI1B 4Z0NA 2ALYB 3FB1A 2O7VA 4PC7A 5J5VA 4DIKA 4EI2A 2F4VB 4LY6A 3R09A 4HYEA 4JBWA 2VDPB 2AYZA 2WIBA 4RVGA 2I6UA 5AXBA 2PCLA 1C9YA 1SGWA 1PV2A 1UJNA 1GWNA 1WXEA 4PZZA 4ARZA 1T43A 3HRHA 4V03A 1WMFA 5LR6A 2XHEA 3M0EA 4HNGA 2JB9A 3MB5A 1DC7A 3QF7A 2CLKB 4O29A 5G41A 4B45A 5C8YF 4GL4A 2QUAA 3ND7A 3Q12A 5M2QA 4GAEA 2QU7A 1O95C 3GLFE 1OXKB 3AHJA 3MGBA 4JR0A 5JOQA 1KZYC 2W42A 4N6OA 1E66A 3WQSB 2Q2VA 4PF1A 5DXJA 3ZNQA 3UJ6A 4EKDA 1YQEA 2RHRA 1ISPA 1IMJA 1DBQA 1JAZA 1ECFA 3CR8A 3I8OA 2O2JA 2QQGA 4HBGA 3THSA 3HKBA 1VXOA 3N53A 3WLOA 2YVQA 2C1EA 3OC6A 2OGUA 3THRA 4QO7A 3SS8A 4E3WA 4WSOA 4FOOA 4DWWA 3ESBA 4UU1A 1E0DA 2QTTA 4QRHA 1K75A 4M9RA 3UWPA 4GW3A 1MR3F 2YIMA 4RVNA 1CEQA 1M1XB 3I76A 3BH0A 2XVAA 3T5MA 5JDIA 1E0AA 2XXBA 4YACA 4YDHB 1M74A 5CBPB 1QRDA 4F06A 5AVJA 2B20A 1YACA 3FPFA 3R0ZA 4XCVA 2QE6A 4PZ0A 3WOVA 3DSRA 1MOQA 3EXFB 3IA7A 3KTFA 3VX3A 3T1YB 1ABFA 1H1LB 1N7JA 1SOAA 1RMYA 1Z2OX 3RLFA 5HIMA 3DFMA 4ZDKA 3KP1A 2IYVA 4KO2S 4PG4A 3ZGXA 1XELA 4P5DA 4BLQA 4MRPA 1E8DA 1R4ZA 4MJLA 4J29A 5AHWA 4R3NA 3WX0A 4M8NE 1X80B 2J07A 1X1CA 4FJ2A 4BO7A 1CDZA 3KQNA 1TI7A 3MRSA 1SUPA 4PAOA 3AUFA 2J9XB 4JYBA 2WAAA 3E03A 4K8OA 3WAGA 2HN9A 2D4HA 3VH2A 5B3KA 4D80A 4D81A 3IIIA 4QVGA 1QF7A 3TZBA 4RLSA 3EDCA 5HRUA 4KR2A 4OHUA 4KQ1A 4MQFA 2LKCA 3SC6A 1AKVA 2ZU0C 1JH8A 2W2KB 3CRZA 4EI7A 3SIXA 4DGQA 2HX1A 1NC3A 4BGEA 2WE8A 2X8JB 3GLHE 3HUFA 1L8AA 1OWNA 1YOBA 2XWSA 2JHGA 3FPBA 5J2TB 1UKBA 1JYSA 4FZ3A 4Y6RA 4DDMA 4PANA 4ROSA 4YYEA 1PRYA 2ROQA 3B53X 1JG7A 4R1TA 2FZLA 4RMHA 4WK6A 2NZYA 3C39A 2PUVA 3H5NA 4GI1A 2AE2A 4B3FX 1ABEA 1XJCA 1XZ8A 2O6HA 3EPHA 1JDJA 3EH1A 3C85A 3ZE9A 4MTLA 2P2CA 4EY6A 2G04A 3IILA 4DQKA 3O91A 4DLKA 3OP1A 4G56A 2G9UA 5EIHA 4X3OA 1QIGA 4LNUB 1YL6A 3HCDA 3I45A 5L53A 3SYKA 3K16A 2DCUA 3GBPA 1MC4A 1WDKA 4Q16A 2BBSA 1KDYA 1FLAA 4D9IA 4KXFB 1YNSA 3DFIA 5BT9A 4UEWA 4X66B 1RAGA 2XVXA 3G9UA 4JSYA 4MV4A 3DE4X 3ZI4A 3Q10A 3QM1A 2LDXA 5K3CA 5IJAA 2QTNA 2CNWD 3LAWA 3WJ2A 4BZQA 1IEWA 4QLAA 2I1WA 4MYTA 5IASA 1I24A 4R9NA 5KCMA 4UBLA 3IE1A 1T0HB 3CLTD 2YV3A 3RC3A 5IJWA 1N6HA 2VTBB 2ZJFA 3AC0A 2SICE 3KYCB 2FLWA 1XXHB 5LVAA 1USKA 4ZZ0A 1YU6A 2L82A 4XGIA 3DE7X 1IOWA 4UXJA 1MABB 2FRVA 4MB2A 4XLZA 1E62A 1EDZA 2ODNA 2WMDA 5H3CA 3B3JA 4PLHA 3CNQS 1IQRA 4F2PA 2OWDA 5BV1A 3RVKA 4Q6BA 2GXSA 2JF0A 4ZYWA 1UPCA