3AXTA

Complex structure of trna methyltransferase trm1 from aquifex aeolicus with s-adenosyl-l-methionine
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
387
structure length
387
Chain Sequence
MEIVQEGIAKIIVPEIPKTVSSDMPVFYNPRMRVNRDLAVLGLEYLCKKLGRPVKVADPLSASGIRAIRFLLETSCVEKAYANDISSKAIEIMKENFKLNNIPEDRYEIHGMEANFFLRKEWGFGFDYVDLDPFGTPVPFIESVALSMKRGGILSLTATDTAPLSGTYPKTCMRRYMARPLRNEFKHEVGIRILIKKVIELAAQYDIAMIPIFAYSHLHYFKLFFVKERGVEKVDKLIEQFGYIQYCFNCMNREVVTDLYKFKEKCPHCGSKFHIGGPLWIGKLWDEEFTNFLYEEAQKREEIEKETKRILKLIKEESQLQTVGFYVLSKLAEKVKLPAQPPIRIAVKFFNGVRTHFVGDGFRTNLSFEEVMKKMEELKEKQKEFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate tRNA recognition mechanism of a multisite-specific tRNA methyltransferase, Aquifex aeolicus Trm1, based on the X-ray crystal structure
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
molecule keywords Probable N(2),N(2)-dimethylguanosine tRNA methyltransferase
total genus 135
structure length 387
sequence length 387
ec nomenclature ec 2.1.1.215: tRNA (guanine(26)-N(2)/guanine(27)-N(2))-dimethyltransferase.
pdb deposition date 2011-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02005 TRM N2,N2-dimethylguanosine tRNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.56.70 Alpha Beta 2-Layer Sandwich Phenylalanyl-tRNA Synthetase; Chain B, domain 1 Phenylalanyl-tRNA Synthetase; Chain B, domain 1 3axtA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3axtA01
2AZTA 2CWWA 3C3PA 3TFWA 3GDHA 2B3TA 3MERA 4FP9A 1D2GA 5CVEA 3SGLA 3HCFA 3O7WA 5BP7A 3PT9A 4IV0A 4RTPA 3UJBA 3BWYA 3SVZA 3AXSA 4X41A 2V74B 2H00A 4C06A 2IDJA 5EIWA 3HNRA 1M6YA 2VDWA 3G7UA 3P9IA 4GQBA 3S68A 4DMGA 1FJXA 1XDZA 5DXJA 2ONYA 2QY6A 3LHDA 2FHPA 3OU6A 4R05A 4BY9E 5LQJA 3LCUA 3C3YA 2ZZNA 5GOZA 4E2YA 1R74A 5DX1A 2NP7A 2GPYA 2K4MA 1FPQA 3DH0A 5CVVA 1SUSA 3M70A 1EJ6A 1RI4A 3I58A 2ZIEA 4QPPA 1WZNA 2GA9A 3U81A 2LD4A 3EEYA 4KDRA 1NKVA 2R6ZA 3UJCA 2OZVA 4RTSA 4E31A 4OA5A 4PYMA 4E32A 5ICCA 2XVMA 1UIRA 2AVDA 4QDJA 1XCJA 1VP9A 2ORED 4G56A 5CD1A 4QQKA 1JQ3A 4ER0A 3IYLW 3MHTA 5C9ZA 4XUEA 4DM3A 5CCBA 3UBTA 3HVJA 3EVDA 1QZZA 1AV6A 2IDKA 1WXWA 3B89A 2ERCA 3DMHA 3C6KA 3FYDA 4QTUB 4GEKA 3ERCA 3KPUA 1R00A 3KQTA 4M36A 4NECA 10MHA 2Z6UA 3LBFA 3V8VA 2VDVE 4IWNA 5E1OA 3GO4A 4HGZA 5DPMA 2UYCA 2F8LA 4YUYA 4KIGA 2YQZA 3TR6A 3B7PA 2Z6AA 4CKEA 4RTQA 1WY7A 2V7EA 3GRYA 3X0DA 3LDFA 5HFJA 3L8DA 4ZTBA 2IBSA 1P91A 4YUWA 2P35A 2IH2A 3F4KA 1VLMA 4U7TB 5K09A 2CL5A 5EVJA 5IKMA 3DR5A 4CTKA 5GIOE 2OB2A 2ZWAA 1SVUA 3CKKA 3QOWA 3P2IA 3GU3A 3HP7A 3KQWA 4AZVA 2EG5A 3D2LA 5LSAA 4BLWA 3A27A 2JG3A 1MJFA 2BR4A 2VDUE 4RTRA 2UYHA 5E2AA 3FPJA 5GWXA 5DM4A 3BXOA 3LDUA 1QYRA 1KIAA 2AR0A 3KPYA 2ZCJA 5KS2A 3G5LA 3GCZA 3C6MA 2ZLBA 4RTMA 3UA4A 4ISCA 2ZBQA 5EMMA 3SX0A 3UJ9A 3UA3A 3VC1A 3TPZA 3JWGA 4EQZA 2QRVA 3OU2A 3FTFA 3ELYA 3G2PA 2VZ9A 5FQNA 1NW5A 2YXDA 5HIJA 1YUBA 3PX3A 1D2HA 4DF3A 4ER7A 3VYWA 1KR5A 2ZIFA 1NV8A 3P2KA 1PRYA 3PFHA 3B5IA 2O06A 5EC8A 3SSMA 3TOSA 1L9KA 3HCEA 4HG2A 4LWPA 4UOEA 3MGGA 2FCAA 4M37A 5F2OA 3HCAA 2C7RA 2P7HA 4R8RA 7MHTA 3CJTA 3FUXA 5CVUA 1IY9A 1ZHFA 3SMQA 2FK7A 5FQOA 1RJEA 4RVHA 1QAQA 4RVDA 1VE3A 1G8AA 3DP7A 1QAMA 3E05A 2GH1A 1R6AA 5K05A 2NYUA 3MAGA 3LL7A 3AXTA 4PINA 5EKXA 2YUIA 1H1DA 5KQSA 3GNLA 4MTLA 4EKGA 5EMKA 5DT2A 2PGXA 2AOTB 1P1CA 3NW9A 5LQAA 4CTJA 1ZQ9A 1FP1D 2CKDA 2Q41A 5C1IA 3UFBA 3R0QA 5CM2Z 3KR1A 5E1MA 1YFJA 5HIIA 3KPVA 2ZVJA 3KQQA 2IBTA 4PIMA 4PYJA 1PJZA 1NBIA 2H1RA 3LPMA 3KQMA 1X19A 3KQYA 2JHCA 5E8JA 3R9XB 3QOXA 2AVNA 2OYRA 3ELUA 2UZ4A 4DKJA 1ZKDA 3LECA 1NE2A 2KW5A 2NP6A 1XXLA 5K0LA 5JUWA 4CKCA 3KR2A 3HCCA 3HM2A 3B3FA 4YV2A 2DPMA 5LQKA 3IHTA 3EEOA 4YMGA 4WXHA 4HRAA 3PX2A 2ZSUA 5BXYA 3G88A 2YX1A 3BKWA 3OU7A 3TKAA 4FGZA 5DX0A 2GAFA 3ID6C 4IV8A 2QM3A 4H0NA 4EVIA 3PS9A 2AOWA 5EZSA 2PSSA 4QDKA 4AZSA 4FSDA 2OKCA 5EG5A 8MHTA 2IFTA 5G02A 4C07A 4C08A 3HA7A 4MQ4A 2WK1A 3P9CA 3OE5A 4JXJA 3PTAA 3DUWA 4KWCA 4L7VA 5DTRA 4PONA 2FK8A 4YV1A 2HTEA 9MHTA 3VSEA 1TW2A 3DLCA 2ZBRA 1QAOA 3EVCA 3KQVA 3HVHA 4GOND 2OO3A 4RYLA 5GIPE 2GB4A 4KDCA 2EJTA 3FUVA 1UFKA 1VIDA 1EAMA 3EGIA 5P8WA 1JG3A 2ZULA 3FUTA 3MTIA 5EOVA 3ELWA 2P3LA 4FZVA 1Y8CA 1X1DA 3G8BA 3G8AA 1SKMA 3E7PA 1WXXA 4WVLA 5B1SA 3PFGA 1G6Q1 5EZQA 1JG1A 1P39A 3GRRA 1O54A 3P9KA 5FHRA 3UJ8A 1MHTA 2NXNA 1VPTA 1V39A 4F84A 5JR3A 4XUCA 1RI5A 3TMAA 1ZG3A 4C03A 3BKXA 2YXEA 4YMHA 3HTXA 4PCAA 5HOQA 3R24A 4KIFA 4EKIA 1BOOA 3KHKA 5K0CA 5C0OE 5DM1A 4DZRA 4BLVA 1NW3A 2XYRA 5CUQA 3A26A 3GXOA 1OR8A 1F38A 2CMHA 3P97A 5DTMA 5E1BA 3VC2A 4A6EA 3OCJA 5LQCA 5GP1A 1KP9A 4HTFB 3JWIA 2P8JA 3LDGA 1X1BA 4PWYA 3M33A 3THSA 4LECA 2PXAA 2Y1WA 3ER9A 3FTCA 5EEGA 2PX5A 1YZ3A 3PB3A 5ICGA 2AOUA 2P41A 3C0KA 3MQ2A 5KYGA 5FA5A 2P1DA 3M6UA 2R3SA 1L3IA 4XCXA 2UYQA 3OFKA 2IH4A 5EHIA 2YTZA 4FR0A 5FHQA 5GM1A 3MCTA 3MCZA 3NMUF 3K6RA 3IV6A 5K01A 1X1AA 2AN3A 4DA4A 3NJRA 4OBXA 4PYLA 3FPGA 4DCMA 4AX8A 2IH5A 2PKWA 3UZUA 1HNNA 3GWZA 2NXCA 5K0GA 2AN5A 5DSTA 3UJ6A 2B9EA 5M5BA 2EX4A 2A14A 4PCLA 3UWPA 1DL5A 2UYOA 3BGVA 3NDJA 2ZWVA 1JQEA 4CWAA 1TPYA 3T0IA 2PBFA 4CXMA 4LG1A 3CBGA 4QVKA 2GLUA 1VBFA 3OZSA 3P2EA 2PX4A 3LKZA 5CIYA 4X61A 4HSGA 3HEMA 3KPWA 4FSXA 1Z3CA 3FRHA 1L1EA 2ZFUA 3H2BA 2G71A 4FS8A 1R8XA 5E8RA 2E5WA 3I64A 2ONZA 4R6WA 1KYZA 1I9GA 4Y30A 4AZTA 4RTOA 4MWZA 4FT4A 2PWPA 3HCDA 5MHTA 4HGYA 3FRIA 3B3GA 3BGDA 1G60A 5DM0A 5E2BA 4C4AA 2YVLA 4EMSA 1TW3A 2AOVA 2HNKA 4HC4A 2VP3A 2NXJA 3TM4A 2OBFA 3KR0A 2HV9A 3R3HA 3CJRA 3ORHA 3Q87B 3TQSA 4RTLA 5ICEA 3T7RA 3O31A 1B42A 2ESRA 5CVDA 1XDUA 3R6TA 4V0QA 4BP1A 3LCVB 2PY6A 3EVAA 3DMGA 3EPPA 1U2ZA 2I7CA 1N2XA 3KPJA 3NWBA 4YUVA 2IPXA 3GJYA 1R18A 4RX1A 4V0RA 2BM8A 1DUSA 5K0FA 1X1CA 4YV0A 5K03A 3ME5A 2G8NA 4BP3A 2AS0A 4OX9Y 2AOUB 1RI3A 3NDIA 2JHAA 3EGEA 3I53A 3KKZA 2O0LA 3GIWA 3MB5A 5T67A 5LQUA 1UWVA 1NW7A 3DMFA 1KPHA 3BWMA 2GS9A 4R6XA 1L3CA 3BUSA 2OPBA 4M7RA 5HIKA 3CJQA 5DM2A 3NWEA 4ATNA 2QRVB 5E1DA 2PX2A 2O07A 5E9WA 3B3JA 3BWCA 2G70A 3BWBA 3P71T 3HVIA 2FPOA 3AWIA 3ANXA 4K6MA 1G8SA 2BZGA 4R8SA 4PGGA 3DXZA 3E8SA 3HA3A 2EFJA 2HMYB 4RVGA 2AOXA 2IGTA 3EMDA 3OZTA 1D2CA 3UJDA 4RTJA 4YUZA 5DRTA 3RW9A 1JTFA 2B78A 1IXKA 5FADA 3MTEA 2ZZKA 3CVOA 3LX6A 2Y1XA 3HA5A 4GC9A 5EKUA 3HCBA 2OB1A 5EQJB 2H11A 1L3BA 4QQNA 3G5TA 2P7IA 2I6GA 4PIPA 4C04A 4RTKA 3P9NA 2IP2A 3T7TA 1JTEA 1NW8A 5LR6A 5HZMA 4KVZA 3ER8A 3TM5A 3GGDA 1NT2A 2ZBPA 3ELDA 3M6WA 4LWOA 5K8VA 2NNWB 2O57A 3FPHA 2PT9A 3UJAA 1IM8A 2XVAA 2JH9A 1NW6A 4PYNA 3RIEA 3A7DA 1JQDA 1T43A 5H02A 2XYVA 3NVMB 3M6VA 3THRA 3NVKI 3DXYA 4F85A 1BHJA 1ZGAA 2G72A 3UJ7A 1YFLA 3PLAE 4OA8A 1RI2A 5FUBA 1KXZA 4RVFA 3BGIA 4O29A 3T7SA 1YZHA 4PYQA 1JSZA 4XUDA 2P3OA 5D1HA 4PYKA 4DQ0A 2I62A 3A4TA 4GBED 2C7PA 1XDSA 3EGVA 2AOTA 2PWYA 3I5UA 5T64A 1RI1A 5BW4A 4OQDA 3SR4A 1NV9A 1SQFA 1JG2A 3CCFA 1AQJA 5GM2A 3DTNA 2JHPA 1M0EA 3JWJA 1BC5A 1SQGA 2PX8A 4IKPA 4E70A 1RJFA 2IIPA 1G38A 3AJDA 2B25A 4PYIA 1N7IA 5DSXA 1EQAA 2CMGA 3Q7EA 5FULA 3EVFA 3REOA 4AUKA 2VS1A 1EIZA 4QTTB 1JSXA 1N7JA 4E30A 3OPNA 4HTFA 4X60A 3RODA 2FRXA 5GINE 4MIKA 3EVZA 4Y2HA 3M4XA 1ORIA 3EVEA 3LGAA 5FTWA 4PNEA 2QYOA 3LSTA 5LQNA 1Q0SA 1G55A 2YR0A 2YXLA 3FTEA 2JJQA 4HH4A 4KW7A 4MHTA 4M38A 5F2KA 4X1OA 2AN4A 5KVAA 3G2QA 3TKYA 3NTVA 3FTDA 3WSTA 3TLJA 5K0BA 5DWQA 2BR5A 4KRGA 1INLA 1ZGJA 2PXCA 2XBMA 2WA2A 4E33A 4AZWA 4PYOA 3BT7A 1XJ5A 2BR3A 3DOUA 1KPIA 4P7JA 4Z2YA 2NXEA 1KHHA 2ADMA 1VQ1A 3FPEA 3G2MA 4GOLD 2G1PA 3OE4A 3FYCA 1JG4A 3E23A 4GF5A 3CGGA 4X63A 1VP3A 5E9QA 4BLUA 3EVBA 1JR4A 4DCGA 4GUAA 1FP2A 2DULA 4P7FA 3SSNA 5KQRA 2OXTA 4F86A 4PGHA 5K0JA 1DCTA 4ER3A 2BH2A 1SG9A 3SM3A 3O4FA 1XCLA 1XVAA 5E9JA 3AY0A 1P1BA 4E2ZA 5FCDA 4ER6A 5IH3A 1QANA 5DTQA 3SXJA 5EHGA 4B17A 3DULA 2XYQA 3JWHA 3OZRA 1RJGA 2HR1A 4FT2A 4GOOD 3A25A 2I9KA 4U7PB 3FUWA 1NBHA 1RJDA 2BM9A 3SSOA 3QV2A 5EMJA 3PVCA 5EMLA 4EK9A 1O9GA 1WG8A 1M6EX 1AQIA 5BW5A 2N47A 2O05A 5CCXA 5HILA 2JH8A 5K0NA 4ER5A 3K0BA 4P7KA 2QE6A 5FWDA 2WA1A 1HMYA 1ORHA 5F2NA 2P3QA 5EGSA 3KQPA 3EVGA 3BZBA 2ZZMA 4RWZA 2PVCA 2PV0A 4YUXA 2PT6A 2PLWA 3M6XA 3KR9A 4OBWA 4QPNA 5HIMA 1I1NA 3DLIA 4C05A 5CVJA 1KYWA 1EJ0A 2P40A 2ZTHA 1O9HA 5ICFA 5HEKA 1FBNA 3FUUA 3LKDA 5DLYA 4RV9A 4P58A 5EIFA 4QVGA 5T6BA 3LCCA 2HWKA 2FYTA 2B2CA 3HVKA 3GRZA 4GC5A 4OQEA 2Z6QA 3DXXA 5DX8A 4P7GA 5D1NA 1WS6A 4CKBA 3GRVA 3KQOA 1VL5A 3LBYA 2PXXA 2ZIGA 3OFJA 5DXAA 4A6DA 4RTNA 2C7QA 5FA8A 5U4XA 5EEHA 1KPGA 1F3LA 3V97A 1EG2A 3KU1A 2EJUA 3FPFA 3P8ZA 1YB2A 4GOMD 5ERGB 4E2WA 4E2XA 5LQRA 2C7OA 1Q0TA 1SUIA 5DRYA 1R8YA 3A7EA 2PJDA 3KQSA 3CC8A 5K0EA 1BKYA 3EMBA 3TRKA 4RSRA 1AF7A 3FZGA 3I9FA 2OY0A 3G89A 2ZW9A 3GRUA 3IEIA 5FWAA 1I4WA 5EPEA 4POOA 3G2OA 1XTPA 1YF3A
chains in the Genus database with same CATH superfamily
1OC4A 4Q4CA 4H3HB 3TFOA 3RU3A 3QXSA 1P6QA 2JGAA 4P84A 4DR2B 1RC0A 5FUXA 4X95A 4IEFB 3K9QO 4JT9A 2I4OA 2IDJA 2A5JA 2QMEA 4GPIB 1WABA 5LZ7A 4HQ0A 4ACBA 5C51B 1IJBA 3GUZA 1XK6A 5B3KA 1EM8B 4JAVC 2J6CA 4TV9F 5EE3A 4R31A 4OYLA 2ZZNA 1T36A 3W2FA 3LS2A 4US2R 1Y37A 1L5QA 1IZZA 2K4MA 4O08A 1PFWA 2PSFA 1SUSA 1PQ4A 2OV8A 2ZDQA 2H08A 2RSLA 3V5NA 2BMDA 2H2FA 4MRRA 4RDCA 4UQOA 4D9KA 2HW8A 2GYWA 1NKVA 4R9UC 3BBLA 1RWNA 3HCNA 5GGYA 5BSHA 1NTRA 2G5CA 3L0IB 4PTYA 5ICCA 4W5OA 5DGHA 2YZNA 1I2DA 4XQCA 3NATA 4CUJA 1JQ3A 3JPYA 4AJJA 2H3HA 4IRXA 3MHTA 3HDJA 2BGRA 3IAM1 4YRZA 2QJFA 2VC2B 4RCZA 2G17A 1A9QA 2B8TA 1CEQA 2D5BA 3WDLA 3ZX5A 1Y9JA 1FX0B 1M6WA 5KTTA 4WKPA 4I4NA 3F78A 2VRCA 1O0SA 2GTPA 5B2ZA 2H8GA 4BMOB 1RQ7A 2JIBA 1B43A 1QH0A 3HGMA 4YCBA 1P2UA 2CB0A 4PO8A 4D9CA 3EC1A 4WLNA 5SY9A 3N0TA 2ZYDA 3GEGA 1GY8A 4J94A 1AN0A 2QE7D 1BFUA 2VJCA 4YUWA 2ASEA 1UM9B 2OBNA 1A1SA 4BNHA 1XTIA 1IMOA 5K8CA 4CTKA 2KPOA 1NM5C 2HFJA 2WSIA 1O03A 3I1YA 3JRNA 4W4TA 4RSMA 3WGJA 3LXUX 3QOWA 4B2LA 2ZB3A 3O73A 4KUEA 3TNLA 3WIBA 1G4AE 5DTJA 3CLVA 1YZTA 2IEAA 3H97A 2XMSA 3MUFA 3TW8B 5KDOA 4OK6A 3RS8A 4D9HA 1PBTA 3WLQA 3V8BA 1RPJA 3GN2A 2DCUA 3MGKA 3PDCA 3REGA 5CX1B 1VMEA 1PAUA 3SX2A 3AY6A 1YVRA 3ZWWA 3EFHA 2YN2A 3VAYA 5IN4A 1XI2A 2WVGA 3M3HA 4B7XA 3EDCA 1EFRA 3HSKA 1UKZA 4CM1A 3KFLA 3U0BA 1EGAA 5GPBA 4EEKA 1GTVA 5KVSA 3Q7IA 2WYVA 2B5WA 2PS0A 3VPGA 4Y6LA 1BE0A 4L4RA 4R1QA 5IF3A 3P2KA 4JDPA 4RGVA 4BUJA 1GGNA 3BSYA 3SSMA 3VC7A 4X62B 3QX7A 1P3Y1 1EJBA 4KN9S 3OF3A 3FKQA 3CJTA 4FHGA 5I4BA 2Z8XA 3CLKA 4XVCA 2BGTA 2VLBA 2OMEA 4C2AA 5LP6C 1LK7A 1TF7A 4FE4A 3C3EA 1OJLA 1RQRA 4AKEA 1T4CB 1X7GA 3ETCA 1L1RA 2O7SA 1Z07A 3ZDBA 2RHGB 1EVJA 4PO1A 4G1UC 3DLHA 3IPXA 4GXTA 2FSVA 2JKVA 1H8ED 5EPOA 1V71A 5CDGA 3R7DA 1SZCA 3RVDA 3FSEA 5LQAA 1VM6A 1TTPB 2W4QA 2WJPA 3H3JA 4P3PA 1PDWA 5CX4A 1B2LA 3ZH9B 4ZALA 3ZV5A 1KRHA 1L7BA 1XVLA 2ES4A 2VHWA 1SVOA 2H54A 2XMZA 4L9SA 4HX5A 4M86A 4ZEOA 2X4GA 3B6EA 1ZX1A 3DPSA 4EG5A 4PYJA 3IKJA 4DDWA 1TRKA 2FPPB 1AGRA 3D6FA 1UM9A 3HCWA 4ZREA 5J43A 4C21A 4F3TA 3E7FA 3WIVA 2MU1A 1O94A 4MVYA 2OYRA 3QGMA 3RDPA 4EGSA 4EATA 4QLAA 3VR5H 3AM4A 4NBLA 1KDTA 4GPZA 5LZ5A 1FU7A 3RTGA 3UNXA 3ZCXA 1L7NA 5K0LA 4OO3A 3OP4A 2SNIE 1GPH1 3G49A 4U2DA 1OA1A 5KSYA 5J3JA 3PX2A 1ODJA 3KP1A 1CHDA 3HN7A 1NMQA 2PX0A 5CT9A 1DAFA 4UJ5A 5ENDA 4HT3B 2PKXA 4AN4A 4BMZA 2Q3JA 2E9SA 3LV8A 5CX1A 3L5KA 5DLQC 5DP1A 3VJKA 3FFAA 5DBHX 1A9ZA 1HTTA 1OSNA 2DRIA 3AMVA 3FWHA 4LRTB 1L5HA 1M7BA 1JFFA 1OLUB 5JSHA 1KBZA 2O50A 2GFHA 1P2DA 2W8BB 4RQAA 2R1TA 4MQ4A 4Q21A 1R0WA 1TI7A 4NE7A 3KZ1E 5CFMA 3FNFA 5FV7A 4EABA 2CMDA 2QMUA 2QLBA 4DLXA 3I6IA 1TQ8A 4EUEA 2I78A 3CEHA 4G0WA 5ILOA 2VJYA 2XADA 2QLLA 3Q11A 3QXHA 2PWAA 3O82A 3ZD7A 4Q7KA 1E2EA 2WWRA 4WOKA 2OQRA 3A14A 3KXLA 2E4XA 1Z6QA 1PEDA 3L01A 4BKMA 3DBRA 3ZBTA 5I9BA 3K31A 1Z5ZA 5TRTA 5C4IA 1RAEA 1CZKA 3O9MA 4YJHA 3RFCA 4B4DA 1RAFA 2WMDA 1NMSA 2P4EA 2Y92A 2HMWA 1H2BA 4FR2A 4JI4B 2BFPA 2UZIR 3R7FA 4CMIA 2ZKLA 2G07A 3TE7A 3JU3A 3O4VA 4MAAA 5LU9A 2WB2A 2VPQA 3GZTB 3DEZA 4XUCA 3SS8A 3N5CA 5IZCC 1L7DA 1DG3A 1M2GA 5DNYB 4O3MA 2F4VB 4G1MB 5HOQA 3AFNA 4G01B 3IMFA 4OLBA 4FFSA 2CXXA 4R7TA 4C5CA 5FBHA 2RHBA 5CUQA 1ADFA 1BXGA 4ZOCA 1OIXA 3MFYA 1KZGB 3OCJA 3MCAA 4X7MA 4D3FA 1W1UA 1WCWA 1RFGE 2VATA 4H3SA 5D3MA 4MV8A 1LZLA 4OXIA 5CT8A 4Q4JB 2R7NA 3M33A 1Q12A 1ZBQA 2EEZA 3C8ZA 3JVEA 4JB8A 4Q3EA 5TNXA 4BVBA 3MINB 1JBKA 5KYYB 1QKKA 1Z4OA 1E4EA 2C8LA 1N6LA 2DY0A 2NX2A 3A9SA 1OCEA 4GNRA 3R09A 1U5BA 1POWA 1Y9AA 2O9JA 2WDPA 1ENOA 3F8TA 4IFBA 2WKSA 2X3FA 2D2XA 1C4KA 2RHOA 4K0RA 4KP7A 5E3JA 4FMDB 3ILVA 4ALMA 1ND6A 4ZHQB 1JHPA 3O2SB 1T4MA 4Q01A 3RS7A 4AJPA 1E69A 3OCWA 1HNNA 1K6JA 1LLCA 2VLIA 4B6JA 3W5SA 1R9NA 3QEKA 3BCRA 3U60B 1RQXA 3PD0A 2JJMA 3ICWA 2ZWVA 4KKVA 1D6JA 1KDRA 1YVPA 2PBFA 5FTMA 1GZ3A 1SVLA 2I99A 3OPVA 1EH5A 1G2QA 2YJTD 3OZSA 3AUJB 1BVYF 5G1PA 3RVLA 1I80A 3D8RA 2AG5A 3UJNA 5CIYA 4KWHA 4NAVA 1B23P 5F5NA 3I32A 5KWSA 1ICIA 3T5AA 1T9KA 4RD4A 2CLHB 2HAEA 2FSPA 1ATIA 2O2DA 4WKCA 2OYSA 4EG0A 1YO6A 3CWZA 2YL2A 1KA9H 2QTHA 2XQVA 4MUMA 3AO0B 2J4DA 2B69A 2HSEA 4G2NA 5IULC 3IQEA 3TD9A 5CIWA 3OM9A 4P08A 3RHTA 2Z4SA 1NVTA 2Y9PB 3DT8A 2WKQA 3SXPA 3NKVA 4FZ3A 3KWFA 3ND9A 4OHBA 1VL8A 1CLUA 1ML4A 1TNDA 1ZIOA 3EK2A 4DMCA 4ETWA 3VDQA 4F97A 5JD4A 1QHSA 4F6RB 3DE0X 5BRAA 2Q3HA 3BX1A 9ABPA 5AVWA 4FJ2A 5IX8A 3Q8MA 1KVNA 2H9AA 3EVAA 4QU0A 1BGWA 1D1SA 4DDVA 4IEIA 5LM3A 4ZC1A 2HDNB 2ZTSA 2GEUA 4LBWA 2O3TA 3CR3C 1OB5A 1FFCA 3HL4A 4L02A 4A92A 3MWEB 3ME5A 1XAJA 5REQB 1E4EB 4ZJUA 5COAA 3RU2A 1JKFA 2H7XA 2XWSA 2F1HA 4O33A 1OOEA 1UAYA 4K9QA 4QKQA 5K4HA 2QRLA 1XA0A 1J0DA 1YQDA 2VL7A 6ABPA 3S8EA 4JLSA 1OYWA 2H2GA 1FB5A 2OORC 1JT9A 3NWEA 5DM2A 4G1FA 1HEYA 3HJBA 5A3RA 5E7IA 4MIEA 2MSCB 4REQB 2GEDA 3ANXA 1Y33E 1NJ8A 3W2EA 4FM9A 2WBLC 1SD1A 4L2IB 1CR0A 3LQ2A 1ZCBA 1FDVA 1LDGA 1P4RA 5T6MA 4PW0A 4KR3A 4RVGA 3K0HA 1NJ5A 1QGYA 4P74A 4IOHA 2GTHA 4DJAA 2RHJA 2VZEA 3ITEA 3KYDB 4Z0PA 1SKQA 1G5HA 3R5SA 1L1QA 4RMGA 4Z54A 5C5DA 3EEFA 1DKNA 1RMTA 2VBFA 2QM8A 3R41A 4I4TF 5CT5A 1PFGA 4DY6A 4HDAA 1L3BA 4KXLA 4GKJB 3EZLA 4PIPA 2I6GA 5L51A 1JNYA 5IH7A 3S1AA 1W46A 1RVDA 1IY8A 4Z4HA 3OPQA 5EGNA 4K3VA 3UAXA 1P0IA 1Y6ZA 3TZHA 4B8WA 4A7PA 1A0OA 1NW6A 2G82A 3RIEA 4OM7A 3IAFA 5H02A 3VR4A 4AICA 2C9CA 2OR3A 3MWGA 3EXG2 5AI6A 2J7PA 2REBA 2LCIA 2DUUA 2HCRA 3JQAB 4G0NA 4JITA 2WNHA 4J07A 4GOXA 4HDRA 1E7WA 3QU5A 3EZ7A 1GZSA 2P4HX 2YRFA 2XT0A 3FVRA 3EIOA 2A0UA 2XQKA 1QWSA 4C14A 2BAGA 3VQTA 1Z82A 3GOHA 2SKCA 3JWPA 3FPCA 3NI2A 1WQ1R 3EPJA 1XZKA 1QQ7A 2GNAA 1FE8A 1R27A 3MTQA 1U0LA 5C8ZA 2DUWA 4MUHA 1GXSA 1GVNB 2QD4A 4EENA 3EAQA 3PQ6A 4JJ7A 2I66A 4EW2A 1CS0A 1T13A 4MVJP 4TXHA 1HYQA 1UFVA 4ZDKA 1UBSB 1YB6A 3JQ9C 3TTSA 3RAEC 3UMYA 4JJAA 3H99A 2BD0A 3FETA 4XE5A 2M2IA 3IAHA 5A4JA 2V0NA 4ZYYA 3NHSA 2FGKA 4OHZA 2O23A 4O0LA 3RODA 4KAXA 1T1RA 4RNDB 3TBHA 4L5IA 4R1PA 3QELB 2F1JA 5LQNA 1JEJA 1UFRA 5GZ6A 4QDUA 4LJ9A 4NEGA 2OK7A 3HJUA 2JIDA 4FCWA 3G6WA 1USUA 4ENPA 1G0OA 1QXSA 2Z5FA 4J9UE 4BMNA 4D74A 4OHVA 2DF8A 1N2HA 3EB9A 3LXRA 1QRSA 1X87A 5K0BA 8OHMA 3OJCA 3A9RA 3O8BA 3V55A 3R3ZA 3ZDCA 1C4WA 1K8YB 3C4VA 5BN3A 1L4LA 4Q6WA 3IT1A 4FNMA 2IYSA 4P7JA 3WHIA 3E2IA 3G7SA 3HFJA 2XGJA 3F5MA 4KLAA 3BPSA 4GF5A 1KFCB 2E37A 4Y2JA 5F33A 1BIFA 4LF8B 3E7XA 1NBMA 2J4FA 5AUPB 1PJTA 1U9CA 1K8XB 1YI8A 4KO1S 2NTYC 4TUYF 2Z08A 3KLOA 4YRCA 1BMQA 2CDRA 2MHCA 2YWDA 4B6SA 4EB8A 4H1TA 2Q4TA 5E4TA 1HGXA 3AY0A 3JASA 5EL0A 2ZRNA 4WOPA 2JBHA 1KNQA 4W6ZA 4LQ4A 4B17A 5KNDH 5L8VA 1UOQA 1KJIA 2QGZA 1GQQA 4BKRA 2BM9A 1XKQA 2BEKA 5KTSA 1HSZA 3PVCA 4ABTA 3OQ1A 3PLRA 2N42A 3QU9A 3N0VA 4Q15A 1L9AA 4QPZA 4D97A 2AGVA 3DLPX 7YASA 5LNK1 1XDGA 3I39X 3PQFA 3Q3EA 1M5RA 1CDEA 3TRDA 2E4YA 13PKA 2FJPA 1J8YF 1V5GA 3W2TA 1XVIA 4BL5A 2DWUA 3C39A 3UAWA 4NY1A 4A03A 2YFYA 1JR6A 4E6PA 1JEQB 2EGUA 1JQAA 1UR5A 2Q4DA 4ILEA 2NO6A 2WFLB 4JLWA 4V0OA 3IUNA 1W88B 1Q7GA 3EDOA 1GAQA 4PZEA 4G2TA 4ZAZA 2GXQA 2OHVA 3FR8A 4DIUA 5EIFA 4CEHA 1TAGA 3LCCA 4DT1B 2HWKA 5IU6A 4YJFA 2ZK7A 1DKRA 3G0OA 4TV8B 1QH1B 2IHBA 3HABA 4AJNA 2WE8A 1NKTA 5LPNA 1WDMA 4CCYA 2BKEA 3WGLA 2N46A 2XYPA 3ZQKA 2DQZA 4Y1RA 5IKOA 4A6DA 3VGJA 1JMKC 2YOFA 4EYGA 4EHKA 1H2XA 4R0MA 3TXAA 2DE0X 3URKA 2J3KA 3KWMA 3LA8A 3LVBA 4YIHA 5IWAB 3W5VA 4ZI3A 4QBGB 1SJ9A 4K6GA 2V6MA 1R9JA 4EZEA 4PQRA 5K0EA 4PBTA 4E2FA 3IBYA 3L8GA 1RQLA 3EIUA 5CB4A 3KAPA 3PXAA 4DLRA 2KQUA 1VTKA 3AFMA 1N9KA 3E9MA 3OP1A 5F73A 2X4IA 1AN9A 2HA0A 2I6TA 2NLOA 3WKBA 4DC1A 4CFZA 1BQ4A 4I4CA 3EPKA 1RWVA 4B34A 2LE0A 4IEEA 1U1GA 3DTVD 3EXEB 1Z34A 4IVPA 4DUGD 3O8OB 4E6EA 4HS9A 3DVAA 4URWR 3TS1A 2DETA 2YWBA 3RB8A 2Q9CA 3VBEA 2NOAA 4E22A 4R5MA 5TC4A 2QAJA 4L75A 4I3HA 1FP4B 3E8MA 3NHBA 4MPDA 1FYFA 2ZSBA 2FHPA 3FPAA 1QMPA 2HKIA 4WNAA 3C3DA 4OGLA 3R74A 3MG9A 4IL5A 3R7SA 5BMVB 5LQJA 2JJ8A 2EF0A 1RIFA 1R74A 3LHKA 5DF1A 1KH3A 1ZM7A 2X6QA 4XWWA 4CLRA 4GECA 4S1NA 3A9CA 3NGMA 1NLYA 3INTA 4YI5A 3VNBA 1I2CA 4L5BA 4D0NA 2XTJA 2QTFA 4QRHA 1D3AA 4WUVA 2Q8QA 2F43A 2R25B 2PUVA 4K87A 2UV8A 1O5IA 5IVIA 4E32A 3H19A 4HPWA 2XUPA 2HCTA 1XCJA 1YGYA 3I30X 3CX8A 1FJ2A 1T1EA 5CD1A 2HJWA 4GX0A 3NO4A 1EHCA 2YVKA 1WSAA 3OOHA 4QOFA 4CG2A 2NVWA 3NHRA 4LJ5A 2HNAA 4W9MC 4HD8A 3COYA 2Z8ZA 2RGNC 2CSXA 1CYEA 1U0JA 2BGLA 2H7YA 1U7WA 3AF2A 4TMTA 5LUAA 1QH1A 2PTHA 4C4TA 3U3JA 2VDVE 5HSGA 3EEQA 3IULA 4ILKA 3U1BA 2ZSKA 3CE9A 2V03A 1OY1A 3BRWD 2PD3A 4CM7A 3A6ZA 4KUHA 3PWKA 4UHDA 2IE8A 1VE6A 2Z6AA 1W8DA 1BG6A 2HLDD 3L0ZA 1G2OA 2VPTA 3ZGXA 2VOJA 3ZDDA 1RYYA 4IW3B 1GPYA 4U7JA 3R3YA 1U11A 2JASA 3H2HA 1J00A 4I99A 3RABA 5IKMA 2B0JA 4YWJA 3BILA 4AI6A 1W76A 2XZOA 3H18A 1W7AA 1K4YA 5JNUA 1JP7A 4ES6A 4K2HA 4AZ3A 3B1VA 3ZU5A 1L4HA 1N36B 3UHFA 3G2KA 5ALGA 3ROKA 3R77A 2ZVQX 3LHSA 2WOOA 4ARVA 2LPMA 5A2QA 1U7OA 5DHSA 3FKSA 2FPIB 4UD2A 1VDMA 3BXOA 3WAJA 4EJFA 1YZNA 2DC1A 3D7RA 4JXZA 1ZDMA 1PIWA 2X0JA 3W34A 3EZ2A 3Q85A 3UA4A 4AS2A 1MB3A 3VR1A 3TPZA 2C07A 4UDOA 1HETA 3VRHA 4FYPA 2A9KA 4M49A 5TS2A 3UT5B 1E8MA 5FQNA 4DW8A 1WUKS 1U6KA 2NAFA 4OHMA 4NCJA 1TUGA 3R9KA 1XBTA 3TLKA 5D01A 1V8DA 4D4GA 5CA0B 1E6CA 4DQUA 1H85A 2VJQA 3IT0A 5FAXA 2B7CA 3UWMA 3I05A 4KXFB 1T3SA 1UAAA 1NC3A 4V02A 3WLOA 4TL8A 5JALA 4RIGA 5BQOA 3V4OA 1TEVA 2R6FA 2QTBA 4DREA 1ZHFA 4E88A 3JY6A 1J2JA 4GPTA 3CISA 1SIBE 2R87A 3SIWA 1R6AA 4RZHA 3K1ZA 3CUYA 5ALDA 2YY6A 1L5SA 1YXMA 2TRSB 3ZJ4A 1ZM4A 3D59A 2CL7X 1X94A 1KMHA 1X92A 1EE2A 2JHGA 3CEJA 4BJ3A 4ZHQF 3G5AA 3LOQA 5EE1A 1UQUA 2EATA 4RF5A 5AT1A 4G5YA 4J1QA 3EXHC 3L7MA 4PM4A 4RS3A 2C7VA 4RZQA 1N1DA 5AW6A 3ZNQA 2OCBA 2UAGA 2FKAA 2QY9A 3AEKA 4GS5A 4M3NA 4XWYA 5BWLA 2RKOA 1ECJA 2P77A 2CE7A 3FAZA 1W6UA 5KJCA 3N2EA 3AVTA 1ZR2A 1G98A 1MVLA 1EA7A 1PT9A 2KW5A 2WT8A 2EQ5A 2ZB4A 5EKDA 4JJ8A 1KJJA 2OCDA 4L4UA 5JNSA 4DTCA 2BTEA 3B12A 3R5JA 2C61A 4TS9A 5A4DA 1AKRA 1N2EA 4HVTA 4HUTA 1YS1X 1DS6A 3TE6A 3KKQA 4YMGA 3H9JA 2PT5A 3ET5A 2K2WA 1S2NA 1UDXA 1HQKA 4QGBA 3T5GA 4DDKA 1OASA 1VE1A 2KMLA 1PJ8A 3NCTA 4EVIA 3GJ8A 1BDJA 3O84A 1BSVA 3MT8A 4LC1A 3HFGA 4GICA 2HBYA 2MSKA 2P9FA 2H92A 1VKHA 2Z5GA 3QFHA 1P5HA 1C9NA 1XTKA 1I2BA 1LCIA 4PICA 2WE7A 3DL0A 1FDOA 1VSBA 3AHEA 1LQ2A 3EMVA 3N39C 1JDSA 5LL6P 3FPLA 1DAGA 3CEPB 3VSEA 2ZUDA 1EUCB 1E1DA 1U3UA 3U4AA 4TYWA 1AUVA 4B32A 1KY5A 3FLBA 4DV0B 2O0JA 1Z7BA 4U9IS 2NU9B 3D5TA 4KIUA 1U8TA 3Q8WA 3FY4A 1A88A 1LU9A 2VSQA 1NT4A 3O8QB 3QUBA 5FBVB 5GONB 1N1GA 1DZ3A 2FNAA 3FUTA 3PIDA 4QDOA 5HJ7A 4QBHA 3TIIA 1K7SN 3PJDA 1ZIYA 3LLUA 1RHKA 4C0BA 4FDUA 3W6UA 2HNBA 4MMYB 1NVVQ 1L7QA 1UWLA 4G9EA 1O95C 3V8QA 5DVZA 3SMVA 4ZJPA 5AW1A 2PYZA 4LJLA 3UK2A 3PA6A 4RD0A 1KE1A 3L4JA 2ZGVA 1FQKA 4P73A 3GYGA 4RZ3A 1NRJB 4L8FA 4LQCA 4P6VF 1IN6A 2HA7A 1SCNE 4PLHA 5A2GA 1W88A 2HJVA 3GYBA 2CV2A 5H0IA 4TLLB 4Q1BA 1P7ZA 4B3TB 3WGMA 2P8JA 4BUCA 3S7ZA 3W6NA 4AZ0A 5CFNA 1FLVA 3ZU3A 4ZARA 1F8UA 1RYZA 4EYSA 2RONA 1QZUA 1SU7A 1GZHB 5KO2A 3PB3A 1Q44A 1W48A 4NXNB 4ZEWA 3N3AC 3GZNA 3LPDA 3VNVA 2QOEA 3T9CA 2WOJA 4QECA 4YAEA 5EFOA 2ISQA 3OFKA 4P4LA 1YOBA 2ZR9A 4WKGA 1GTL1 4FR0A 2DOKA 3KZCA 4KZPA 4W1QA 2B30A 3GEMA 2V5VA 2PZLA 4AT1A 2LVBA 2EZ8A 4DIBA 1U94A 3NWJA 3BXPA 4HNAB 4BJHB 2PD6A 3BFVA 4BZXA 2JF0A 3CNEA 5KOIA 2B1GA 4MVWA 1I6KA 2QRKA 4ENSA 3P96A 5HKAA 1ZUHA 2CVQA 2EX4A 2OSBA 1H0KA 3T3EA 4EPRA 2BE9A 3AHDA 3BREA 3E1SA 4H31A 4D9FA 4D9JA 2JNWA 3TZLA 3DVAB 1GTMA 1MH1A 2JGIA 3EQ7A 4LG1A 5HM8A 1UKEA 1Z0KA 3A3NA 3OM1A 3P2EA 2CJXA 3DNMA 4QICA 4UUAA 4M53A 3LLMA 3DNPA 4IS3A 3WLJA 2FQQA 2GARA 2JZOA 2UKDA 1CUIA 5CT4A 2JJ2D 4E3WA 5JAMA 2ZBGA 3C6ZA 3FRHA 3QOFA 3NG1A 4WGGA 4BGUA 1RXWA 4TS4A 4KREA 4RDHA 1DAHA 4FYJA 2FPKA 1TC2A 2ONZA 3D43A 2HQ1A 2EAUA 4JT4A 2LGJA 2P2GA 4Y2RA 1OXSC 1UBGA 3QQPA 2ILTA 5A1TA 4PIVA 1VE5A 3H16A 3ZHOA 1PYSB 1R0CA 3D6VA 4C1NA 4C20A 3GUYA 3SLKA 3V32A 4ESOA 5K6AC 1SBTA 2I03A 3G0DA 4JKIA 5CBPB 1PZMA 1XZQA 3JQAD 4ZCMA 1K27A 4B80A 1GCGA 1LSOA 3NIFB 4BIIA 1T1GA 4MCJA 1UC4B 3HCPA 4MW0A 4N8SA 4QBKA 4E5PA 2AFIA 2MR5A 3MOIA 2GLTA 1VRCA 2YYZA 3NDRA 4XFJA 3T7RA 3VYRB 2VP4A 2NZJA 3I8OA 5LOVB 1F7UA 2I7CA 3THYB 4IX1A 1WDTA 2IPXA 3AHFA 1L7EA 2VA9A 1M73E 4HDNB 2ZG6A 3UVEA 1CC1S 3N2IA 1GYPA 1Q83A 4D56A 3E9ZA 2W43A 3OE7D 2BDUA 4TL9A 3X43A 5AQ1A 1CUGA 1QPBA 2ACVA 1NVXQ 3BE6A 1PUXA 3EGEA 4XCVA 1VHDA 5IKPA 3GOQA 4JJEA 1VG1A 1R5NA 2HSDA 1IIRA 1CUUA 3LQKA 1A77A 3AUSA 1P2VA 1UADA 3PUJA 4YRBA 3UGJA 3QBDA 2CLKB 2XY4A 3OD5A 4KBGA 3RE1A 1QGZA 1AA6A 2BUCA 1N5JA 4RKFA 2FF7A 3SU8A 3BWCA 1M34B 4TKVA 1V1MB 3B8HA 5IHXA 3DM9B 3FMPB 2RHRA 1K97A 2H1FA 1PTJC 2C4TA 3I8SA 5THXA 3WIOA 4YT8A 3AB8A 1NQTA 3W6OA 2Q3LA 3CX7A 1A2KC 3DG9A 3QG5A 4HNRA 4OTZA 1LRJA 5I9TA 3SHWA 1R16A 3TNDA 4MPTA 4MGHA 1QOZA 5GJWC 2BCGY 2BM0A 1X7DA 1VIAA 3C15C 1T36B 4NBRA 4W5HA 2QN7A 2QAGC 2YWFA 1JXOA 1Z29A 1IRIA 2HRCA 3DCIA 5FL7D 2M6KA 3T7TA 1ZM9A 1UEIA 1JR2A 2R62A 3I4LA 3LTNC 4LZPA 1KK1A 2ZUBA 3EQ2A 2CCJA 5BN4B 3ZK9A 4PYNA 4L5CA 2XCQA 4H6VA 1SR8A 1TZCA 1LVUA 3QBEA 2CJWA 3DXYA 3V8NA 4F85A 3UJ7A 3U9TA 1KEZA 1KVSA 2W2QA 5BSFA 4ZMSA 3BGIA 2B6HA 4DWVA 4EW3A 4MUFA 2I65A 4NOLA 5FUWA 4XD7D 3VXKA 3HI4A 3OJWA 1V3VA 1EBFA 1DGQA 3LRPA 5AM4A 3X1ZA 4GR9A 3VSDA 4IZ6A 3JQFA 3PEFA 1SQFA 2Q4EA 1JHVA 4XOUA 2G8LA 3KD3A 4R5HA 2BFCB 4ZCTA 2ZRIA 5AVTA 4UTZA 4C0LA 3QJ5A 2GRJA 2ZE5A 5ITZA 3T5MA 4E70A 4DLZA 1GXSB 5HCIA 1D1PA 1V3UA 4IDFA 5A4IS 4MCIA 4RCVA 2B25A 4PYIA 1PX2A 4KXVA 1YU9A 4MQ6A 1MC1A 3JQCA 2OHXA 1OREA 3G3EA 2XUGA 1NJGA 2PFGA 4H3VA 1JALA 1XP8A 3PRYA 4G0VA 4MW7A 5LB4A 2D8MA 2FQXA 2BI7A 3IPLA 4MR9B 4AW9A 3LGAA 2QDKA 1DFIA 2NPFA 4D42A 3I0NA 2REQA 2Q5LA 2YXLA 2ZS7A 1AD2A 3TTXA 4PNEA 2JJQA 2NV6A 2ZIXA 3IVCA 3FJYA 3BEOA 4HI0E 2AN4A 3TG8A 2X2PA 1D4ZA 1V37A 4FKBA 1OFTA 1YR8A 1DADA 2EKBA 3IGFA 4UBLA 5DWQA 2OEPA 4DB4A 1M1ZA 1U28A 1YA6A 2JI4A 3I9MA 3QW4B 5JO9A 2CVFA 3ZKAA 4AZWA 1BA2A 4MWBA 4OB8A 1GYQA 3BD8A 4Y3UA 2Y05A 1HDIA 2BELA 1JQBA 1Y6JA 3LFTA 2HF7A 3QY9A 4W63A 4BFYA 4CBVA 5ADUS 4P4NA 2I7DA 4RXUA 4IZIA 2C77A 4ISBA 1L7VC 2PX3A 5ALRA 1QBGA 1SC9A 1U4OA 1EP3B 3NHAA 3RTAA 5IG2A 5KTKA 3FFXA 1YIOA 1S8OA 2JAHA 3FZQA 2WJWA 4GUAA 3T3DA 4G0XA 2HREA 1KJWA 4FB5A 1V6SA 3PHCA 2LWIA 2RGYA 1J97A 3QYPA 1ZESA 1EBUA 1KY2A 2IZZA 1J07A 3COPA 3SJAA 2JFZA 3K09C 1CX9B 1MRZA 4L16A 4QYSA 2OFFA 4DV2B 2Z8YM 1ZIPA 4G5XA 4DBVO 1KFBB 5MN6A 4BB0A 2R4QA 1YB5A 3OHSX 4EY8A 1PFVA 1RJGA 4JUAA 2I9KA 3IEPA 4E3ZA 3IIJA 1MG0A 3KZNA 2FE4A 1KU0A 1P4GA 1NBOA 1X7YB 2GVNA 4UVGA 3MINA 3CZ9A 2VJNA 5IBRA 2AC7A 4CUZA 4EJ0A 1TMGE 3DE5X 4NU8X 4JI5B 4J1TA 1XEFA 4UUQA 5F7OA 5ITZB 2EBHX 3QXJA 5LYJF 1KFKB 4QODA 3SVLA 4EWLA 1NUQA 1I4LD 3NBXX 1VHQA 1FDSA 2QTVB 3E9RA 3M6XA 4ZO9A 4FEGA 2GTIA 3PWSA 3CXUA 1CZOA 2O1XA 4G5OA 1HDOA 1JQLB 3HG7A 5ECWA 3E9YA 1FBNA 4I8DA 5IW8A 4FKZA 2JBAB 4ZWNA 1WKVA 4KLNA 5EP3A 3DWFA 1SN7A 3WGTA 2WABA 1ABFA 4IVRA 2R68A 4J8PA 4JUIA 1RBYA 2NU8A 1YL7A 4PZ0A 1ZW6A 3JR3A 1UMDA 2ZIGA 2NU7B 3GJ3A 3KT3A 1I33A 4K7JA 3V97A 4ZCIA 4HGQA 2XCIA 2O14A 2HBQA 5A3VA 5FDFA 1XP5A 3KU1A 1BKDR 2PH3A 3FPFA 4GOMD 3TOXA 3VR0A 4YDSA 3ZHCA 1PJAA 4B82A 3I2IA 5EQDA 1Q0TA 3COJA 5DFAA 2XQIA 2ODTX 1N2OA 4DSAA 4UMFA 4Q4AA 1BDIA 5FP0A 2B1IA 3G9UA 1IB6A 1XR3A 4G63A 1QIGA 4R7ZA 2IHYA 1U8AA 5EPEA 4GQAA 1QVAA 1TKRA 1XVTA 3BE5A 5K3CA 2O5CA 3EG9B 5JBNA 4QARA 2ZQYA 1J09A 2QQGA 3ZQUA 2VF8A 1QO7A 3GDHA 3MERA 4E5YA 3EA0A 2OORA 1HG0A 5BP7A 2WUEA 4F4JA 4KUGA 2JIPA 2C1XA 3OKAA 2PL1A 4X41A 5KQGA 2OENG 1Q74A 1E4VA 4JI1B 4BTVA 1DCMA 4BBJA 1BO6A 3NTRA 3KYBA 2R5FA 3MC1A 4UEKA 5CTAA 4HEA6 3L7BA 4K28A 5EJMA 4XWOA 1FU8A 1M75A 3IV7A 1GKUB 3OZWA 1PJSA 2PGOA 4OLFA 2NP7A 3IOBA 1TGYA 2GPYA 3BJEA 1P0MA 5JT1A 1FUIA 4KV7A 4JT2A 1OAKA 1A8HA 4AP6A 4R83A 4EMTA 2WHXA 4PG7A 4QX6A 1WD5A 2RHWA 3SE0A 3RS2A 5LB2A 2FPGA 4ENRA 3GAMA 1R64A 1NXTA 2RGGA 3N2NA 4L4SA 4O59O 1BZYA 1UIRA 2HQOA 3PQ2A 4QDJA 4PX5A 4V0SA 5EY5B 2CFRA 2AF3C 2XUZA 3BN3A 1BXGB 2AKWB 4YCDA 2VNJA 1TOAA 2ZWOA 3IVAA 4F60A 2OGSA 2IQ5A 3FYTA 2A8YA 4QFDA 2Y1EA 4XYMA 3CLTD 4A8TA 1DIAA 1CPYA 2YFHA 3TLGB 5DGIA 3EOZA 1KAQA 1VLJA 2FEMA 2W5UA 2ODAA 2HGSA 4FOTA 4NV1A 1I7LA 3VPXA 3G0IA 1XMJA 5E1OA 1O9BA 1SK8A 1CE8A 1EFCA 4UTXA 1MGPA 2JI6A 5TARA 5JAUA 1A50B 1DDGA 3LK7A 1W44A 3HU5A 2IHJA 2NSLA 4A27A 4MUIA 3QPCA 3NB0A 4NJOA 2FWPA 3F4KA 4DVGA 1H22A 4CEIA 4M0DA 2JLAA 1RRPA 4N3BA 1UMKA 1VJ0A 2AG8A 2JLVA 2HF8A 5GONF 5ALKA 3HP7A 2EG5A 1OXKB 4A16A 3UK1A 4XDZA 2E6UX 1IK4A 4G5HA 1CY2A 2ATEA 2WJ6A 1PCXA 1QK4A 2AN1A 2VHZA 1DBVO 1G7CA 4JOBA 2AR0A 3A32A 1IBRA 1TVKB 1WHSA 3FIJA 4FW9A 4BNIA 5ADWA 5FWNA 3C6MA 1MTOA 4X7BA 2ZLBA 4A8JA 3AHGA 4TWAA 4LNUA 3WYFA 4AJIA 3LO8A 5CLLA 1DZIA 2VO1A 3QE2A 3UJ9A 5B7GA 1F14A 2YXDA 3VKUA 3JS5A 1HA3A 3UWOA 3W1WA 3I5MA 4KIJA 2ZYUX 3U19A 5KREA 4B6GA 2WZCA 4LWPA 2ID7A 4FYHA 1WXFA 1M2NA 2F9MA 4Y6PA 1IHOA 3R75A 2NZWA 4WZ6A 2DMRA 1TYEB 2IXGA 4UNSA 2YWRA 5AW3A 1RBZA 5JYCA 4EFNA 4YALA 4S2EA 2FFRA 2GN8A 4AIRA 2UZAA 3RUFA 2ZS8A 3B60A 4H7DA 4ZPJA 1H1DA 3CKLA 2AXNA 3C48A 4B3SB 2IUTA 4EQ6B 1VPWA 2PRYA 3IXQA 1VGVA 2CNKA 1D7OA 2OBLA 1SVWA 2RB4A 3D1LA 1AX9A 1TD9A 4FE7A 4LCJA 4IR7A 5FUVA 3W6PA 1QKIA 3TGLA 5TMBA 2Z2JA 4BO7A 1E7YA 4LHVA 5T4BA 1T5BA 3K16A 4LGYA 5EZ5A 5F9MA 2IBTA 4QSHA 1YDEA 2YOGA 4TX1A 2LIPA 1B93A 1MAUA 3ENQA 1E3QA 2YDXA 1T10A 3G2JA 2J0UA 3SYMA 3DXFA 3PPXA 4TZKA 3SF0A 5BXQC 2ASVA 2XJ9A 3B6KA 4REQA 4U2GA 3AP3A 5DT9A 3TCNA 2LXNA 2IU3A 1V47A 4OQFA 4UHFA 3TMKA 4EGJA 1MN6A 3DCYA 3TUIC 4RL4A 5H9VA 3HN6A 3LX8A 3ZBQA 3QVVA 1RZRA 4F46A 3VZQA 1QRDA 4J0CA 4K9PA 2C7BA 2F6RA 1ESNA 1YZLA 2AOWA 2NADA 3C7CB 1KVRA 5EZSA 4QDKA 5FPKA 1LNZA 3GGGA 3MB8A 4FSDA 4P3XA 3SLGA 3W2HA 2E82A 3Q5DA 4F92B 2OLKA 3O93A 5JC8A 3AL2A 3GBVA 4C08A 4LSZA 3COWA 2OQIA 4Y9RA 4ITRC 3BDIA 5TQVA 4L7VA 4ZOAA 3RSQA 1IJKA 2RHTA 4Y98A 4FSHA 5H4HA 2XXJA 2VTKA 4PO9A 5BUSA 1MO4A 2X1HA 1FEZA 4YBRA 3DZGA 5A7FA 2DPGA 1F12A 1K75A 1CZLA 4N12A 2J9RA 1EUCA 3TZBA 4RYLA 1IUKA 3UICA 4AKIA 2QIPA 3BMXA 3FLAA 1JG3A 3CF6R 3WDKA 4KN6A 6REQB 2JLUA 1ZZEA 2WTEA 4LC0A 3VBCA 4WLVA 2XNKA 5KYVA 3U44B 2EFGA 3ETDA 4FFBB 3EA5A 3GFOA 4IXNA 5B1HA 2OK8A 4A0SA 4CGYA 5B5SA 2CFIA 2G9VA 1DNPA 3Q9SA 1U2RA 4NBSA 4ZVQA 5HCNA 3ZDFA 1FFBA 5CH3A 1R0BA 2QDXA 1RI5A 3EH2A 4S3MA 2YXEA 2AA3A 2QN1A 3C16C 4RK7A 4A9AA 3WB1A 4BNDA 1C0LA 1EBBA 4IYJA 4BO5A 2B94A 4YP1A 5A3SA 1Z26A 5LP6F 3RNOA 4M1ZA 1G5FA 3AZOA 9LDBA 3GFFA 1SC4A 3A26A 5IEBA 5KJEA 4YRGA 2WJHA 1US8B 4OFWA 2BEUA 3HKDA 5FB3A 3UV7A 1J7JA 2HYIC 1Q3HA 2D1RA 4N48A 2P9BA 1Q7CA 4RHCA 1BCSA 3J7AC 2XRFA 2O52A 5KB3A 3N28A 5KKNB 4G1VA 1VECA 2Y1WA 3OJEA 3T3GA 2R8OA 1MDBA 3MZ0A 2R1VB 3F1LA 5A0TA 4OAQA 4L7QA 4LXXA 2I87A 3BGWA 1I1HA 2NU7A 3PE4A 2IPNA 1UKCA 2PGDA 1DRVA 2UYQA 4S0ZA 4KFSA 4MQBA 3SCZA 3UAOA 2HB6A 3DW1X 1EVYA 3CUKA 2EJVA 3BK7A 2QVGA 3U6KA 4AC9A 2BJVA 4IIEA 3SPXA 2P0AA 4X7RA 5C52B 3W9UA 1PZFA 1ZLYA 3VOTA 5JRDS 5K6AA 2P6MA 1XLTA 3UZUA 3MUNA 5KCZA 5BWCA 3CLUC 3H5NA 5IBPA 2H1LA 3T7EA 1N32B 1J9ZA 5EJ7A 4IGFA 4J7CA 4NMLA 2F2TA 3K32A 3A9WA 2FX2A 5AJZA 5AKEA 1PZXA 4HH0A 4F9TA 1UAGA 4H7HA 1LLDA 3V4SA 2GCIA 2OO7A 5KYXA 4X61A 2WLSA 3HEMA 5C1PA 5AICA 5FH9A 1V96A 1ZK3A 1SQ0A 2FFQA 4CT4B 4MI3A 3LUGA 2RJOA 3TI7A 2E5WA 1SKYE 1X74A 1ZW1A 4WLFA 3OIUA 3CT6A 4MHSA 1YACA 2GWRA 1UXGA 5JDIA 4JVSB 1RM4A 1S2IA 5K0ZA 3WRWA 4CM8A 4ZTUB 1JDNA 2E21A 5DM0A 1V48A 2WTXA 5FNVA 1PSWA 2G7ZA 2VNIA 2ZXEA 4J0DA 5DU2A 1PG0A 4U0KA 4J1NA 4DCVA 4DLAA 3VFDA 3N74A 3BSSA 1YI1A 3I9V6 1I0ZA 4Q7EA 3AT1A 5F76A 2YNMC 3H1PA 1PSDA 4J2OA 1PDVA 4CIDA 1C7FA 2H29A 3QE0A 3TRHA 3QVGA 4XVRA 1EWVA 3FZEA 1GRNA 2VT2A 1QG0A 1CJVC 1LBQA 3JR7A 4PNHA 4PQFA 4V0RA 3HXQA 2FR0A 4RKWA 4RLQA 3HBNA 5HF5A 1PVDA 3ZI0A 4BV3A 1MD9A 2BJHA 3H05A 4CCYB 2Z4TA 4M9SA 4TXNA 4BC1A 3IPYA 1ONBA 1PGOA 3GIWA 5BVHA 1CY0A 2E4ZA 1DRJA 3ZXIA 2NUPA 3CEAA 1T5OA 3L43A 3EPRA 2J87A 2Q62A 3H8SA 4GSLA 4OYHA 3I6MA 1J2YA 2G28A 2PUWA 2I6XA 4TOIA 4EA6A 5KQMA 1KAEA 2PL5A 3E53A 2FLKA 1CB0A 1CG6A 4Y1FA 1Y8RB 4A2WA 3LY7A 3RK1A 4BEWA 2FV8A 2X42A 4N0PA 3KKKA 3NYQA 3ON5A 1G8SA 1XQYA 2Q1SA 4J16A 4HFJA 1QF9A 3B2EA 4FFPA 4V0KA 2CJFA 4C88A 1M8KA 2QJTA 1U80A 1URPA 1A2OA 1ICEA 2A9JA 3AUAA 3REFA 4DCNA 1GEEA 2CFTA 3PKJA 1NURA 1P0PA 1JTFA 1AUQA 2P5TB 2OQVA 4JFRA 5ER9A 1IY0A 4GX2A 4M0EA 3HCBA 2PX6A 2VT3A 4FD3A 1P9OA 4RFSA 5CDSA 4R1TA 4ZVVA 2C2MA 1ZCFA 2OESA 1Z16A 1L4FA 3A2NA 2JRCA 3ZHRA 4CODB 3TSOA 1J8QA 2L82A 4DADA 3Q5EA 2PN1A 2GM5A 2FZCA 2X3YA 1NT2A 3LCMA 3JARB 5CFZA 5JCXA 4F6CA 4MCHA 1QJCA 2GBCA 5ALHA 2P6PA 1BE1A 4U5QA 1IM8A 1HKHA 1BXKA 2BFDB 3NJ8A 3TDNA 1GCUA 3WFJA 1G63A 2POQX 3PTLA 3W6ZA 2Q49A 4K2AA 4OQ4A 3NVKI 5H8WA 1R66A 1XDWA 2PJUA 3W3AD 2WD8A 4G5RA 7ABPA 5ES4B 5JXGA 3H13A 3PLAE 1XF1A 5DHAA 4E4RA 3GQBA 4LJ6A 1A76A 5CITA 5CEEA 1JAHA 3GGSA 1W19A 1DXYA 3OFND 4XRRA 2HJHA 2HA2A 3T7CA 1EXNA 1MC4A 1NJ2A 4W9RA 3HY6A 3OJXA 1MEOA 3RRJA 2DPYA 1NX9A 3ZIUA 4LYGA 3V7YA 3ESCA 4QTYA 1EEXB 1OROA 1TM5E 2Q3DA 3LYHA 3GCGA 4UEQA 2ZM5A 4B47A 2HJSA 2I80A 4H9GA 5DMHA 2ADFA 1JPVA 4AY3A 3CH5A 3TEHB 5SZIA 2IXAA 4N5MA 5DSXA 4PPGA 1NBAA 1THZA 1JXAA 1QHHA 3L93A 5JSUA 1ETUA 4KFUA 1JQJC 1R6XA 1NOKA 4OFBA 3RKUA 4ALIA 3QSGA 3FNGA 1P1KA 4JK3A 1XRRA 2CEAA 4MR9A 4KK3A 4KWIA 3WLKX 3H2KA 1A96A 1MF7A 2CD7A 4LGVA 5IMBA 1GRQA 3SDBA 4JV5B 4NC9A 3C7KA 1NQUA 1QTNA 2VK4A 3G2QA 3HYLA 2C3YA 3ED1A 2C5BA 4X7PA 3GGPA 1ZJYA 5WRFA 5I8ZA 4LXTA 1INLA 3U7QB 1D07A 1PWYE 1S4QA 1JEEA 2ZREA 4P1ZA 5BSMA 3A2KA 2XRMA 2BEVA 2NXEA 3T3HA 3CUUA 4GLJA 1O57A 1Z4JA 1LDBA 3MFQA 3OE4A 2WT9A 1K4MA 1EFVB 3FYCA 4F93B 5HNKA 3S4YA 1OXXK 2XV1A 5E4JA 1Q17A 5A0VA 2PT7A 4QYIA 1RABA 5G3ZA 1JR4A 2OOSA 1Z5NA 3E82A 2Q6TA 2FCRA 4I4TA 2C8JA 2G1AA 4F86A 4ADSG 2KJQA 3CZRA 2Z95A 5AXBA 1TKAA 1EHYA 1B1CA 3RC8A 2Q3FA 3FSRA 1SOAA 1V7QA 4RHXA 3LT2A 4ER6A 2AQHA 3PHLA 5DTQA 4NBUA 2NSDA 3JTEA 4GP9A 4PXYA 3WI7A 3U13A 3ANSA 1M6HA 1FTNA 2G9QA 4FT2A 4ZEXA 2Z43A 1DQYA 1ZUNB 2WJJA 2X76A 3CX6A 3FGNA 3UMMA 1LK5A 1AK2A 1RKQA 1OJ7A 4QFMA 1WG8A 3B1ZA 2HHHB 2DPHA 3TW6A 3CONA 4BNDB 2D0IA 3JRXA 4P7KA 1H94A 4EITA 4MIYA 3JQ8A 2DFDA 2SHKA 1ISIA 2G40A 3D81A 4DZTA 3T34A 2YWJA 1Y9DA 4IFEA 4H27A 2IYYA 5GADl 2M9MA 4WJZA 1I13A 4U6NA 3FNIA 2GMWA 2VK8A 3I6BA 5FBLB 1US8A 3ZBUA 2RGWA 3ED5A 1JDJA 3K9FC 4PG4A 4H7EA 2D1SA 3WHLA 3UG7A 4OJYA 1KYWA 2LZ0A 5C8XA 4UHBA 1SCBA 1JEYA 1S8FA 2GF9A 2Q5JA 1PW7A 1RR6A 4LOHA 4OHKA 1A8QA 2HO5A 2QLJA 5EIOA 1W25A 3ICOA 1L4KA 4PR0A 3IKMB 3ZV7A 3OTIA 1KRWA 4I55F 2JCGA 1ZNYA 2D1TA 3NPMA 1RBMA 1Z6YA 1GWNA 2A35A 3EZGA 4DR6B 4X1KB 3QI2A 4OHCA 2UUCB 4D8VA 3GPLA 2HCFA 1UT6A 1A4RA 3VDNB 5CW2A 2C7OA 3E3AA 5KYWA 4QOJA 3ST7A 3TAUA 1OUMA 4DM4A 1ZRMA 1R8YA 4IQGA 4FX2A 5J4VA 1TTQB 2A0FA 3L9XA 2QI9C 3T9BA 3TRKA 2YJZA 4TMZA 3U5TA 3EBOA 4JFAA 2UYYA 1I4WA 3BAZA 1FUUA 1LDYA 2DSTA 1R3DA 2OM2A 3IP7A 3V3TA 1SVIA 1YR6A 3L07A 3B85A 4N0DA 5CB6A 3RU7A 4L9AA 3OQMA 3RYHB 2Y0CA 1TZJA 1TJPB 3HJAA 5G0VA 3RO7A 3W77A 2XRZA 1P1IA 2A5FA 2WD7A 4E7OA 4C06A 1UZLA 4A1FA 4RVNA 1EP1B 5SYNA 5AKZA 5TXGA 1PT6A 1DHRA 1KH1A 1XDZA 3SJCA 5F35A 1ZRSA 4LKOA 2MJLA 3HHPA 2BMAA 1UJBA 3WIEA 4EUKA 4JU9A 3W3AH 2QRZA 5HZGA 2GJ8A 2C94A 2I7XA 4GYKA 5CP8A 4J76A 4LHEA 2VWHA 2XNDA 3GVIA 4XWGA 4YMWA 1BVRA 1H2RS 2XE7A 4MS1B 1Y48E 3E0XA 3HDVA 3NUQA 4RTSA 1Z5PA 4L07A 5C5EA 4UCXA 2FG6C 3UB2A 3N7AA 1QB8A 3ZDEA 3KSBC 1WMDA 1IB0A 3N1UA 3FIUA 1EAYA 1G20A 1LNQA 1Z4KA 2FUNB 2FF5A 2HM7A 4KBFA 4LE1A 2Y1LA 5AJUA 3KD2A 1QZZA 2PPVA 3QNMA 4B9EA 3RS3A 5JAHA 1G5IA 3IL2A 2W2KB 3TZQA 2ERCA 5BQXA 3D3QA 5LP6A 3OQNA 4I0WB 3B9RA 2HT6A 3CRVA 4MRPA 1XWFA 3I2HA 4D4HA 1UIMA 2OC9A 3K5PA 1RWXA 3TPCA 1F0KA 3FM9A 3KQTA 1DIHA 2K6GA 3MPOA 3WDSA 1IOZA 1HYEA 3BM5A 3NOQA 3LBFA 1RWBA 5IABA 1ULHA 1Z7EA 1K0FA 3HBLA 4M0LA 1PQUA 2AJ8A 1NP6A 3EW9A 2IPMA 4RTQA 2IEIA 1DOHA 2V7EA 3PQ5A 4MW9A 1M2FA 5HFJA 3IKVA 1OFUA 2BFBA 4OU4A 2FLWA 4CLHA 3RVNA 3QWAA 5KSWB 2Z9DA 3OECA 3IFSA 5C8YF 4KQ9A 3L1JA 4H18A 4A0GA 5JVDB 3IUJA 3PXDA 4HQRA 2W37A 3U3XA 1A4IA 3D8NA 2JG3A 2ERXA 3KQWA 1DAPA 3O9VA 4TXJA 5BSVA 1FMFA 4DMMA 1Q15A 2QVBA 3FBTA 2PA0A 3Q1KA 1UP6A 1N6NA 1CQJA 5E7MA 2WP8J 2ZBDA 3D4PA 4C7OB 1M33A 1DTWA 4ZMBA 5U9CA 1XU9A 1A97A 1YDGA 4WY5A 1FXUA 1PFYA 1VIVA 3VZRA 3U61B 3BL6A 5EMMA 2DR3A 2RAVA 2GUWA 1VXOA 2Q07A 4EY6A 1HL3A 1AJEA 4Y6OA 5DBGA 2FWIA 3AR6A 4B33A 1OHHA 1RXEA 2QLTA 4Y18A 3PC2A 4A2QA 2IXTA 4HL6A 4YRNA 2ZT6A 5ABPA 3IE0A 1LTKA 5HQJA 3G59A 4MWEA 4WFJA 1L4MA 5H3LA 1L9KA 1ZEMA 5HJ5A 3C6BA 3PUIA 1WW2A 2FW6A 5CBPA 3IUBA 2C7RA 3MSXA 1G42A 3O4GA 2F3RA 2SBTA 3DOFA 3T0GA 3CEMA 1P0QA 1XQ1A 4NJMA 5IK2D 2C03A 4BNZA 2NVOA 4DC9A 3J81k 3ITNA 3DQPA 3NV7A 4XLZA 2WTMA 3D31A 2WWIA 1NAHA 1X8JA 4TTRA 1OX4B 3T1YB 1H4SA 4R0NA 4D3YA 1RYDA 3OJLA 5DHFA 1PI3A 2ZRKA 4FFWA 4OKIA 1PJBA 4LNAA 4P98A 1JDPA 1WSWA 3ER6A 1YFJA 3QKIA 3L82B 3KPVA 1L5HB 3UCEA 2QG6A 3M5CA 3K6SB 1Q7RA 2CXHA 4IILA 3ENWA 1PJZA 1T9GR 2ISCA 4JVNA 5CTJA 2Y66A 4JROA 2W2MA 1P1JA 3MILA 1W59A 1M5TA 2IXEA 5CURA 5T57A 4B87A 1CKEA 1OLSA 5SV2A 3ZX4A 4ZT6A 2X8LA 5T4EA 4U63A 4KQ2A 5JUWA 3HCCA 2GYVA 1P62B 3THXB 3IHTA 5FLEX 3IVRA 2DHCA 3QLUA 4XXHA 4DLYA 1RP7A 3V7WA 1S2LA 2HRRA 1TB4A 3OMXA 2RB5A 4OXXA 4LDRA 5I8PA 4IV8A 1KKUA 4HPJB 4NBTA 1SZJG 1T9DA 3D5QA 4GGOA 2X77A 4Y2SA 3KZMA 5CFOA 2P1RA 1T6ZA 2PZMA 1ILEA 1CJBA 3RC7A 2CMFA 4WXPA 1FFYA 4CCAA 2B4KA 5I8WA 2Y1KA 1XZNA 2J45A 1A95A 3ZE0B 2XOXA 3OFSA 2IGBA 2DLDA 4B3RB 1S89A 4QUJA 4IUCS 5HR5A 2P79A 1LTHR 1P5RA 3GLHE 3JAKB 3CU5A 5F4ZA 3GVXA 2NUAB 3W9BA 5IVKA 2G9NA 4L72A 3CFYA 2PH1A 4UD6A 3QVUA 3WQSB 4UUBA 1U2QA 1WDLA 2OFXA 1VHJA 1E3SA 2Q2VA 3FI0A 3EGIA 2ZULA 3MWLA 4L4XA 2L0XA 1AZTA 1T0PA 1OXVA 3WYAA 1NYTA 4FZVA 1QX3A 1V41E 3G8BA 4BX0A 4BRWA 3QVWA 1YUMA 2HADA 2JC3A 3PNSA 3TZKA 1JW9B 3WYCA 1G6Q1 2XB6A 4C6TA 3QYJA 4KWTA 4JB2A 5KTOA 1DMSA 2YJ6A 3EXG1 5JU6A 5LMUB 3CYFA 1Z2NX 2PO5A 3AOEA 1MOZA 4IMPA 1LI5A 4B46A 4O1HA 3DDNA 1Z37A 2Z3VA 1ABBA 2WMYA 2FWMX 4FC6A 4X93A 2IV7A 4QG7A 1C80A 5DM1A 1H5QA 2CZQA 5A71A 2WHYA 3HU1A 1E1RA 1L4UA 1UBLS 1QO0A 2GILA 2YHIB 4N6NA 3LX4A 3EGXB 4Q3BA 3CCBA 2FW7A 4JBNA 5KDLA 2H06A 4LCEA 3MIZA 4WI1A 5J2UB 1TRHA 4Q4AB 3H11A 2PD4A 2O8BB 5IC4A 1KDPA 4CR8A 1RAIA 4LXHA 1KEEB 1EVKA 3JVIA 3N76A 1GGFA 2GN0A 2OD9A 1EX7A 4DUYB 4HNVA 1AS3A 3QXXA 4IICA 1YSCA 4UAJA 3VU1A 4DL9A 3S1SA 2IIBA 2YRWA 4AY4A 2QN3A 3BTUA 3DCNA 3T1NA 1MAVA 1SXJC 1NAIA 1NMEA 4I9FA 2P1DA 2BBOA 4X8MA 5ALUA 3W3AA 1C30B 2PLFA 3K1JA 3L8MA 5P21A 4YJ2B 1A3CA 5ALVA 4ZFNA 2W2NA 3D54D 3H8VA 4KDFA 3SQNA 1Z6ZA 4PHTA 1E8DA 2Y67A 2VP6A 3BTOA 1A9OA 1DDOA 2J9YB 2A9PA 2QAGA 5JS6A 2ANCA 3A3YA 5M5BA 1R9GA 2VK2A 1DJNA 1DT3A 4WE3A 3PQCA 5B37A 3GIDA 5HA5A 1LTQA 3QF7A 5CHYA 3QA3E 4QVKA 3LVQE 3MT0A 1Q2UA 3T52A 4MLZA 1L7RA 2P2DA 1SELA 5ES3A 5F7XA 3A05A 4INJA 4YCMA 3BSWA 3PPVA 5HQTA 5KYXB 4GFDA 3HFSA 2PSHA 5IVHA 2Q5IA 1ESCA 2O19A 3WK4A 2E89A 2XDWA 4PS1A 4YHHB 1UT5A 3SNHA 1OIVA 4FCCA 1BH6A 1JAYA 2IYPA 2WNSA 2HHAA 1PTKA 4G0PA 5DZSA 3ILYA 1Z0SA 4LYHA 2CYBA 2DU8A 1GZ4A 2IZ7A 3B2NA 3VI3B 3BF7A 3KT6A 5D5QA 1YZVA 4L3WA 2PFKA 5A9SB 1QVZA 5SZKB 4BX2A 4EPTA 4L73A 2VP3A 2NXJA 3H8JA 3LKBA 1WULS 1WU7A 1FLNA 2A1UB 2HV9A 3FMFA 3R3HA 4MYCA 4ZV4A 3ORHA 4B5KA 3KQHA 3P9PA 3ZVMA 1KZ6A 2EWWA 1U2PA 1XF9A 3AG5A 3U4GA 3OCXA 2NZ2A 4XCQA 2WDZA 4R2IA 1UWKA 1TCBA 3IERA 4RY2A 5CB4B 2GESA 2WUFA 4RX1A 1G8JA 2BM8A 2A4KA 2ZB7A 4O5AA 2IE0A 2IP4A 2C5EA 2OD2A 2ZRBA 4EHLA 3C7DB 3SR0A 3UWSA 3H17A 4BWFB 3RIYA 2PGIA 3NDIA 2QD5A 3DMPA 4D98A 1ZGBA 4KO8A 1XZDA 4FUTA 5EXTA 1T25A 2VOEA 5BQPA 3O8OA 5BV8A 3RSGA 4MUBA 1KPHA 4Q1FA 1IEVA 4ECEA 2QBYB 5H3HA 3T4UA 2VDOB 5C31A 3BUSA 2XZTA 3DEAA 3F7TA 2XWQA 2CD9A 2P6UA 2TS1A 2WJ4A 2B1QA 1DAEA 2IF2A 4RHYA 2RHLA 3RSLA 2MSWA 4C0KA 3JV7A 3U7IA 1OVMA 3B3JA 5BV7A 2QMHA 3OF2A 3P71T 5L7TA 1XZBA 5DEOA 2IPLA 2FEWB 2FMHA 3P9SA 4KOAA 1ECLA 4JLBA 3K6JA 2YJ5A 4D3DA 2IGTA 5B2FA 3R8FA 1HF3A 4LV6A 2XRYA 2JK0A 3PCXA 3RW9A 3NONA 4RDXA 2ENUA 3OG9A 4ZIRB 1O87A 2ECFA 3KBOA 3PXCX 1U6IA 2VJPA 2Y1XA 3MOGA 5CYPA 1VG9B 4AK9A 3ETNA 4ALNA 1UPAA 2P0YA 2Q28A 2P7IA 4MUNA 3BTVA 1JTEA 2VNHA 3H9GA 4HADA 3KTFA 4R2KA 1XFDA 2PQMA 3M6WA 1VYUA 4Z1MA 5HIAA 2J3MA 1RZRD 1BYIA 4C2BA 2MSDB 4GUDA 2F17A 3A1WA 2ECKA 3ISJA 3O90A 2A5DA 2ERYA 3ABOB 4AJKA 1J0CA 4IIVA 3DEIA 1FPMA 1T8SA 1S1CA 3IB3A 1C81A 2W98A 4J1TC 4H1WA 2B2XA 3LO5A 4D9BA 3SKVA 1YFLA 1DOAA 2YV1A 1C5KA 1DPFA 3D2CA 3PYMA 1QTRA 1A8SA 4CU2A 1OI2A 2ZT5A 4HZUB 1RVV1 1ADJA 4HNTA 2P69A 1Z0ZA 1FLAA 1QGOA 3NAQA 1V5EA 4QHSA 5LYJA 3N9IA 2JGDA 4LI3X 2O7RA 5CDFA 3WQHA 2HA4A 2QG4A 4BO1A 1NI5A 4ZPXA 2ORVA 5F1KA 3LUKA 3L1UA 1JHOA 3Q7SA 4F1JA 5FOUA 4HUJA 4K9KA 4G5QA 1D0VA 1AK1A 5G3YA 4EHDA 4Q66C 1AGNA 2HEIA 2YYAA 5CDFE 3VKGA 5LZ4A 5TDHA 1CB7A 2BY4A 4W5WA 4WK2B 3OLQA 3EQZA 5AW8A 2CDAA 2EX0A 2XGSA 3O2QB 1TZ2A 1L5FA 3IO5A 2EHJA 3LD9A 2SKDA 3LQQA 4QTTB 4TWRA 4UC0A 4HTFA 5I7OA 4DSOA 1RTTA 2FRXA 5IXYA 1Q0RA 1BX0A 2H1IA 2DY1A 3DT6A 1ORIA 3PC4A 3AR4A 4MIKA 5EYPA 2DLNA 5ITWA 3FTEA 4HXYA 4MQUA 1JAXA 3QVLA 2UZ0A 1VE9A 4EW1A 1WZ2A 5CK5A 1MGOA 4J7XA 1MTZA 3OC6A 4M38A 4X1OA 4C0XA 3BTSA 3E48A 1JFVA 1YR9A 2IYQA 3IQDB 4MS3B 4CQNA 5BSEA 1CDDA 4WEQA 3JASB 4AUMA 3UUWA 2VUTA 1XTTA 4E33A 1JVSA 3CF4A 2D06A 4LNUB 1SXHA 2V9ZA 1KKLA 3M4JA 3JYPA 2BR3A 4EKYA 5EQTA 2BMJA 3PDIA 1DO8A 2OAQ1 4XYBA 1N0WA 1QR6A 3ZLTA 1YZQA 4YXWD 4Y6GB 4BVJA 1PT8A 3DFUA 3FPEA 3G2MA 4YACA 2G1PA 3JAKA 3VISA 1V7CA 3FSJX 2ZRPA 1U0SY 3CGGA 4HB0A 3UJ8A 4BFUA 3I1JA 2GAJA 3GFPA 1JHUA 1XN1A 4EY3A 2O5RA 2YC2C 3T54A 3AF6A 3AVUA 5HKLA 3K94A 1Y6QA 3HKEA 3AW9A 1VJGA 1TX4B 3DD5A 4MR8A 4OI2A 3CRNA 1XFAA 2VHXA 1R37A 3JW8A 3Q7PA 1UXHA 4IQ4A 3SM3A 2I8CA 3B7GA 1EJ2A 1F0YA 1AB5A 2C9BA 2XI4A 5EKTA 1TKBA 4ARZA 1U7UA 2XYQA 4WESA 3T0FA 4XYEA 5BWMA 4YO8A 1CD5A 3OUUA 1ZVKA 4GOOD 4DJJA 1UZMA 5JNRA 1P80A 1S96A 4YREA 4UDYX 3MXOA 4YCCA 2PKYX 3HDQA 5EMLA 1PYDA 1AQIA 3FW1A 2Z2YA 3TR5A 1PEAA 4AN1A 2AUMA 5L53A 1E1RD 1KYXA 4F9FA 1O5TA 4XDYA 5JEDA 5T4HA 3ZWCA 4QPJC 1W87A 3ZWQA 4CTOA 3P2OA 3W9SA 3DE7X 2LTAA 2WVAA 3E3MA 2OZKA 3IELA 3EBLA 3GT3A 4NH4A 5EGSA 1E1MA 5AW4A 1HNXB 2GQ0A 2PVCA 2PZ8A 2PDAA 4YMVA 4FQ7A 2HGZA 1FFSA 1XXHE 3ASZA 1QE3A 1QCCA 4JLVA 2R6AA 1L8LA 2B4TO 2XOKA 5ICFA 1YS7A 1VG0B 3G5UA 1FS4A 1ZN8A 4BOYA 1B2RA 1RBQA 2QD2A 1LUAA 2YZMA 5TX7A 5GJVC 4D92A 3DXXA 2A0WA 3BH7A 3BXHA 2I3ZA 4PLVA 4C4PA 5D1NA 2OMKA 4HNQA 4OLHA 1G17A 2JKZA 1GPAA 5CH8A 3ZGYA 5CPBA 5A0FA 1AK9A 1P19A 3ZI4A 3KQOA 5CB0A 4QM7A 5C46F 3MTBA 2R6DA 4I2VA 4DCOA 2J7PD 2XGGA 3V1YA 4M1EA 3TIGA 3VJMA 4QATA 1NF9A 5LP1A 2B82A 1N1EA 1QIFA 1SUIA 3FWNA 3A7EA 5FO1A 5KYWB 1N25A 1J0EA 2IX9A 2J30A 4WN9B 3UW3A 3ZJYA 3IEKA 3ZS9A 4BNKA 4COKA 4NABA 5KJ1A 4PX2A 3N8NA 2W83A 4QTZA 3RVKA 3C3KA 3I2KA 5ISMA 4L50A 3Q6MA 1NRXA 3LT0A 5EJ5A 2ZYTX 2I8AA 2JFNA 2AYZA 3RKSA 1K6XA 5JV5A 1C29B 4IGKA 1YS6A 1CJTC 1UJ6A 3MOSA 1X3LA 2H3EA 4LHXA 2BBTA 1UC9A 3FG9A 4MV6A 3EJWA 1U3VA 1GM5A 4FU0A 3ZE7A 1E2FA 1QM5A 1FFWA 2B4RO 5EHNA 3W5DA 3T3OA 2AMFA 2I3GA 3CPEA 4X6LA 4C01A 4A0FA 5LLSA 3HJFA 2YRXA 4OHOA 4UHJA 5F77A 4MS1A 5BVHB 3EQ6A 2IV2X 2H2WA 1F20A 1Z2DA 4ANFA 5AVZA 4KR2A 1RT9A 3GFBA 3S99A 1H6AA 3W9YA 1O95A 5TF0A 4EYKA 2GPAA 4UJ3A 2P9GA 5SYAA 4HNAA 4LZWA 1D8AA 2WAMA 1T5DX 3B36A 3B89A 3KYCB 1VIYA 1S7CA 2YWEA 3DV9A 5JBIA 3IDOA 2W2KA 3AK4A 2PSJA 2XOKD 3ERCA 5JTUA 4R2HA 4JLAA 7MDHA 2P6OA 3LPNA 5JTTA 4MR7B 4MB2A 4YDRA 5KKAA 4BKPA 2QYTA 1V3TA 1W581 2QPLA 2ZATA 2JJYA 4LF7B 2VH1A 4DEXA 2HCBA 1C1YA 4BV2A 4F2HA 2GZDA 2J9GA 3OPYA 2BF4A 3VNRA 3WLNA 3JX9A 4A10A 2ZAOA 3L8DA 1JZQA 3IUEA 4QG3A 3ZZNA 4GR4A 1V35A 1RAAA 2INGX 4RW0A 1VLMA 1L0BA 4U7TB 3A9UA 2E48A 5A7HA 3T94A 4C7BA 5HUHA 5GIOE 4ZI7F 2IY8A 4G36A 4I1PA 2C0CA 2JGKA 2VEOA 2DB3A 1E9DA 1OKKD 1P2FA 1LDMA 2FEAA 2G1KA 4RELA 5AXCA 4BX9A 3UXMA 4EUFA 2P78A 4M8IA 2QX7A 1VJCA 3PLNA 3D2LA 4ZOEA 5FORA 3ZOZA 1SG6A 2Z2XA 1QRAA 1OBHA 1MJFA 2VDUE 1NJFA 2JIMA 1C4XA 4K1LA 3P5SA 1ZGZA 2OCAA 1KIAA 4QIHA 2WNIA 1S1MA 1WNFA 3G5LA 4KU4A 3UAGA 4C7OA 5JQGF 1PX0A 2VTDA 1UMBB 4U7GA 1BJKA 4L0CA 1W94A 1NPYA 2ZXUA 3SX0A 2XB4A 3DE4X 3OJOA 2FWRA 2CXIA 1KMQA 3EJ6A 1AKNA 1T8TA 4K6HA 5JS2A 3VHQA 1NW5A 5AW5A 1XRPA 3ZE6A 2ZBUA 1JHYA 4F3RA 3O4HA 4H08A 5BNFA 3RSFA 1ZPDA 1LJ8A 4JI6B 4JMLA 2JFGA 1N2CB 2Q7OE 1FOEB 3E5NA 2LP4Y 3HWX1 4X0EA 1K63A 2ISSD 1MC8A 1IXRC 2EOAA 2Y9MB 3D4BA 4OJTA 4R8RA 3OBBA 2P2ZA 1OB2A 3IAUA 4TVSA 3FUXA 2NTJA 5TE9A 2LIVA 1RJEA 1HM5A 4Q1AA 2GH1A 4ENQA 1HLDA 5EP1A 4CKYA 1H3NA 4V1CB 3PC3A 4NPCA 4MZXA 5EUQB 1QZTA 3H83A 3EDYA 4NBWA 3SAJA 3TK1A 1PR4A 2NO1A 2P9TA 1CVIA 2BTQB 5I7SA 3N75A 3T5CA 2ODNA 5TV2A 2DPXA 5AVVA 3ZZMA 5J4HA 2BFFB 4GWGA 1P2SA 3R0QA 4GLFA 4EAQA 7ADHA 5JASA 3E5RA 1NN5A 5JS8A 2XKKA 1E66A 1U2SA 1U28C 2QN8A 2JEZA 5E3HA 3JAWB 4KTTE 3QYFA 2H1RA 1U31A 2PUAA 4IUDS 3AF4A 3P0RA 1YBAA 5E8JA 2GHTA 2WJGA 1HRDA 5G4LA 1KOJA 1EM6A 2ZR0A 3KT8A 2O3RA 3NBYC 4FBMA 1QORA 4B0OA 1OLSB 3L5OA 3OFVA 1OZGA 3BZUA 1ZITA 4U4AA 1JYSA 1MJGM 1Z12A 1FY2A 3AFGA 3PI7A 1QIIA 4W99A 3TSZA 4CG1A 3IE2A 2YX1A 4M8NE 3AEQB 2KM1A 5HWSA 2I1QA 1PVVA 1T5TA 3MMNA 5DX0A 2RAFA 4HLDA 5E7QA 4H0NA 2RJ3A 1UUFA 5GONA 3TSYA 4HNUA 5JJKA 3H2JA 1J0AA 3M9WA 3A1SA 3VHRA 4X24A 5EG5A 1PKXA 2VHCA 3M3PA 5J2TB 1L8OA 5EWLB 2XD9A 3OZXA 1MHPA 2Y1OA 4CTJA 4HQ6A 5ALEA 1P2GA 3PHGA 5G1OA 1JEDA 2JFVA 3DFFA 3M1YA 5DBFA 3TEFA 3WMGA 1JPUA 3R5XA 2COEA 4WFQA 3RAFC 2R1UA 3N2YA 5TPWA 1N2CE 2R44A 3D64A 5JYBA 3V2GA 2AKEA 1GCIA 1WZIA 2JL1A 1M1UA 2PGJA 1ZUD1 3QPUA 4KXNA 1YU6A 4PZPA 3UH0A 4DMLA 4GPD1 4EB0A 3UMVA 1EAMA 3IHKA 3CY6A 3IKLA 1XNGA 4CIVA 1MRSA 2EL9A 4M9UA 1P3JA 4ZYTA 3GJ5A 4I6EA 1BMFA 1D2RA 1YBHA 3G1UA 1N2GA