3AY4A

Crystal structure of nonfucosylated fc complexed with bis-glycosylated soluble form of fc gamma receptor iiia
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
215
structure length
215
Chain Sequence
b'CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
molecule tags Immune system
source organism Homo sapiens
publication title Structural basis for improved efficacy of therapeutic antibodies on defucosylation of their Fc glycans
pubmed doi rcsb
total genus 36
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ay4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ay4A01
4KVNH 3S36X 2O5XH 5ENWA 2R2CA 2PXYD 5I66A 1J0JA 1VPOL 2P5EE 4RFNB 4FHBD 2VABB 4KAQH 2Y7QA 4JKPL 4TSCH 4ZUWB 4X6CA 1UWGH 4N1HB 1W0YT 2UVEA 5F7LB 1NC4B 4LHUD 4WTZG 1EXUA 2EKSA 5FYLL 1LDSA 3A6BH 1IT9L 5D2NB 3AMKA 1EERB 3LIZL 3D18B 3GUTA 3W39A 4UILL 1F11A 4MS8D 1ZV5A 4HUKB 3SCMD 2YK1L 4V1DE 2EDTA 2DIAA 3KPNB 1T5XB 1A5FH 1MJ8H 2HJLB 3ME0A 4C59B 4WU5A 1YA5A 1PY4A 3U0PA 3EYUH 4LAQL 2FATH 4L3EE 2W0FB 4S2SA 4ZD3L 1NCWH 3F58H 5MENA 5DLMH 5J13C 2BC4B 4MJIA 1ZLSL 1DL7L 4NGHH 1XGQA 4NCC1 4I9WE 1R24A 4NC2B 4X5WB 3P30L 5CUSH 5FHAH 3V4VH 3MV8D 2YC1B 5J1AB 3KPOA 1HI6A 3B83A 5C9JA 5DD3L 1EIBA 5JW3H 1NGWB 4JDZB 1G7PB 5AYUL 3E8UL 5KSUB 2R23B 1NCWL 2OMBA 4J3UA 4JO4L 4NN6B 1UXSA 5MI0B 2GJ6E 4JY5H 1QRNE 2FO1A 4L3CA 3FCTB 1HH9B 2OMNA 3P40A 3BX7C 4HF5L 3QI9B 1IEBB 4PLNC 1AXTH 3R1GL 2IG2H 4NJAL 4U1KB 2GCYA 4JHWL 2XY2A 3HR6A 1NL0L 4XTRD 5K9JH 1F97A 3GMRA 5KSVA 4HW6A 3O6FB 4Q6IC 3RTQA 5GS0C 1E4XI 5I18H 3MV7A 1EFXD 5FYKD 2MKWA 3SJVD 5F6HI 1U8HB 4H88H 2ADIB 3DLQR 5ICXB 4NT6B 1A14L 3KPPB 3RDTD 5MP6L 1OP9A 1PFCA 3KPLB 3VFGH 5IB5A 1VADB 1A64A 3BOVA 2C7UB 4LSUH 1P84J 2HVJB 2ZG3A 3VXNA 1FIGH 4V2CB 4B41A 1I8MB 1VEMA 5DRNA 5MEOA 5BMFH 1AO7E 4OQ1A 3RVTD 3MJ9L 4X8JA 4O2CB 3DJ9A 4RGNC 2BFVH 3WO4B 4EZMA 1N5YH 1ITCA 3HC3H 3QJHB 1WZ1L 2IQAA 1IM3B 1KN4H 4UTAL 5H8DA 3HMXL 1FPTL 1A7PL 4OLZL 1VSCA 1CDJA 4UMGA 4XX1E 3HPJA 1ZA3B 1JRHH 3D2UD 1FYHB 2VR5A 1FDLH 3S98A 4XCYB 4FQLL 2DYPB 2J8UF 1VFOA 2WBJA 1O0VA 4YDVB 3EDDA 4PR5A 4F7EB 3PHQA 1G6RH 3RWCB 4PRPE 3W5NA 4OLZH 4K3GA 4FFZH 1MH5B 3T0EC 2NPLX 1MHEB 5DSCA 2ARWA 2F5BL 1TZHA 1YN7B 3PWUB 4IDJH 2AJUH 5J3HD 4X4ZA 3NACL 4GOSA 2OLDA 5D8JH 4JVWA 1ULVA 2KH2B 3DO3A 3QUXD 5A1AA 4D9RD 3L3HB 4OI9A 4U6YB 2NY2C 5IBUB 1T5XA 5D4QA 2DQIH 3ARPA 1A9BA 2OYPA 3BH8B 3QUYD 5HGHA 3T3PF 4R8WL 5CP7B 3Q2CA 1I4FA 2IALA 1BX2A 3QUXA 4R97C 4J8RB 4PJDB 4Z78A 5DUPL 1F5WA 4HWEL 4L8BA 2CKBA 1JTTA 2K7QA 1QSFB 3MRPA 5J11B 3MJGX 1AGCB 4D9QD 3EW3B 2XQBH 4PP1C 1OAKL 1YEEH 3IU3A 3MZGB 4YZFE 5AZEH 3W9DB 2VDLL 1Y0LB 1IFHH 4U1IB 3GIVB 4G8FB 3HFML 3QXVA 3IAQA 5CILH 1QKZL 3MOAH 5GRWA 3RL2B 2OXGA 3HR5B 1GVIA 4NWUH 3SCMC 2LAAA 3S8WA 2OTUA 2WUCH 2Q6WB 2VDLH 4OGZA 3SO5A 3EO0A 1JNNH 3Q6GL 3DBXB 1RZIB 4UQ3B 2DYPD 4JFDA 4ZTOL 1EJ6A 4HGKC 3MRDA 2CK0L 3LRGA 1NDMB 1IC4L 4J4PA 2H2PC 3JV5A 5IEKB 1LQSR 3U9PH 2EO9A 4FNLH 4NNPL 5LKNA 4PIRF 2CO6B 4I77L 1BF2A 1IRAY 3BKJL 2PXYC 4FXGA 3FFCB 4LPTA 4XB8A 1OARL 5CZXD 1I3GL 3VXUB 3BMVA 3M8OL 4E41B 5KW9L 3ARBB 2CK0H 3EKCA 1V7NL 4R7NA 3WIFA 4NM8L 4YHLH 5D5ME 4I4WB 5CWSB 5ITFA 3QUYB 1J18A 3G08A 2VXQL 4I0KA 5E2VL 1PZ5B 5GGRB 4CADA 3RUGB 3DHJA 4XCEA 4KRPB 4L3EB 1JF6A 1BBJB 3SPVB 3ARFC 3KS0H 4LSTL 4MCYB 2DS4A 1CZ8H 1FE8H 5F9WC 2AJYH 5K9QG 2COQA 3IXTB 1QBAA 2WBJD 4M61B 1CTNA 3HS0B 3MLZL 1G9ML 5KVEH 2E7HA 4HDIB 5GS3A 5J7CC 3DX6A 1EV2E 3REVB 3QUML 1J86A 2VLRB 4RMSA 5GGVY 1CFVL 4QTIL 4ODWA 2HT4C 3GMRB 4FMKA 2D0FA 4ZFGL 4U6VL 5IVZB 3VFWA 3QXDB 3MYJA 2NY4C 4XB7A 43CAB 2PKDA 4FFWC 4LLVB 1IARB 3NIDE 3M45A 3IDIA 2O5YH 3X11A 3ZKND 4YUEH 4IRJC 1CFVH 2YN3A 3LPFA 3TVMD 4QHUB 1WZMA 1CDCA 4ERSL 3NZ8A 4R90H 3TJHC 2VAAB 3D3VE 3QT2A 3MCLH 4X4MA 3ESUF 4L9LC 4Y4HB 5C9JB 2Q1EA 1WLHA 3HB3D 1KB9K 4GLRI 1A1NA 4Y5YC 4XWGL 1EZVY 1FFNA 3PP4H 4WHTA 2R1XA 4HBQA 4EDXB 2CMRH 2P8MA 2Y36L 3C2SA 4ISVA 1UACL 3OAUL 1VGKA 3SEPA 1XCQA 3AC0A 1RFDL 5GRZA 4F9LC 2F5AL 2L7JA 4PJ9A 2UVFA 4PJ8A 3ES6B 1ZHKB 4OM0H 1ORSB 3VI4E 3DUUA 5KG9A 1GHFL 2R0WH 4TQEH 1OD7A 1JYNA 1DEEA 5I76A 3CFDB 3OF6A 1YEFL 5TE4H 5CIPA 4U6TA 3NCFB 1JFQL 1SYVA 1CXKA 1A1OA 1BFVH 1T6VN 2C1PB 4APQA 3DSFL 4OSUL 1CL7I 1J1OH 5FO7A 3L1OH 4PR5B 4LEOA 3WFHB 4TTDC 3S35X 4P46C 1GXEA 3RKDD 4PJXA 1F13A 1I7UA 3U83A 3TO4B 1MHEA 4ONGL 5FV1L 5DSCB 1DEDA 3PL6C 5F88A 5BJTA 2NY1C 3GSNL 2VLRE 1N3NB 1P69B 5I8OL 1AR1D 1CD1B 4I2XE 4YBHA 4DZBB 5CEZE 1HCVA 3V6BR 1RZ7H 2BJMH 2YEZB 5DHVA 3UTTB 4K7FA 4J3OC 1JK8B 3MQIA 5DURD 2ZKHH 5FKAA 2ATPA 2ICCA 1WUNT 1S7VB 3UJIH 5CKGA 2HG5B 4L3AA 5HSFA 2B2XL 2XI9A 4JPKH 3QJHA 3ULVH 3QRFM 4HK3J 4QY8B 2XRAH 5ICZB 3D69B 2QHRL 2FJHA 4MA7L 4TVPL 1AQDB 5KTEL 3HRZB 3LPWA 4XPTL 4MA3A 4OLVL 1N0LA 1KJ2H 3NA9L 4PRHE 4JFDE 5JORA 2YS4A 2B2XH 4OUOA 2R0ZL 1KEGL 1K8DA 2KZ1B 4OLYH 4TSAL 4XWOD 1SEQL 3NVQA 1NDGA 1F4HA 4EQ2A 1AQKL 4IRJA 1AO7D 3QDJD 3B2VL 4Z0XA 3V5HA 3GSWA 1IEBA 2BY3A 4JHAL 3T0VA 4NN5C 4HS6A 4OLYL 2Z8VC 4TSAH 4UDTA 5DUBB 4YQXL 3ZKMC 1CFBA 2PW2B 4OQTA 4FFYL 3B3IB 2GYSA 3BHBB 2VERN 1FIEA 1U3JA 2DQEL 3FB5B 5CD3A 4MQXC 2ZUTA 4ODVH 3MMEB 1B2WH 1NANH 3L7EB 1MIEH 4QRTB 2XKSA 3FQNB 2LABA 3QEHB 3BW9A 4P2RD 1VACA 4JR9H 3FOLB 5EO9B 2XFXA 2XWJA 3NZHL 4R7NB 1WFNA 2Z8WC 5DK2A 4XRCA 2EIDA 1GCFA 4XAWL 5C07D 3IT8D 4KZDH 4XPFH 1RJCA 4K94C 3P0YH 3BKMH 1Q9OB 1U95B 1KEML 3QPXH 3MNVA 1F8TH 4FN0A 1U8NB 3C9NA 4U1MB 2X89D 1ETZB 2BVTA 1YECH 5D71L 4R6UA 3ZT7A 5I16A 3PV6A 2OP4H 4P5TB 5DQDH 4J3WA 4F15C 1YEGH 1S8DA 2BDNL 1TVHA 5I8EB 2EYTA 2FEDD 3G6AA 3LN9A 2J4WL 5E5MA 1T21A 2FGZA 1PVHA 2AK1H 1U8KB 4QT5B 2DM2A 3HMXA 1D5MB 2AXFB 4KTDL 4JO1L 5J56B 4KV5F 2ZCLH 1GYAA 2PW1A 2YD7A 1SMAA 3ZO0A 1IGYB 3H7BB 2Q20A 2R2BA 4MD5A 1FFQA 1R3KA 3DTXA 1LNUB 15C8H 4H25B 2VLKA 1JGLL 4LSPH 3PHOA 2JF1A 5H94B 1JCKA 2QQKH 5GGRA 5FYJU 2R0LH 3PDGA 3SDDB 2J8HA 1K4CA 2I9LA 4ZUTA 5GS2H 2EIZA 3O4OC 4HKBB 5E9DD 1MWAB 3U4BL 3U2SB 1AH1A 1CD8A 4X4ME 5KZCB 2CKBB 3MNZB 5C08E 5KBNC 3VXQB 2HT2C 4F2MA 2GQHA 4O58H 3HPLB 2RHEA 3HS0A 1NAKH 1ZSDA 4D8PB 2VKXA 4NO5B 4PJBE 1GOHA 2XQYG 4GRWB 4LSSL 1NLBL 5J12B 4U1JB 4KV5E 4MSWA 3E8UH 1NGXB 1WF5A 3OKEA 3FT4B 1I1YA 4HXBH 5AYUH 4POYA 4P5MA 3PHSA 1U8MA 2JB6A 3HLAB 5E8NB 1PYWB 1UKTA 1NKRA 5KVFH 3TYGH 2AK4E 4IJ3C 5ICYA 32C2B 4L8CA 1LDPH 2VAJA 2PW2A 3JTSB 1FV1A 2F54E 2D7QA 4YNYA 5F7NC 5IMMB 3MLRH 1WT5C 4XVTL 5JPMB 3VGEA 5TDNA 2XWBB 3C60D 3S37X 3G5ZB 1Z9MA 3RX8A 2R1XB 4NQED 4BQ9A 3C5ZD 5FHBL 5SX5H 2YK1H 4HWNA 3FQNA 5CLTA 1FFNB 1K3ZA 4FXGB 4WHTB 2UZIL 5GHWL 1MI5A 2R69H 5KVDL 5DRXA 3RUGF 5HI5D 1NMAH 4Z5RB 4KHXL 3VCLA 4U2YA 4WGVB 2B7DT 4I3SH 3TBSA 3ZTNH 5EU6B 3HC0B 3C09C 4P23B 3F7QA 5GS2D 2W65B 1H3VA 4WFHD 5IB2B 3KPRA 3PWNB 5FUZL 1S9KC 5JHDA 2BFVL 2H8PB 3K8LA 3HE7C 4JFQB 1PSKL 2G5RA 5CJXA 2YBRA 5JQHC 1OSZB 3VFGL 3GO1L 3MJ9H 3MNWB 5DJYB 4NFCA 2DLGA 2GTZB 2A73B 4PV9A 3TV3H 3ULVD 3O9WA 4FMFA 2IBBA 4OSUH 5KS9F 5BW7A 2OJEB 3PGFL 4F58L 5B4MC 2K3TA 4FA8A 3RWHB 4JHZA 3MXVH 5D1ZA 3H9HB 4MHHI 5F93C 4HG4J 2OBGA 1INQA 2VR4A 2WWMC 3CX2A 4MDJA 5JNYA 3GHEL 2BY1A 4FFZL 4OQTL 5HHQA 4RAVB 2X05A 1ADQH 3TM6A 2YSSB 35C8H 2W0FA 1Q0XH 1KJ3H 2ATPB 2NX5E 1QO3B 4JRXB 2CLVB 4R0LC 4WENB 3D69A 2Q8AH 4H8WC 4Y19D 5IP4A 5JR1H 4G3YL 5IG7B 1GGCL 4F7PA 3PWPB 4Z0BL 3DHMA 5IBLC 2CRYA 4G6ML 3VFUB 5KVGH 2ITDB 1G7HA 4PJIA 5F9AC 5C0RH 2JJUA 3MGOA 4KK9C 4BYHA 3U7WH 1IAKB 1MVUB 4F9PC 1R5VA 4ZFZA 2DQCH 4M9OA 1RK0A 3O8XB 1WWAX 2Q76B 3T09A 3EYVB 4MA1B 4Y4KD 2HWZL 5KVGL 1GZPA 2B39A 1G6VK 2X4UB 3ULUC 5I1LA 5FKPB 1AFVL 3RTQB 5FIEA 1TZIB 3N1GC 1RHHA 4FFVC 3V8OA 3VDAA 3TP4A 3CVHA 3H9SE 5HYSG 4OGYL 1CBVL 1C8PA 2FECI 3Q6FA 1BWWA 4YHPA 5F21B 3T8XB 3OJMB 4HAGA 4ODXB 4P3CH 3PL6B 2ID5A 3QRGH 3ZZ1A 4X6CF 4N8CL 5ADOL 3OGOE 1DBJH 3KYOA 3ARRA 2GSGB 2IANB 4ZOCA 4HUVA 3O3BB 2QBWA 2R4SH 1MHCA 1BAFL 1NGWA 2ORBH 4PJFA 3EZJB 4JGMA 2Y4SA 1ZA6B 3L6FB 2VXUL 3QO0B 3RGVA 4OBSA 1BVKB 1MCLA 1I7RA 3PQYD 2P5WA 2AV1B 4HWZA 4NPYA 1YMME 4PRDB 4BZ1H 4G9FB 1S78C 3LV3A 4NKOA 1R3JA 4ODSH 2GSIB 3NCJL 4M7ZB 4C83A 4O5LH 1HDMA 1K5NA 1J0KA 3IFLL 5DQDL 2FX7H 3NIFF 3MCKA 1T80A 1FFRA 2CRMA 4E0RB 1J11A 5C6WH 2BOBB 3BKYH 2FHCA 3QYCA 5H37G 1JGVL 4PJ7F 5DEZA 5T3ZH 3DO7B 3A6OA 4FQCH 4ZODA 4CVZB 1CDYA 4KMQA 1MLBB 1RIVL 3OR7A 2EDLA 4OB5L 5I8KL 3VFOA 4TOYH 4MXWL 1OCWH 5I2IB 2WUCL 2NY7H 3MRCB 5D1ZB 1JGLH 4LSPL 5HGBA 5JXAH 3T08A 4FQCL 4JZJC 2ZG2A 2VDKL 2ZCLL 5ESQB 4YFEA 1FNSH 1VGEL 2LTQC 2WWKT 1U3HD 3HNTH 3BHBA 3BIAX 4PRHA 1AD0A 1FP5A 3FO1B 1RZFL 3QEQD 3P30H 2X4OB 5CUSL 5FHAL 1IQDA 3F12A 3MV8B 4K3JL 2J7LA 4PY7B 2P8LA 1KG0B 4X6CE 3IDUA 4JQXA 3HPLA 5FFLA 3MGTB 4NN7B 5BRZB 4BFEA 1JPGB 3W0WA 3F6IA 4QTIH 2F8XC 3WFEH 2XXCB 5C0BE 2DM4A 2PUQT 2SEBB 3BIBX 3GJFB 1INEL 3P4OA 4NM8H 4U6XA 4P23A 3PG2A 1FL5B 3C87A 3DXAE 4L8SA 4YBQC 1NAML 4FP8L 2YMXL 3SE4C 3QDMB 4YHKH 3N50A 4XBEL 1JF1B 4M5ZH 1A6ZA 1TVBB 1XIWC 2A73A 1X5GA 3BRDA 3R8QA 3AS1A 1G7JB 4KJYA 2YUVA 4UOJA 4P5TA 4W4NA 5T1KD 1OTTC 5IMMA 1KENL 2P5EB 4RIRB 1KXQE 4NQXB 2VDPH 4POZC 2R0WL 1QNZL 1I4FB 2AJVH 3GBLA 3C5JA 4BK5A 3RZCD 4KDWA 1RU9H 3O6FC 4LRNH 5D7IF 2Q7YB 1NGYB 5M94B 2AJXH 5C0AE 5KN5B 4DKFH 3IS1X 5EO1A 3U1SH 2ZUQB 4OZIB 3FO0L 2DQDL 1BOGB 1AGDB 4FTVD 5D72H 2PR4L 2X4TA 2AXJA 2DM3A 3IU3B 2YHGA 3HMXH 1R3IH 4C54A 4MNGA 5GS1A 1NGZA 1RVFH 2I5YL 3QIUA 3QNYB 3CMOL 2EDJA 3VXMB 2YD1A 3NPSB 4FQ1L 2F19L 2H32A 3B2UD 1ZA6A 4FXKA 4ZS6D 5I8CA 3N1PC 4Z6AT 3E6HA 4L4TB 4XNQB 3I2CL 5TE6L 3BT2H 3WJJA 1YN6B 5TE7L 4ZPVA 4K3EH 5HYJD 3DWTA 2EIEA 3CMOH 5T5NF 3O9WB 4OFVA 2AVGA 4YO0A 4CNIA 4G8EB 2Q3ZA 3ROOA 3S4SB 2F5BH 2CDFB 2ZSVA 3WIIH 3FCTA 2XIDA 3PIQA 3L3GB 1MRDL 5IFJA 2F53D 3MXVL 4FQ2L 1BIIB 4J1UB 4RSVA 1T20A 4ZAKC 5DUMH 2J5LC 4Q2ZA 1D5ZB 4RA0C 1MNUL 2HMIC 2HJFA 1JPST 3FFCA 1UADC 2J1KA 3ZTJG 35C8L 2JCCB 4U0RB 1H0DB 1P7KA 5F7DA 4HXAL 1BZQK 1DBBL 1CFSB 3DIFB 5ILTL 3CZFA 5D70L 2VE6A 2ZUXA 3ALPA 4YQXH 4XPGL 1XR8A 2LVEA 1OM3H 3Q5YA 1YEJH 1KLGA 4DZ8A 2N7BA 3GRWH 4DGVL 1Q1JL 4XCCL 2ZPKL 1NGQH 2I9TA 2P8LB 1HYRC 4GRWE 2X40A 4OGAC 1WGOA 1IAOB 1Z0MA 1XGPB 4WFEE 3B9DA 1C5CH 1HEZA 1JGUL 2IBZY 5IMLB 2C1OB 3U7YL 1S7WA 2XKUA 2VDOH 2J8UE 4NRXB 3HC0A 1CT8A 3VXRB 2P5WE 1KBGH 4PJXE 5CKAA 1DVFB 3EGSB 1ZA3A 1JF1A 3WIHL 2ZG1A 3HUJF 4YDVA 2WWMD 1T7WA 4NQDE 4HUUA 4HBCL 1RZIA 4LCWE 3ARFB 3RWGB 5FECB 2R8SL 3HZVA 3OKDA 4CL7A 5HDQH 1E4WL 4LKCB 4U0QB 5JO5B 5ACZA 4X7CC 1CL7H 2VITA 4F37K 1IL1A 1G7MB 1N64L 1VPOH 2UYLB 4O2EB 2NY5H 1DFBH 3HCVA 5JNYB 3MOQA 4R7DA 3IDNA 3NIGF 1HNFA 1G7IA 1IC5L 4EKXA 2IF7A 1HXYB 5EZLB 4GKZB 4FQQA 4E41A 4QXTA 1QO3A 3CD4A 1IZJA 1O7VA 2BSTB 2XTJB 2VSDA 1UWXK 1MCPL 5IHUH 3NTCL 1SJHB 4OCNC 3ILQC 2ILLA 4OD2A 4PJ5A 4W6XB 3VGAB 2C4FT 1Z0NA 4U1GB 3MLPA 1RZ8B 1MAML 3F58L 4JFEB 5IEHA 5FO7B 5DQ9B 3FT3B 4W4OC 2F58H 1HXMB 3MLSL 3P4MA 4NUGH 3MLZH 4HMDA 5DMIL 5C09B 4P59L 2C3XA 4AT6B 4LFHD 3QUMH 1HHKA 5EBWB 2DJSA 1EA9C 3MYJB 4MYWB 1QPXA 1ZT1B 3KLAB 4RRPG 3HR5A 3MRRB 1TZHB 5EDXA 4QHMB 3I50L 2NY7L 5EOTA 5SV4A 2E9JA 3KJ6L 4J6RH 1T1YA 4OB5H 5I8KH 3VXTB 4JRXE 1FN4A 3O2VL 3TVMB 4KU1A 1DUZB 1K3IA 2OL3B 4JFFA 4QOKA 1IGIH 1AD0B 4HKZA 1UQSA 3AAZB 5I1IH 4JM2A 1XH3A 5MHSE 3BP6B 3WLWD 4GAYA 5EUOE 4X6EA 4EI5D 4X9FA 2YD3A 4DTGH 5FOBA 2JIXB 4M3KB 4DN3H 3QUZD 4NWTL 4ZXBC 3T1FA 3WIFB 1SVZA 1GGTA 4M48L 1CICC 5DC0A 2DJ4A 3ARGB 3GK8H 2D7OA 4MAYB 3UYRH 1SYVB 2VUYA 2RIKA 4K7PL 2VWEE 5E4EB 4P2YA 4DGYH 1R3JB 3GMLA 1N5AA 4YHKL 1CFTB 4LARL 4Z7UB 4UDTB 5EWIH 1S7UA 4P49A 2FX9H 4WI9A 5DGQA 1F58L 4JFEE 3DUSB 3LVEA 1ZHBA 3VGHA 5C09E 2OZ4A 2DQTH 4JLRA 1CGXA 4Q2ZB 4JHWH 4D9QE 2FECL 1G9EA 1QFWI 5SWZB 3V52L 1UB5A 2ZOKA 4OCSL 2E7MA 1IGFL 1WVZA 3BGMA 3LN4B 4ZTPL 3SE3A 4LDEB 4HXBL 1U8QB 9CGTA 43CAA 3L5WA 2YD8A 3MLVL 3GSQB 3INUL 1AO7A 3SDAA 4UZGA 1QQDB 3O45A 5E8PB 5K33A 5IROC 4UIKH 5F7MC 1YDPB 4GAGL 1LVEA 5ISZA 3I2CH 5TE6H 1Q9OA 1S5HA 1U95A 4X7SH 1EMTH 3KPMA 4JFHE 5GGVH 2QHRH 3VD3A 1RHFA 5ALCH 4XXDB 4P2OD 2LVCA 2BXZA 5DMJB 2KZWA 1I8LC 3GSOB 5F7UA 2BNRE 4BFIB 1KN2L 1GGCH 3U7AA 1E6JH 1CFQB 1G9MC 4QKXB 3GJFA 4YC2B 1MAKA 1UYWL 2CKBH 4ZS7L 2FYYB 4U05A 5DF0A 3W9EB 3GSUA 4LPYA 1T20B 2Z8SA 2ZCHH 4MQXD 2ARJB 4MJ6A 1XIWB 3IRZA 1IFHL 2ZUUA 1J87A 1RUPL 4UU9A 4AMKH 5CGYC 3FQTB 3U30B 2C1PA 1DLHA 1X5LA 3FQWB 3O6MH 4Y4FA 3EYSH 5HHMB 3WFDH 3UP1A 1F6AB 1TFHA 4AY0A 1KYOK 4K2UL 5IW6B 3U36B 2WIIA 3QEHA 4B0MM 4FFYH 1BLNA 4WO4D 5I17A 3S35H 3GRWL 4N0UB 4WW1A 2AXGA 5IESL 1UWEH 1U92B 5J57B 1D5XA 2GFBB 4WDIB 3OKLA 4PGJA 1EAPA 1KTLA 1F4XL 5ADOH 1S9XB 4P3DA 3RDTA 4YK4B 1P4IH 2YA1A 4L4VB 1DBAL 2VLJA 5C0IB 4QLRA 1MFCH 4ZS6C 1OD9A 4JRYB 3F65A 3WV0A 1HYSD 4OJFL 4OUUB 5EH1A 3BKML 4XMPH 4D9LH 5DVOA 4LRIA 5SWSB 3NAAL 3L5IA 3KYNB 4PB9L 4WEBL 5E4EC 3VGBA 4P2OB 1VFUA 4IIQA 5CJQL 3V5KB 4DW2L 3V6ZB 3HE6D 4FQIH 2O26U 3QXAB 2DBJA 4KI5E 5B39G 2H8PA 4GKOA 4JFQA 2ICEB 1JYWA 4PJDE 3EDJA 5A3ID 1S7XB 2P43B 3H42L 5BOZG 3RWDB 4UT9H 3O6FD 2B20A 4WI4A 4KFZC 4RCAA 2VQ1A 1UH4A 1KPUA 4K7PX 4O5LL 3LKPA 5IW3A 3SJVB 4M62L 5C0BA 5TDNB 4DGIL 3IDGB 2PETA 3MXWH 5SWZA 4UINH 5A2LH 2NZIA 3MRJB 3RWJA 3S88H 3QNZA 1UXWB 4PV8B 2P5WD 1PGRB 1S7VA 4HGWB 4ORGB 1RJLA 1RIHH 1R0AL 2WNGA 2A0LD 5JW5A 2X1XR 4WRLA 4W68A 3NFSH 4BKLA 4YGVB 2Q87A 1DBJL 1KFAH 1KT2A 5IIEB 1VACB 2J8OA 3TBYA 2D3VA 4PJAE 1IQWH 3TT1L 1L9MA 3T04D 4U7KA 3L95A 5I1HH 2NTFB 4OZHB 1TITA 3MNZA 3V6OE 5DD5L 3GI9H 5FGCE 2QKIA 1FAIH 1V3KA 2XQYK 1W72L 1HWGB 3P3YA 4LNRA 3B4NA 5D5MA 3HC4L 4AH2A 1F90H 5EU6E 4PB0L 1QYGH 2FX7L 5EFIB 1XR9B 1X44A 4MJ6B 1T1WA 3KPNA 3VRIA 5BCAA 1LE9B 5DJ2B 3GI9L 5F1OB 4JO3H 2NNAA 1K6QH 4TQEL 3RJQB 1J0YA 2EDRA 3OKYA 5IQ7L 5T1LB 1QYGL 1GGIH 5D7JB 3QWQB 5GZOD 2ADGA 4L8BB 1XZ0B 3DSFH 2DWDB 5DJCB 4ZYKB 2YKLL 1KF9B 3VXPB 1NSNL 2HKHL 4U1NA 1LO4H 3L3DB 1HHHA 5HGGS 3GBML 2FL5B 5J13B 3WJJC 4CAGA 5IBUG 3U4EB 3CH1B 2B0SH 2VLKB 4H20H 1YEHL 1G84A 1M71B 3QIBD 4GG6F 3HNTL 4L4VA 2E27H 2AKRB 2VWEC 4TPRL 1ETZA 1T5WA 4Z5RA 4OUUA 1KJVA 4WFGD 2GCYB 2ZKHL 3TCXA 4KKLD 2CDEA 1IGJA 2NXYD 1UACH 3OAUH 4LKXA 1HHGA 4YIQB 3P9LA 4F58H 1AR2A 1RZ7L 1KXTB 4WO4A 3GO1H 4G6AD 4HIEB 4FQ1H 3NFPA 5BVJA 4U1JA 3S37H 4G7YH 2BNRB 1JPFA 5TE7H 2H2PD 4EOWH 4NYLA 4Z7WA 3OR7B 3OHXB 1ZLVH 4OIIL 2W60A 3KYMB 3X14A 1LWRA 1CFNB 1TVDA 2IGFL 4LL9A 1V3MA 1J88A 4JFPA 1J1OL 4YR6B 1AQKH 5EUOF 5AD0B 3CU1A 4G3YH 3VG0H 2VISB 1J8HD 3ULUD 3CXDL 3FFCD 5GGSA 3MRHA 1I8MA 4CKVX 4RMUA 1MQKL 2AI0L 1OAUL 5JUEL 4XCEB 4X5WA 1EFXB 4NQCB 4ZUSA 1HE7A 4ZPTA 1LO3H 4NPYB 4PRDA 1TXKA 2GSIA 1D5XB 2GFBA 4HKBA 4ODTL 2YD4A 2AGJL 4PJCB 4LLYB 1P7QD 4J3VA 4K55A 4YBQD 1CE1H 4F2MB 1OB1A 4DKEH 1QSFA 2Q86A 1S7QA 3KYKL 1CXFA 2VDNH 1RUAL 2R56L 2NXZC 1E4XH 4GJTB 5IBLD 3M07A 2DI8A 4Y4KB 2VNCA 2DQEH 4HJGB 2F19H 5DFVD 5DK0A 4CN4A 4YX2L 2E7LC 2HWZH 3RGHA 2AQ1A 3KPRB 2XG4A 1NCCL 2QL1A 3MV7B 1I7ZB 1G7LB 2NW3A 1N8ZB 4LSQH 3TC9A 5FCSH 3OAYH 4KPHH 4Y2DD 2FRGP 1IC4H 4GO6B 1B0RB 1Q1JH 1T1WB 1RIUL 1L0QA 4PRNA 5J12C 4M5YL 4GG6B 1EO7A 3SJVA 2D7MA 2V17H 2A6IB 1F6LL 3J7HA 2AXGB 4FQ2H 3MA7B 4HKXA 2E6JA 5CJ5A 1C16A 4KUZH 2BVPA 3QCVL 1M6OA 3VXSD 4WDIA 2EZ0D 3OJDB 5EU3B 1QEWA 3WEXA 4Y4HD 2WK2A 2R4SL 3DI2B 1KULA 5AG8A 4O02H 5DRXB 1H9VA 3B6SB 1TMCB 3O3BA 1LK3H 3P4OB 4Y89A 3SN6N 3PQYB 4PGZA 4NQCD 1KPVB 4G9FD 5DS8B 4JJ5A 1MCFA 5CJQH 4I4WA 1P4IL 3DV6B 5CINL 5CWSA 3UTPE 1MJUH 1QRNA 3VFMB 2XA8L 2AK1L 3IFPB 1S78D 5F44A 3X12B 5KSBB 3DYMA 3MA9H 2NW2B 1G7HB 1GIGL 1N2RB 4XCCH 1H5BA 3MRMB 1MIML 3DROA 3TCLB 4LQ1A 5LGHH 2FWOA 1JYXA 4YHYB 1MFDL 1AGFA 1WBZB 5T3XE 1V7ML 1G0XA 3BPCB 3DYPA 4G6KH 3LMJH 4NQXA 3MA9L 4YDJB 1BFOA 1ZLVK 1WIPA 4ODBD 2LE9A 2XZCL 5I1AB 4M6ML 2Q7YA 5EZOH 3GSUB 2UWEB 2WIMA 3AUVA 2J88L 4PJFE 4ZQKB 1B90A 4XP4H 1YEGL 1G1YA 4LSVH 1KOAA 1HQRA 1F4WH 3VJ6B 4IRSD 1I7TA 4HX1B 1A0QH 3EOAA 4WNQB 4XNZC 3V4PL 3RRQA 4HFWB 4WFHE 1NFDB 1TQCB 4FOMA 4ODXA 5CEZH 2X2YA 2YPVL 1UM6H 2R1YA 3L3KA 4IRZL 4LHUA 3SQOH 1A7QH 1GAFH 1R0AH 5IGXH 1MCDA 4MNQE 1S3KL 4X5LA 3GMQA 4M3JA 5IW1B 3CLFH 3VXUD 4X6DF 3QAZC 3BPOC 4LCIH 4BSVB 3BVNB 4P57B 4WJ5B 3O3UN 3BSZL 3FQXA 3MODL 1ZGLM 5F7FA 1QSEB 4M7ZC 5D5MB 3SY0A 2A2QT 1KELL 1IGIL 4H0IA 4G5ZL 4X80H 1T4KA 4ZFOA 5D1ZC 3PUCA 5AAWA 2ICWI 3B3IA 5JHDD 4HT1L 1I7ZA 2V5MA 2VOTA 2X7LA 3DVNB 3VDCA 5HVHC 3T8XA 2IFGA 3WFBH 4AEHL 1QNZH 2AJVL 1MFBH 2CDGB 3BMWA 5JMRA 2GJ6B 3QG7H 5HHVH 5ETUB 4DOHE 5DD1H 4JFPB 2DD8H 4YR6A 5AD0A 3PDDA 3KLHC 2A6DB 3RY6A 4FTVB 4TNVK 3S6CA 3V4UH 3MLTB 4E41E 3QDGE 5HGBB 1HHIB 3GSXA 1J7VR 2DN7A 1P4BH 3ULUL 5KN5A 5SWSE 1TJIL 4Z77A 1JHLH 5ANME 4LLQB 4RQQB 4JFZH 3SPVA 1IAIH 1RJYB 4HFUH 2X4TB 5D2LF 4PJ8B 5FYKH 3IDJB 1RI8A 5FA4B 3ZDZF 5I71B 1BZ7B 5LXGL 4WI2A 4UIKL 1YNKL 1PJ9A 2DDQL 3RWFB 3GSNB 3O9WD 1GPOH 5MI0C 2DMBA 4M02A 4LFHG 4GQPH 4Y5YA 2OR9H 3ZDYF 4XPBL 1OTSD 3DECA 4QT5A 4EI5C 3TBTA 5M7QA 2D7TH 4JGJA 3IJSA 5ALBH 4JG1L 4LIQE 5IVZA 1OP5H 3C60C 4NSKA 2G5BB 1I9IL 3SDXF 5DRZB 1JN6A 5I30H 1NANI 3D0LB 1MF2H 3ZKMD 5IR1B 1DVFC 1UB6B 3CFEB 5CGMA 1EX0A 4LARH 3QWOA 3WKNA 2QR0B 2GY5A 4RBPK 2ZNXA 3DVGA 2NTSP 3NZ8B 4Y88A 3IAGC 5IFAL 3UTQA 2X4OA 3BP4B 3CCHB 3R0NA 2QJDA 4JVPA 4XVUD 2FSEA 2XACC 2UZXB 2NY5C 3DRTA 5TH2A 1C08A 5DJ8B 3CVHH 3MGTA 3DX9A 3SDDD 1UM5H 3JV4A 2JELL 4GW5B 2V2TA 4LLWB 4HPYH 1BQUA 4WW2B 4XVUC 1NGZB 3QIUB 5DK2B 1KJ2A 4V1DB 1G9NH 2R23A 1NCTA 4NCDA 3VFRB 5T1DL 3WCYA 3G6DL 3W0WE 2ZZUT 1KIRB 5GGUA 3QZWB 4X7SL 4LCCB 5ERWA 4OZIE 4L4TA 5B21A 1BF8A 3FFCE 4LSQL 1A4JA 5HY9A 5HYFA 2PTUA 1ZLUK 4GMTL 4YJZL 5DZOA 3BD3A 4JM4L 3H9SA 3RWGA 2HJKB 4JFYA 4PS4H 2H1PL 1JJUA 4HS6B 1QR1B 2MWCA 3CSPA 1WISA 2EEDA 1XGYL 3CFJA 4FQIL 3EJZD 1CGUA 1G6RL 3TYFA 4X8XA 4DQOH 1KTRL 1SQ2N 3DVNA 1MREH 4R4BA 3FB5A 4KUZL 4WFED 1CL7L 3RP1A 3H6JA 1T0MB 5FOBB 4WHYH 4QXGH 2I60L 2PYEA 1NMBH 1N59B 2CLRB 2QQKL 1JNHB 2BSTA 4HULB 4NUJB 5INDA 1ZEAH 3E0GA 3VXMA 5ENWB 5IQ9A 3QISA 1CI5A 4LEXH 1BP3B 3NFNA 2V9TA 3QB7C 2LU4A 3TNNA 3KPMB 3S5LB 1K2DB 4EVNA 3GHBL 4TVPD 3KJ4C 3F62A 3RU8H 1N2RA 2Z31D 4R96B 2HH0H 2PYFA 3KXFA 4RGOH 4ZUTB 3T0DA 5T3ZD 1N6UA 1CLOL 3QQ4A 4YO0B 3I6KA 4CNIB 2OR7A 3AREA 3IETA 5EULV 1S7QB 3MRNB 2L7UA 5IUSA 4XPAL 3L3GA 4BZ1L 4G7VL 4PFEA 3EO9L 1CYGA 2GUOA 1RZGA 1DE4B 5FEBA 2XTJC 3C8DA 3TT1H 3O4OB 3MV11 3SKMB 1A4KA 4KI5C 1KTDA 1AP2B 1QBBA 4ZQKA 2EECA 4XNXL 2UWEA 3O4LA 1DUZA 3CMGA 5DD5H 1IM9D 2D7NA 2ERJC 2JJVA 3MRIA 3KJ6H 1P4LB 3BRFA 4DFIA 3F7PC 5D9SA 1A6WL 5ADPL 2HT4D 2DTMH 5MENB 3KHOA 5DT1H 4C56D 3BW9B 1SMOA 1WFUA 5CBAB 3NIGE 5SX4I 3QFJB 2YC1A 5C3TA 4F7TB 5J11C 1XF4B 3WNLA 2EDHA 4XBEH 4JM2B 4DN3L 2I07B 3MRLB 4GT7A 1EUUA 4R0LB 4BFIA 4M7LH 2P47B 3LKRA 1HIMH 3BVNA 4P57A 3CFIC 4XCFH 3QDJA 3S88L 3B9KD 3LKNB 3TESA 3PDOA 3DXAA 1TJGH 4JFXB 4MCZA 3QDGB 5J0BA 3JV0A 5BV7H 1CGWA 1SEBA 2D31A 3VXRA 4WV1C 3RA7L 2HMID 4HPOH 4LVOB 1EH9A 3T0EA 2Y7QB 5MEPB 5E9DB 2HFTA 1TPXC 4FZ8H 1JGDA 1YQVL 1A6VH 3Q6FB 4YHPB 5E7FA 3I6LE 3VMOA 4YFDB 1UB5B 3PL6A 1QFPA 2EKJA 5C0CD 4L8CB 4AEFA 3KLAA 4LPCA 4PJ7E 1U8LA 1WTGT 1MHPH 4Q9QH 3TZVD 3BH9A 1CWVA 1BZ9A 1S7TA 1IBGH 2DLFH 4WWKA 3C2AL 5ABDE 1J8KA 4YUEL 3MBED 3CK0L 3GJEA 3G5YA 1N59A 1OLLA 1Q0YL 2IADB 1UGNA 1ZKAA 3MCLL 3WXVL 1IE5A 1YUHB 3OTTA 2JJSA 2IPTH 3G08B 3IDJA 1P9MA 2VIRB 3FL7A 1QFOA 5IB1B 2GEEA 1QLRB 3MV9A 4GBXB 4PRAA 4C58B 4JM2D 4MLSA 5FYKL 2UY7A 5MP6H 5FUCE 2DQJL 4QHKI 3FRUB 5JPNB 3WXVH 1HOCB 3L95B 3SDCA 1YEJL 4PJGF 1FYTB 1XF1A 1I3RB 3GRWA 5L9DL 4MMZC 1A2YA 3LKPB 3RPKA 5GRJH 4G43B 1XIWD 4MGXA 5GSRA 5LGJB 1Q72L 3TN0D 3ARTA 4PG9B 2D7TL 2HTLD 4Z7OF 1T66D 1MWAH 5I1EL 3D2UA 3LQZB 4XP9H 2OXHA 4FFWD 5IWLA 4AIXA 1TNNA 1Q9LB 4R3SB 5F3BB 4A6YA 1D9KB 5IESH 1RD6A 1R5IB 4WVRA 3X3GL 3ALXA 1F4XH 5EC2A 5BS0E 3LSOB 5C8JA 3FOMB 1RIUH 5DTFA 4Y8AA 3N06B 5ECJE 3W9DA 2VQUA 2IANA 4HUVB 2VL4A 2YWYA 1QQDA 1A1NB 4L29A 1KIPA 4IDJL 3S36L 1VFBA 4N8VB 5A2JH 1JNJA 5MEOB 1YJDH 5D7JC 3KPQB 4GW1A 4DW2H 1HILB 3R0MA 3S5LA 2EE3A 1V3JA 4RWYH 1AJ7L 4WEBH 3LKNA 5KAQG 2XRAL 3DXAB 4F57H 4FS0A 1FC2D 4UT9L 2R2HA 5IMOA 1OAZL 3MOBL 3N9GH 4OV5A 5T5NG 3NACH 5EFIA 3RWFA 1JPTH 2Y5TB 3WSQH 1WEJH 1SM3L 1U93A 3STZA 4H5SA 2DLHA 3BI9X 4MXQD 4N8VG 1HKLH 3MREB 1LK2A 4JLRB 1DBML 1Q9WA 3L5XL 1TJHL 1VEPA 4I2XA 1Z9SA 3BKCL 3QEGL 4AEIL 1PG7H 1FL6A 3OHXA 4XBGA 2BVQA 2CR6A 2NZ9C 2YD6A 4UU9B 5F88B 3HE7B 1HYSC 2Z92B 3D85B 4OZFA 3MRQB 5FYJH 4EDWL 3WL9A 3QNYA 5E2VH 3WHE0 4F80A 3U0WL 5JMOC 3B9KC 3ARDA 4HV8A 4XP5L 4BZ2H 1KXVC 1X3DA 1CICB 5I8CB 2OM5A 2FO4A 3O2DA 1Z5LB 4WW1B 4CADB 1ZEAL 1JZ4A 1INDH 4PUBH 4FQPA 2DQGL 3EYOB 5BS0B 3ULVE 4G9FA 3TGXA 4IHOB 5FYJL 4EDWH 1CLZH 1KCSH 3JWOL 1DSFH 3F8UB 3NN8B 1B0GB 2BY2A 2DQFA 5E5RB 1JPGA 4GKSA 4O51A 2OL3L 1DUYB 3SQOL 5FM5O 3B9EA 1KEMH 1OVZA 2FYYA 2APFA 3DX8B 1ZOXA 1YJDC 3OKMA 2VR9A 3BE1H 2EC8A 3HAEA 4M4PA 5E6IC 4MQ7B 1UWGL 4PBVC 3T65B 4W70A 2E7LA 1NCAH 3BEWA 1XCTA 2O93L 1TQCC 3EO0B 4PD4K 5D7JA 3UYRL 2ZUYA 4K8RL 5I73B 3V0AC 2A6KB 1XFPA 2DRUA 3O0RH 1G7JA 4KJYB 3UJJH 5CZVL 3FB6A 2HKHH 3G04A 3KYOB 1P2CB 3D48R 5E56A 1ZT7A 3ZLQC 3MRFA 4G6KL 3VRIB 2ZUWA 4RISL 5L2KA 1XF4A 4KMTL 3CAFA 4X6BB 1EEZA 3V7MA 3BSZH 1EAPB 1RVFL 2V9RA 5C0GA 1MJ8L 4TNWF 3EYUL 2VLJB 2VXSL 2GT9A 3PXHA 3WHXA 2DL2A 4F3FB 1IGFH 3ESVF 1ZLSH 5I0DA 2EDXA 4LVNC 4AIZB 4PP2B 4KRPC 4ZD3H 4AK1A 3BWAA 2A6JA 1OGTB 3D39E 1A7QL 4RMVA 4QGTA 4PJHF 1OPGL 5DJXA 2A38A 4F33B 5CAYB 3SDCB 4OTXL 5TGBB 4M48H 3RA7H 1JPFB 3SDCC 4OGXH 3HHRB 4O9HH 2EDDA 1W0VB 4W81A 1AXTL 3TO4A 5ELIA 1OGAE 3PWPE 1CFNA 1XGTA 2GJZB 1DN0B 4JY6B 1LO5B 2A6IA 1RZGB 1F11B 1MCKA 4AH2B 1BQLL 2IGFH 1NBQA 2JJSC 2OR9L 1N0XH 3WN5C 1VHPA 3BH9B 3RTQC 1AC6A 1FGVH 7FABH 3WMSA 5D6CA 3CK0H 1NFIB 2XN9A 5HHNB 1EHNA 2AEIT 4Z7VE 4KRNA 2D0HA 3ULSA 2DDQH 5HI5C 1NC2B 4MA1C 1CE1L 5D2LA 2EE2A 3CFKB 4H25A 2D7PA 3SKNB 2ZPKH 1OB1B 2AGJH 1WBXB 3QUZC 3HRZA 3CSBA 5I66B 3CLEH 5IT2L 5ICZA 2H9GB 4WHCA 5E6IB 3S3PA 3SDDA 5E7BA 1AQDA 4GRLC 1JZ7A 1ADQL 1RY7B 1SJVA 3QHZH 2CR3A 4JREC 1KEGH 4X9IA 3V4UL 2FHFA 1BREA 2C26A 5FK9A 2X42A 3NN8A 2HLAA 1IAOA 5B3JF 5IJVB 2EDBA 3S4SA 4V2BA 4JCMA 1DQTA 3F7YA 2NY4B 5I15H 4JN1H 5I1GL 3OKNA 3UJIL 3X3FH 3ARDD 1FFOA 1N6QL 3LQZA 3TA3D 5F8RC 3QJFA 1OWWA 5J6GA 4WI5A 3JUYA 4PTUA 5EZJA 4X4YB 1A7RH 3PWJA 2HT2D 4L5FL 3ZE1F 1R5WB 3MX0A 1WK0A 3FRPG 5GGTH 4XRCB 1MI5E 4HUXB 2XFXB 2XWJB 1EBAA 3VG9C 3PQYA 4UDUA 1JHTB 1TCRB 4MNGB 5FM8A 5D1QA 4OKDA 2UYLA 5DRNB 4I0CC 5E2TH 3MLXH 2CIIB 2FIKB 4O02L 5ID1B 1QEWB 3LAFA 4ETQB 3MNVB 4LRIC 3A67H 1X6LA 4OLXH 3T0XA 3OKKA 1RUQL 4HC1H 4PGEB 3CXHJ 1JPTL 4IS6B 1BM3H 1I1AA 5DK3A 4XH2A 1FLRL 2R15A 4L3ED 5IBTH 3WXWH 4MMXC 3WUZA 5C0EB 3LIZH 3HG1B 4P59H 2Q86B 2X4QB 5FOJA 4EI6B 3D3VB 2AJZA 5CILL 2J2ZA 1BQHB 1EBPA 3ZKQD 5TDOB 4OLXL 1AHWB 3JBG7 3WE6B 4QXUL 1GH7A 4OZ4B 3NZHH 2I27N 1QOKA 4XBGB 4OAWA 4NQVB 4WU5B 3IJSB 4LSVL 3UBXI 4TSBL 2FGWL 1SBSL 4M7KH 3T65A 2D03L 1EHLL 2H3NB 4J4PD 4HX1A 4U1GC 4M6MH 5DRZA 2VITB 1F8TL 5D93C 3T0BA 5EOTB 3O45B 4NFDA 3VI3E 3EOTL 3CPLA 1QRKA 3UBXA 3D2UB 3DVGB 2FDBP 4HIHB 3HAEG 3PWVA 3TA3B 4OGAD 4PJBF 3JWNC 4OD1L 5J1AA 4KJPC 4WFGE 1Z5LA 1P6AB 2OK0H 3T0EE 5T3XD 2XZQH 3K8MA 1KSRA 2OJZL 2MJWA 4AENA 4IHOA 1CR9L 2P44B 5DVNA 4JY5L 3TJEL 4P2QB 1GZQB 1FYTE 1NBVL 5E1HB 3SKOB 4I48A 2GKIA 3NCCB 2BERA 4PJIB 5GZNC 3Q3GA 1KJ2B 4V1DA 4JAMB 1R5VB 1QVOA 4ZO8A 1T4KB 4ZFOB 3ZSSA 5IJVA 4PJBB 5ERWB 1KELH 3VWKC 1I1YB 4RGNE 4ORZC 3FQTA 2XN9D 1OOAA 2A9NL 3FONA 5CZVH 1PYWA 3GJFK 1W0VA 5JW3L 5HHME 3HZVB 2EDOA 1NCAL 3SBWA 4I1NB 5DD0H 1KCKA 2EO1A 4RBPH 2FEEI 4XMKH 4NN7C 4IOIB 1U8JB 2MCPH 5HHOE 3HC4H 4OCWH 2FSEB 3BAEL 3AAZA 1F02I 3C8KA 1HWHB 5TPWL 2GJ6A 5GRVL 1M7DB 1C12A 1IAIL 1Q94A 1CN4A 3IFOB 4QRPE 1LEGA 3PJSA 2E7BA 3RBSA 1DTUA 1HINL 5CIPH 1PLGL 1X7QA 4R4NC 5EU7E 1C5DB 3X17A 5JTWA 1AGBA 1P4BL 2BP3A 4LRNL 1GC1H 5DURB 2W9DH 4PPTA 5CSGA 2GK0B 4WGWB 3L6FA 5TPWH 4N9GB 4UT6L 3FHQA 1H3WM 3QH3B 1LO4L 1F6FB 2VZUA 1FG2A 2CGRL 3C60A 4D9RE 3K4AA 2RQ8A 2MHAB 3LKQA 4GXVH 3T4AA 3P4MB 5EIQA 4G8GB 2R9HD 1T7ZA 4ZXBB 3R8BB 4G8IB 4M61A 3HE6B 1GPOL 2EDYA 2IPKA 4MJ5B 4O2FA 5LWYH 3H3PL 3DX6B 1IBGL 2DLFL 5JIPA 2OJEA 4K3EL 1E4JA 1N0XL 3MPCA 5F7EH 4PRPB 4LBEB 4HK0B 4ZOAA 2XN9B 3M1BB 4TNVF 1ORQA 3ZTNL 4JVUA 5J6HA 2X10A 3BP4A 3CCHA 1UVQB 4G9FE 5F9JA 4IEFB 1I7TB 1P4LA 2CLVA 1DLHB 5CP3H 5C6TL 3OX8B 4XAKD 1SY6A 3IYLW 4ESKA 3ILPB 4MJIB 3QWOB 1MWAL 4ZNEA 2WIIB 5ETUA 3L3JA 3T1FB 1ZVHA 4AL8H 1WZLA 3MGOB 5JXEA 4OKVA 2A6DA 4MVBD 2ITDA 1OAXL 3CDFA 1QSFE 4X7FC 4P2RB 2EYSB 1XCQB 3LKRB 5GRYA 4ACPA 5FB8B 1FZKA 3O2WH 4NOFA 2HLAB 4FQJH 1G9NL 2KPNA 3I9GH 3HI5H 4PP2A 4PD4J 3LEXA 4LP4A 1UEMA 4GMTH 3GZKA 5I6XC 4W6YB 3AB0C 3VFWB 2DJUA 1Z3GH 3BZFA 1A6UL 4MZ3A 4KVCL 4DWHA 1DJSA 4ZOBA 1TVBA 1U41A 3QEQA 2XA8H 4X4YA 1S5IH 3QJFB 4G6AC 4JANA 1N6QH 3H8NA 4TRPL 2D2OA 3T3MF 3UJTL 4S1DC 3GSQA 4HCRH 4LPVA 1WEJL 3O11A 1PKQE 3TWCH 4Z7VA 2L0DA 1I85C 3A6CH 4HBCH 3UO1L 3VFNB 2CJUL 1ES0B 1S9XA 4P3DB 4PJAF 3BKCH 4LLAA 4LLQA 1KGCE 3KXFB 4HH9B 3SOBL 3M17A 5DEFA 2FR4A 3QO1A 4NKIH 3TWCL 1BZ7A 2HH0L 4NBYB 4PRID 5B3JE 1XF5A 3RU8L 3NFNB 5IFHL 4XNQA 2IFFH 4HAFA 4MNHA 5LAXB 1IEHA 2HKFH 5TQ0H 1ACYL 1I3GH 1JUFA 4NRYA 4OFYD 2VUOA 1ZXQA 3CFCH 2EC9U 2CRIA 4JDZA 1A9EB 4KTEL 4HUWB 1FYTA 4M93B 5IHUL 3U9PL 4Z7WB 2VZVA 4O58L 3FN0L 3VWKB 2QTEA 3K1DA 3DETD 1NJ9B 2Q6WA 3VFOB 5SWSD 3ZE0F 4LBEA 2IQ9H 4HWBA 5DUBA 3SKMA 4KC3B 4OF5A 1MCQA 2WUBL 4QO1A 1YYMH 4ENED 2PXYB 5EZIL 2XZQL 4OLUL 3QNZB 4UILH 1T7VA 1PBYA 5EU7C 3RPIB 1WBYA 5D9SB 3VFTB 2HLFC 4DFHA 3SGJA 1I8IA 3G5XB 3PGCA 5KSAA 4JEGB 2ADJB 4QGYA 2DWDA 2X41A 4H20L 1F2QA 3QEUB 4OIBA 2PYEB 4Q58C 1YEHH 3MLRL 3FKUS 3EDFA 3QG7L 5C0AA 3BJLA 4GRWH 3MR9A 4PJFB 2ZNWA 3V4VL 2V7HB 5FA3A 2BSRA 4YDLB 3GGWB 4DK6A 4KHXH 4PGEA 1V3LA 2YZ1A 2FBJH 4KKNA 2XZAL 2NY3D 2ESVA 1DANU 3KPRD 5E03A 3CJJA 4OT1H 1JMXA 1NLBH 3CFJB 1T1XB 1T89C 1J0HA 1N3NA 4KJWD 1U3HA 4YHZL 3REVA 1A3QA 1MHPL 4ODWB 5EWIL 1VFAB 1WFTA 1TNMA 3LS5H 1D5MA 3NGBB 5E95B 2ADGB 5FM4A 4BFGA 4JKKA 4M8VA 5JW4R 3JXAA 1PLGH 3HE7A 4O9HL 2DTSA 1AGDA 3QA3A 1LDPL 2WP3T 3C5ZA 5HGAA 3JSSA 1FH5L 5F6HJ 1LEKA 3ZE0E 1JE6A 5HPMA 1MSPA 5E24E 1A3LL 3RVTC 5D6DA 3L3HA 5HHVL 3NH7L 3U82B 2A83B 1YN6A 5CSBA 1XAUA 3PV7A 3X12A 3C5ZC 1ZK9A 2M8XA 1I1RA 1X5YA 3INUH 4M5ZL 4ZSOE 5ITBL 2V6HA 4DKDC 4AENB 3GI8H 2IH3B 3I6KB 2EKSB 1DLFH 1VGKB 2AAVA 2IPKB 1BQLH 1EMTL 4HEME 1JL8A 1TJIH 1ZSDB 5IB1A 1W0WA 4HZAA 1LGVA 4JQXC 1II4E 3D18A 3GUTB 5I1KH 4MD0A 5CEYB 2XKNB 1QLFA 3QNXA 2PR4H 4QRPD 1ADQA 5T1MA 1RQ5A 2EE6A 1JWUB 1AP2A 5GISH 4CW1B 2H45A 4K94H 3VMPA 3RI5K 1D5ZA 2AJXL 3BP5B 4ZO6A 1MCBA 4APQB 4CVUA 1BVZA 2HVKA 3MMEA 1XCTB 4ZFOL 5D72L 4JPWH 4JN1L 3LKOA 2X4SA 2DKUA 4X83A 3ARGC 1KJ2L 3FOMA 4XP9L 3FB6B 3G04B 4WV1B 3DNKA 4N90D 4RIRA 3WUWA 3P9MB 4P2QE 4PJGB 3N1FC 5FYJD 4DZ8B 1QBLL 4P2RA 5F70A 1I8IB 5DHVH 4YDIH 4QHNB 1A7RL 2MQ0A 4LSDA 5KANG 3ZE2F 1U8NA 3C9NB 3MJ8B 5L7XH 4PJAA 4RWYL 3FOLA 2LFGA 5EO9A 4JB9L 4JFXA 5B38G 4Z7VF 1KNOA 4PG2A 4G9DA 4PJEE 4XPHH 2H32B 5B8CA 3DV6A 4GSDH 5I8EA 4L1DA 2VXUH 4GBXA 3VFMA 4NO0D 5HHOA 4HZLB 1OGAA 4NQEB 2E6PA 4RDQG 1QSED 1Q9WB 3FTGA 4LEOB 3WFHA 1BHGA 3VXRE 4GQ9H 1SM3H 4G8EA 2OTPA 3QFDA 4Z7NE 5B3NA 5J4MA 2Y5TA 5JQ6H 1E4KC 3GKWH 3OKDB 3V0VA 3L5XH 3P0YL 5FV2A 3WXWL 2XPGB 5DEGB 3ZE2E 4X6BA 1JNNL 1PW3A 2GJ6D 1S9WA 1YNTA 1KPRA 2X70A 2FJFA 1S7TB 3HUJA 1CXEA 3BO8A 1JZ2A 4X8JB 5EU3A 1QUNA 1RMFH 1P1ZA 3G5YB 1BOYA 4Y2DA 1M4KA 1CICD 5F96H 2NQCA 4DQOL 1J8HA 1E6OL 4G6JL 3S35L 5IVXA 4YPGA 1JHKH 3MLYH 1FVEA 1NEZG 1R3KB 1S5HB 4YXKL 2I26N 4NZRL 4Q9CA 4PUBL 5IB2A 5F3HA 3VGDA 3GM0A 2DB8A 3M8OH 5DQ9A 4U7SA 1K4CB 5C0CE 5DJYA 1OTUC 1TCMA 2NY0B 3SKJH 1HILA 4KRLB 5C09A 4J2XA 4I13B 4X99B 3VRJB 5LCVH 1PG7W 4OJFH 1MJJB 3NAAH 4ODSL 4K8RH 2W9EH 3QULA 1FVDB 4J6RL 4PG2C 3QDMD 2DIJA 4H1LA 3VXTA 5DHYB 1BM3L 2OK0L 2LU7A 4ONFH 2Z4QB 3QG6A 4NP4H 1S9VB 2CLZA 1ZGLP 3BKYL 4JKPH 3KYAA 3ULSB 4G7VH 3VE0A 5T33L 1RULH 3BQUA 5DI8A 1OW0C 3MTRA 3IKCA 4P4KA 3MV01 4NKDB 5FECA 2E9WA 5C8JB 3TFKD 2P5ED 3GM8A 1TJGL 4M1CD 2A9MH 5I1JH 2FGWH 2BVQB 2W59A 4N0UA 3RIFK 4M03A 1FNEA 3RZCB 4KMTH 5J06A 5F1NA 3T4YB 2IPUK 4HK3N 1IGCL 3STBA 1K6QL 1U3ZA 4WW2A 3MRQA 1CD1A 5HDLA 5CJXC 2V2WA 3D0VB 3GSXB 3KPTA 5GGUB 2A9ML 5I1JL 4CUCA 2FATL 4LCCA 3SGKA 3FO0H 3IFPA 5EZLA 2Z35A 4V1DD 3P77B 2MPAL 2EIZB 3DURB 4HKJA 1TETL 2AK4A 2DQUL 1SHMA 1NFDE 3TCLA 2FX9L 4AIZA 4M7JH 4WWKC 1HQ4A 3MCKB 4IOFD 4PTTA 5J89A 4JFDB 2DICA 5EIIB 5EN2A 3TIEB 4OTXH 1OGAB 4NQEA 2V5SA 1YPZA 3QIWB 5CCKL 4R4FL 3GFUA 2ADIA 4GKNB 2O61A 3PHQB 3PWJB 5E8EB 5D1QD 1T2XA 4OD3H 5K9OA 3WIIL 3LS4L 3QCTL 5D7KD 3GNML 1KACB 2DL9A 3GSWB 3NPSC 1QA9B 5HYSA 4Q74A 4M6AA 4WV1A 3HKFA 5DC9B 4JGUA 4ONGH 5HHXH 3TA3A 5D6CB 4QRUB 4LP5A 4HWBH 1ZANL 3MYZA 3PE9A 3MV9D 4MXVF 3KPRE 5HI3C 1JTPA 3HB3C 3ARZA 4ZFFB 1MWAA 4LGRB 4F9LA 2IALB 5FYLD 1AY1L 3H3PH 1REIA 3NH7H 5EOCH 3UPCA 1L7TL 4MB4A 5DJAB 2X4QA 2NY1B 1Y6MR 2CKBL 4ZS7H 4B50A 1W0WB 3VFUA 4WI6A 4OZ4A 4PJ9D 2WQRA 3KPSB 5EU6A 2ZJSH 1NGXA 3BDXA 2NY4D 1XF2A 1CGTA 4UV4L 4MA7H 4ZMAT 4BK4A 4OLVH 1IEAA 4P3CL 4GW4A 2YRLA 5GISL 1CGYA 3OKNB 3SDXB 4X9GA 3QIWD 1JRHL 4DEPC 5BRZE 4G42B 5IW6A 1PZUB 3BGFB 3WIHH 1UCTA 2A1WH 1NCBH 3W39B 1IAII 5D1QB 5MENE 3SGJC 1B9ZA 3FAXA 4M1GH 4ZO7A 4ISVB 4XNYH 5L2KD 3QO0A 3RGVB 3FMGH 4WUUA 4QHNA 1S5IL 4I48B 3C6SB 5D70H 2AJUL 1WC7A 1H8OA 3HNVL 1IM3A 4PJFF 2CLRA 3DARA 5JLZA 2NY6C 5D2LB 3LRSA 4OZGA 4G8FA 2NY5L 3V8CA 1JZ6A 2A6JB 4WWKD 2OR8A 2H9GA 4Z9KB 4HLZG 5DJZA 1ZTXL 4M7LT 1ND0B 4AG4L 4JREB 2OS7A 3D3VD 1J1XH 4Y16D 5KVMC 2NY1D 4HCRL 1KCRH 3IDMA 1P5UA 3QQ4B 3NTCH 2CDFA 3K4DA 3ZKSD 3D3VA 3IDGA 4HDIA 4Y1AD 4F57L 4IOIA 3TYFB 1JTOA 1YNTB 2X70B 3IXAA 5I6XB 4FXLA 3K2UH 5FUCC 4QTHA 1CQYA 4NYLB 1U91A 3C8KB 3GSVB 5DMGC 5KSBE 1P1ZB 2XQBL 5KSVB 1V7MH 4RGNB 3JV6B 1RHHB 3WO4C 1A9BB 4MQTB 3MRKB 3WFCL 3C6LC 5GS1B 3L9RB 1MHHB 5CGTA 4YGVA 3S3JA 5HDQL 4YXKH 1JGVH 4U6HA 3E3QC 3QUYA 1U8OA 4BQCA 4FXKB 1C08B 4UOW0 5HYQB 3HZYB 1E6OH 4NIKB 5DZNA 1BBJA 3Q3GB 2YZ8A 3RVXD 2V5YA 1P84K 4GUPB 1H3XA 3QFJA 2Y25A 4DJMA 1HOCA 4ZTOH 1OT2A 5FO9B 3LEVH 3ZDXE 3H42H 2X09A 1LK3L 2NY2D 4S10A 4PJAB 3IETB 5H35B 3QUXC 3C08H 4GRLD 4HIXL 3DURA 5ID0B 1FNSL 5EC1B 4D0BB 4YHIB 4D3CH 5IOPB 3OSKA 3JUZA 2AQ2A 4K9EL 3LEVL 2W92A 3RWIB 5D7IE 5C0EA 3EGSA 1DVFA 2VDPL 2F58L 4XMKL 2B1AL 2E7CA 3IDXL 3LN5A 2UWEF 4JKLA 1NDMA 3BWUC 1WCBA 4CDGC 3JVGA 3IB4A 4CVZA 5DJCA 4JQIL 3SDYH 4EI5A 2DIBA 1H15B 4GS7B 5F97E 3IKCB 3VI4F 5HYJE 1C12B 1Q94B 4LOUC 3FO9A 5BQ7A 5J8OA 4KROC 2WBJC 1R3IL 5SWZE 5EZOL 8CGTA 4OCWL 1U8LB 3WDJA 3PWUA 4UAOC 1QA9A 2HRPL 1A7OH 1OL0A 1R3HB 4RGND 1BIHA 4QRQB 4GG8B 4ZFGH 3BO8B 3DYOA 3QQ3A 1M7IB 3I75B 3O6LH 3RIAK 3BIKA 5GJSL 5KSBF 1IGCH 1K4DA 4KY1L 3BZDA 3C6SA 1I7RB 4HWZB 3GSRA 2QLVB 1UM6L 1IQDB 3OR6B 5EBMA 1RZJH 3IU4L 4WI3A 5CSZB 1CG9B 5A2KH 4LOUD 4MJ2A 1SEBB 2D31B 4C56B 1RU9L 3ULUH 3ULUF 1H3GA 1VB9A 4K23H 3THMH 3KNBB 4J23A 2UZYB 1SYSB 1KLUB 4BUGA 1WJ3A 1KENH 1NSNH 4JO4H 1NL0H 4XHJD 4DVRL 4XVSH 4PYGA 4I2XB 4OCXL 4OZHA 2HLFD 1IAKA 1K8IA 2APVA 5EBLB 3S7GA 3QUZA 1CXHA 1TPXB 1FORL 5ITBH 4XX1G 1LP9B 4OI8A 5C6TH 5IT2H 4H1LB 3WL9B 3LQAC 2VJXA 4UQ2A 4XPBH 3V6FA 2H2SC 4JFOA 3QIUC 3GSVA 1KCUL 1N7ML 2MSPA 3QG6B 1QZ1A 4Y4FD 1FIGL 4MJID 3W81A 4DGVH 3FN9A 1UVQA 3O6ML 3BZEA 1HZHL 3M17B 4KHTL 2IADA 3K81A 5D1XD 3MUY1 3VFTA 3KWWA 4PP1D 4EDXA 1FGVL 4CRPA 3LS5L 3ZSTA 3H3KA 4YHYC 4AL8L 1Q9KA 2FJGA 4L9LA 4M8QA 4EQ3A 2X4PB 3P0VL 1MHCB 5AG9A 1HXMA 2WSKA 3MR9B 4L4VE 2DBLH 2I9TB 1FDLL 3DX8A 3AS2A 3ZHDA 3VG0L 1CCZA 2PN5A 3NMEA 4RMTA 4XAKE 3EJYC 1Q38A 3VWKA 1ND0A 3VGFA 4U1SB 1JGDB 3S34H 1DQJA 1G9NC 5D2LE 1S9YB 4L8SC 5IOPA 5EUOB 3WS3B 3ZDZE 2A6KA 4PG9A 3IRPX 4KTYA 2XZZA 1Z3GL 1RURH 5DA4A 3MJ7B 4R26H 2PXYA 3DUSA 2P45B 4YDIL 3PIQB 1JP5A 4QYOB 1P6FA 4L1HA 1X5KA 5JPMA 1KB5A 2VDRL 2MCG1 1L7IL 3RPIA 1ITBB 1R5IA 4WEMB 1L6XA 1G6RB 2VLRA 2HJFB 3WFDL 5T3XH 3ARFA 2DOCA 3HTLX 5D8JL 1ZMYA 5E08H 4KDTC 4QEGA 1U42A 1MREL 3F7VB 4JPWL 3UTSD 1G7MA 3SCMB 3ZYZA 4ELKA 3PXJA 3JTTB 2OTWB 4CDHA 2W38A 3QDJE 4IMLB 5FCUH 2VLJD 3P4LA 5LAXA 1EHAA 2X4RB 1QLRA 5ESVA 1T6WA 2ARJQ 4S1DD 4RRPA 5JQ6L 5GQBA 5HI4C 1CVRA 3CUPB 4KZEH 3VFPA 2F54D 5AZEL 2FCBA 2OI9C 4NO0A 5HHOD 3QCVH 1WAAF 1FLTX 3I3DA 2OJZH 4QHMA 2PO6A 4F37F 2ATKA 3RVXC 3TT3H 1MFCL 2BMKB 4R2GD 4QHLA 1I9EA 3QCUH 4WY7L 4ONHA 2BRQA 2LTQB 3W9EA 5KJRL 2GK2A 3IGAB 3RNQB 1QBMH 3FN0H 1RV6X 3B9KA 3L3IB 2OL3A 5L0QC 3KLDA 3BPOB 4Z7QE 1YEDA 4DUXA 3WYRA 1EJOH 3K80A 4GXUM 2BNQE 4GG6E 1DBKH 3LKOB 2FD6L 3NIDF 4JDVB 1UB6A 2R0KL 3CFEA 4WNQA 3T2PA 2JJTA 2QR0A 4LLUA 5DMGD 4KDTA 5C2BL 5LQBH 4TSBH 4WU7B 1BD2B 1IVLA 4MVBC 4UNUA 4NQSB 2HFGL 3BJ91 5C0AB 3DETC 2G2RA 5H2BB 1WAAE 2PYED 3HMWL 3OXRA 5BO1L 5F1IA 2I60H 3VW3H 1U9KA 1JVKA 1XGPA 3KPSE 4LSTH 3RDTB 3DX7A 3UTSB 2Q76A 1FZKB 3IDYC 1UXSB 1UKQA 4O51B 4NN5B 2VLKD 3NPZB 4X80L 3UYPA 3PV6B 4OT1L 5I1IL 3WD5H 4XXCC 4Q9RL 3LN5B 1U58A 4D2NA 2F54B 5GGSY 3ARED 4H1LG 2V7NA 1U8IB 4JQIH 5E8NA 2VZOA 1X5ZA 1FBIL 5EUOA 4OCSH 5IB4A 4JFFD 4RNRA 5E8OB 4HG4K 5DFTA 4YDKL 5C0FA 3MV8E 4X4XB 1LP9F 4M6NH 5ACZB 5JO5A 1C5BH 2ZUVA 3H9YA 4WCYH 1A3RL 4HUXA 5EPMB 2CH8A 2Y1VA 3JWOC 2BNRD 5IFJB 2W9LA 4I0PC 5SV3A 3MLWL 3R1GH 4NJAH 1K4DB 1NAKL 1QRND 2A83A 3O4LE 4F7MB 3I75A 5ADPH 1D7FA 1K9TA 1UXWA 1MCIA 3MRKA 3OR6A 1PKQA 3OJVC 4X5XB 4HH9A 1J8HB 1G0YR 1A3LH 4ODUA 2YXFA 4Y5VA 4U6HB 3SGEI 1SJHA 3H9SD 1OAYH 3SKNA 3HG1A 3MO1B 1U6AL 4XVTH 3TBYB 5BW7C 1MJ7H 1XR8B 3TO4C 3HPJB 5AWNH 2ESVD 2M1KA 5K9KB 4L8DB 2AEQH 4XC1H 3QR2A 4HS8H 5EBWA 3AY4C 2P1YA 4QRPB 1VCAA 4FZEH 3TBTB 1I1CA 4ZTPH 2ATKB 3LKSB 3HC3L 4Q6YA 4KJPD 5DD6B 4QHLB 4HIJB 2GJZA 1DQLH 3OXSA 2AEQL 5IJKC 4UIMB 4KQ3H 5DJ0B 5D7LA 1XR9A 3LDBB 5ESQA 2R69L 3MV7D 4NHUA 1A1MB 1TZIA 2E8ZA 3IVKA 4Y2DB 5DVLA 3P2TA 3CVHB 2HFEA 1E6JL 3F12B 3LQMA 1KTLB 1F6AA 1YC8A 2VLMD 5I1CL 4LLUB 5CZKA 1MNUH 1KT2B 2ADJA 1DBAH 3FAWA 4PJHB 5E2TL 4URTB 1BJ1H 4HWUA 4F8QA 3P0GB 3DX9B 3F7VA 2X44D 3SKUD 2SEBA 4PJGA 2W07A 5SWSA 5J1TC 1HH6B 1P5VA 2I07A 3MRLA 4JRWA 2EEAA 1CS6A 3ROLB 4BELD 2JJTC 1OQOA 5DDHA 1OAUH 3DX7B 3UTSA 4EN3D 1BBDL 1OM3L 5LJYH 4GSDL 2VXTL 3VXME 3FJTA 3RY5A 3GDBA 5C0DB 4FQHB 2D4DA 4P0DA 4HKJB 4XCNB 3U2SA 5FM5M 1AKJA 1NCBL 2EH8H 4JPVL 3QEQE 3QUKA 1L7TH 4H0HB 3KNBA 1LO0L 3D5OF 1H8NA 1ZLUH 3BPLB 3SDXE 2P5EA 1UJ3C 4CMHB 4EI6A 3RKDC 2YPLA 4Y2OA 1E4XL 2ICEA 5F9WB 4KH2A 3AREC 5IEKA 2O61B 2V5RA 3TFKC 3P4NA 3I84A 1ACYH 2MNUA 1WAAA 5HHNA 1R3LA 4U3HA 1YY8A 1RJLB 1F2XK 1QFWL 2YN5A 2BSSB 3QQ9C 4JDVA 2F53A 3ARDC 2G75B 4A2MA 4H8WH 3L5HA 4KXZI 1FGNL 3QHTC 4BA8A 5B39A 1B2WL 3VXRD 3F7RA 4CU7A 4EVNB 3NGBC 2IBZX 1CDHA 4FRWA 4NKOB 3WN5B 3LD8B 2AEWA 4ZFZB 3MXWL 5M95B 5HGDB 3BXNB 1D5BB 4TULL 4LSRH 5D71H 3W0WB 4HIEA 3BKJH 1MI5B 4PB0H 2BMKA 3UEZA 4LGPB 3KYNA 2GTWA 2E9BA 1GIGH 1QVOB 1MIMH 2B5IC 4U1HB 3AM8A 1DQMH 3AXLA 4HQQH 5ANMB 5KJRH 3MRIB 1YMMA 4LNRB 3U79A 2HJKA 4GH7B 4LAJH 4YWGL 4LMQE 3UDWC 1TJHH 4EIZC 1Z2KA 5T33H 4WU7A 3HMWH 1A7NH 2GW5A 2J12B 2Y06H 4NHCL 3G9VA 4HKXB 5KAQF 5GRUH 3CX5J 3OXRB 5KOMC 2R4RL 5SWQA 4OZGE 3MUHL 3VFSA 1UM4L 2J88H 3WEXB 3WNNA 3QDME 1T03H 1FNEB 4RISH 3WFCH 2C4FU 1NLDL 2O5YL 2C1OA 4BZ2L 3KR3H 1S7WB 4ALAL 1RIVH 2E8YA 2F8OA 4IDLA 1C1EL 4LLDB 5IQ7H 4XNMA 2Y9RT 4N9GA 4UV7H 1CXLA 2EDEA 2AKRA 2VMFA 1A6ZB 2YRPA 5DJ6B 3ARWA 3ULVF 4KJWC 3P77A 3H3BC 4YXHL 1XGRA 5F7EL 4LDOB 4P2QD 4OAWB 2PYEE 4PTTB 4X7TA 4FQXA 3DGGA 3TBWB 4LIQH 4PJIE 2QADD 4XVSL 3FFDA 3HUJB 3HCVB 3EYFB 2VLKE 4GKNA 2B0SL 4WUUB 3ARGD 3UAJD 3TA3C 1LE9A 1PKQB 1BEYH 4I8DA 4K7FB 4MAYD 4X5XA 5FHBH 3RBGA 1FO0A 2AV7A 3FO1A 2F5AH 1AIFA 1I9IH 1VDGA 4HFWA 4ZG1A 1T04B 5HPOA 4ZO9A 5I1DA 2IH1B 1KG0A 3QFJE 4JZNB 1U8PB 1AY1H 4HH8A 1U8OB 1QSEE 3FQUB 3G9AB 4WUKL 2J8UA 3CGTA 1GZQA 2GAZB 5BS0A 5BXFA 1HH6A 4ZPVB 3KPSA 5HDOA 3F6LA 1A7OL 2R1WA 3DROB 5HXMA 3L1OL 1I3RA 2VLRD 3OG4B 3EHBD 4X99A 3CVHL 4RA3A 3WS6C 4RDQF 2AQ3A 4PGBB 4G43A 1UM5L 3HRPA 5F72S 1F42A 3VGAC 3U4AA 3BN3B 1HNGA 2QQQA 2X1QA 4P48A 3VXSE 4XCNA 1ORSA 3P0VH 1DDHB 1D6EB 3MLUH 4UV4H 3OXSB 3SY0B 1LP9E 1LD9B 4NRXA 1YNKH 4PJEF 1U91B 3WNOA 1MELA 1FCGA 1SJXA 3P9LB 4FTVE 4XI5C 2XICA 1QBLH 5INCA 3VFVB 3UTPD 2BOBA 3H7LA 2PCPA 5JOEA 3DOSA 1UYWH 4G8GD 3DMMB 1MLCA 3DIFA 5JA8B 5CP3A 3JZ7A 1EEUA 3ZHKA 5FGBA 2I25N 4Z7NF 4JG1H 3ZDYE 4P46B 1WC7B 4IOSD 1H3TA 2Y23A 3QEUA 2WZPD 2IWGA 5L2KB 3U46B 1T83A 4XP1H 1LEIA 2FL5A 4NQUA 1N6VA 1RUKH 1X4YA 4JG0H 3L7FB 5HYSB 1LHZA 3CSYB 3BP7A 1AJ7H 3VFSB 2XN9E 3RL1A 1OAKH 1YEEL 1L7IH 5J9PB 1Z6JT 2F53E 3DGCR 4ZUSB 5C0DA 2NW2A 4NBXB 1FHGA 3C6LA 3QI9A 5TDPA 3MV7E 1T5WB 4Z0BH 4EUPA 4FQQB 4YHIA 5HHMD 1B6DA 1AKJB 2EH8L 4QY8A 1ONQA 3VRLF 5EU4A 2VDQL 4KPHL 3U6RA 1TQBB 5AEAA 4KTEH 5EIIA 5BRZA 3TIEA 1KLUA 5EG6C 4HIIA 4H5SB 5D7SH 3BDYH 5DJZB 1IAIM 1I1AD 3HI6L 1JUFB 1PG7L 4NRYB 4QOKE 1RMFL 1PY9A 2VO5A 3JV6A 3FZUC 3IS0X 4PJ8D 2QHLA 4H8WL 1MHHA 1AFVH 1F3DH 4HHAA 4X7EC 1F00I 4PJEB 5IV2A 1BJ8A 4XNZB 5L2JA 4OLUH 4HV8B 4QRQA 4NRZA 5DJ0A 4TSCL 2ICWA 1T66C 5HPMB 1P53A 5KW9H 4Y2DC 3S36H 1SBSH 4M7KL 4FG6C 4FNLL 1ES0A 2VDRH 3VD4A 4LCYA 2ZSWA 4NNXA 2J6EA 3LMJL 4YBLB 5EC2B 1YECL 3QO1B 4UINL 2OI9B 3GMOB 5JZ7D 2IANE 4LCWA 3WNMA 3P11H 1CF8L 1A8JH 2HP4A 1ED3B 4NP4L 1DFBL 1T2JA 5CBEA 4HJGA 1XF2B 3BPNC 1J1PL 4EBQL 4YDLC 1L6ZA 4KKCC 4XNUL 3QXUA 1M71A 4NSKB 5D93B 3QDGD 5EU5A 4KKBC 5H35A 3ECBB 2ERJB 3MBEC 4MS8C 4PRIB 5KVEL 3TEUA 3SKJL 3QUKB 3EYQD 3EO9H 3BDBA 2BRRH 1WIUA 1WZKA 2AJ3A 5JXAL 3BISA 4QXWA 4FZ8L 4MNQA 1WITA 4PJ7B 2FX8L 1BVLB 1B6UA 1QSVA 1AGCA 3U0TB 3MJ8A 2Z92A 1C5BL 4NKQB 3T0WA 2NY6D 1DQQA 3QZWG 1T3FB 3O6LL 3O3EB 4HT1H 5DRWB 1JIBA 3VI3F 3LS4H 3MLTA 4LSSH 4WW2F 2VISA 1J05A 4LGSB 3PNWB 5MEQB 1XGQB 3A0OA 3GI8L 3UJJL 1OGTA 2CRZA 5CMAA 3Q5OA 4O2CA 4NQCA 4B5EA 4DVRH 4LLMA 1B4JL 4JRXD 2BVYA 2YBRB 3KVQA 2IAMA 1X5AA 4K23L 4HUWA 4Y19B 3P73A 5D7JD 4CVXB 4NQEE 4WWID 3BXNA 4NO0B 3CFBB 3QIWC 3DGGB 5E2UL 2ITCB 3MRDB 2K1MA 4Z7WE 1JN6B 1SYSA 3IF1A 5IVNA 1KJMA 4FQXB 1DE4A 3T3PE 4HPOL 1KTKE 5D2NC 3W2DH 4CN6A 1QLFB 3QNXB 4MHHG 1YZZA 4CMMB 5GZOC 2NR6D 3VGGA 4P5TC 4NWTH 1NBZB 4N8PA 2D9QB 3FHAA 3O8XD 1W72A 3TVMA 1MVFA 4PRBB 4KHTH 3PF2A 2BJML 5FGSA 3DMMA 1EGJH 4Y4FB 4LCCC 4KJQC 1WZ1H 1PSKH 1FVEB 3RY6C 2PTTA 1LO2H 2EDQA 5LXGH 5D1XB 1X9QA 2HTLC 2WP3O 2JELH 3BAEH 4N0FB 3LRHA 1HK6A 4LKCA 5FUOL 4R96A 3N1QC 5FK9B 3T3ME 4KUCD 5KSUA 3PWLA 5HI3D 4NC1C 4PJDA 1KCLA 2D0GA 1W8NA 2ZCKH 3GSOA 4C55A 4JO2L 5I1GH 5I15L 2DQTL 1Q0XL 4OF6A 1MFEL 2MQCA 3VCLB 1S9YA 1XT5A 12E8L 25C8H 5F6IB 4MJIE 4NCC2 5KTEH 4JRYA 4GAJL 1HSAB 5DVKA 2CSPA 3LDBC 5T1MB 4IMKC 1MF2L 2CIKB 1QFUH 4M43L 4PBXA 2EIBA 3QZWA 2IEPA 4P2OA 3V5KA 4R4ND 2AJSH 5DJ2A 5DUML 1WTLA 3MUGA 5EO0B 3GKWL 2K9UA 4I18C 4BM7A 4X6FA 5DI8B 5L9DH 3MOBH 5D7IA 2NY0C 2IAMD 5C0FB 3QUMA 4PTUB 5EZJB 4FQXD 1QR1A 5GPRA 3C5SA 5BZWA 5T1DH 1A6UH 5I17B 5T3ZE 2R9HC 4Z7WF 2VL5B 1FG9C 2Z31C 4XPGH 3NIFE 3ARVA 1INQB 4MDJB 3ZMRA 2DI7A 4RGMB 1YMHB 4P23D 4XXCA 3VXOB 2A74A 1T1YB 4LVHC 3BIKB 1P7HL 4K9EC 3X3FL 3X3GH 4E5XB 1T1ZA 1Z9LA 3RWJB 3OF6D 5IHBA 1BECA 1ONQB 5C07A 2APTA 5JW5B 3CVIH 3FQUA 4YE4L 3Q6GH 5DJ8A 1PZ5A 3GSNA 4N8CH 5CIPB 1XMWA 3EYSL 3DI3B 4M1CC 4P9HL 4QXUH 5DVMA 5GZND 3QXAA 4ONHB 5HHOB 2KL6A 4KZEL 2EXWD 2J6EL 3GIVA 3AMLA 5IF0B 4KK8C 5CJBA 4G8IA 2APXA 3WDHA 2VYRE 4NNYA 3K0WA 3RL2A 2VDOL 4PGBA 1EZVX 1DANT 4P9HH 4KKAC 1ZVYA 1KJMB 3EOTH 1EDQA 2VLJE 3I02B 5GSVB 1D6EA 1V7NH 1YMMD 4Q0XH 4LCUA 5C2BH 5EOQL 3E6FA 1MFDH 4GBXD 1FO0L 4OCRH 4OM1L 1LO0H 2XV6B 4UNVA 3HZKA 3GMMA 3UZEA 1YEDB 4F7TA 4ORGA 5KOVC 2Z31A 4LLYA 4M7LL 4JY4A 4F8TA 2YRZA 1N64H 2BVOA 1R5WA 4N0YH 2YR3A 4OCRL 4QOKD 3VWJD 4Z95H 3MV9B 4PRAB 3UZVB 3U4BH 4D0CB 4L9LB 4M8QB 3UPRB 1WCQA 2QQNH 2VLLB 3MRBA 4J3TA 4MWFA 1MCEA 2YD5A 3ARYA 2DQHL 2CJUH 1JI2A 2KBGA 2YXMA 4XVJH 4IBLT 4OLWH 2QSCL 2B1AH 4I18A 4MXWH 4TUJB 5ITFB 3RQ3A 1GOGA 4E42A 5C1MB 3SOBH 3A6BL 4P2OC 3MFFA 3L3OB 5ACMA 3RTQD 3QWRD 4LVOC 2EXYC 2VDKH 2QV2A 4XNXH 4U0RC 5IMKA 4PJ9B 4C4KO 4AIOA 3GBNL 5GJSH 1UA6L 2UY6A 5E8OA 1CLZL 1HSAA 2QQLL 5EU4B 5BVPL 1KJVB 4OCYH 3CFBA 3G6JA 1TTUA 1C7SA 3QFDB 2AJ3B 2HRPH 1CR9H 3SDCD 2WLYA 3IVKB 4D0DA 1CFQA 1KB5B 4Z7QF 4PREB 4YDKH 3E3QE 2XG5A 2DAVA 4UV7L 5JHLL 3BQUB 2YMXH 3O9WC 5JXEC 3LSOA 1M6OB 3ARXA 4QF1A 1NGYA 4G5ZH 1DL7H 3DXAD 4DK3A 4KGJA 5TF0A 2RAMA 4Y0GA 3QI9D 3NCEB 4JZOA 4LLVA 4LQFL 5CEXA 1X7QB 3UPAA 3WFEL 1UEYA 2F53B 3D0LA 3FB8A 5IR1A 4YPGB 4W6WB 3RGVD 3CH1A 3DMMC 4UBDD 5AYQA 4OM0L 7FABL 1ZS8A 4UB0L 4L4JA 2XNAB 4NZUL 1OAYL 5F3HB 4Q6IB 3BH8A 2MHAA 2DD8L 1F90L 1MUJB 2EXYD 4GXVL 1C7TA 4S0TD 2CXGA 3GK8L 3KLHD 2NLJA 1BFVL 1M05A 1FH5H 2BK8A 4PJCF 1U2CA 2VDML 1MFNA 4Y19A 2DWEB 4TUOA 4OCLC 4N1EA 2ZJSL 4OV6F 5EN2B 1AD9B 3ES6A 1S7RA 4HK0A 4U1IA 4N1CA 1FZOB 1YYLH 4FZEL 5D1ZD 4ZNCD 1HSBA 3QDHA 4BZYA 1KIRA 4CGTA 3C2AH 2VXVH 3JWDH 4HUMB 5D7LD 3SDAC 4U33A 1ZE3C 2F74B 1PDKA 3S3SA 4ZDHB 2NX5A 1YEIH 4JFDD 3SE3C 5CHNA 1CICA 2R0ZH 1R24B 1DVFD 2Z0BA 4PRNB 3BQUD 5F1NB 3T4YA 4MJ4A 5FO8B 4ZPTB 3SE8H 3RNKB 4QNPF 5JW4Q 1BVLA 1BZ9B 4OLEA 4QRTA 4G6MH 3VXQA 3PABA 5EO1B 3PWLB 1J0ZA 4PJIF 4X98A 4OFKA 4R97B 1KB5H 1NCDH 1IM9A 4LPUA 1LE5B 3MRJA 4ONOA 2Q8AL 5JR1L 4NZDA 5C0CA 3B6SA 5DRWA 1QFUL 1KB9J 2M2DA 3O41A 1J10A 2NZ9D 4M43H 4TTGA 2NY2B 3OKEB 2CDEB 5LBSH 1U93B 3KPQA 4X7DC 3RWIA 2BNQD 3HAEB 3VH8A 2HN7A 2DMKA 3TNNB 5IHZB 3JWDC 2GHWB 1J8HE 4DN4L 3ULUE 3CXDH 4H26B 3T4AB 1N8ZA 4Y4HC 5GGQL 2PYFB 4ZXBA 5ICXA 5E08L 2YPLD 4CVXA 2Z93B 1H15A 1JWMB 4QRPA 2N7AA 5DA0B 4YAQA 4JKMA 1VADA 2DQIL 4D0DB 1DR9A 3WIHA 3KPSD 2KKQA 2MOVA