3AY4C

Crystal structure of nonfucosylated fc complexed with bis-glycosylated soluble form of fc gamma receptor iiia
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
170
structure length
160
Chain Sequence
b'LPKAVVFLEPQWYRVLEKDSVTLKCQQWFHNESLISSQASSYFIDAATVDDSGEYRCQTQLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVQITITQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
molecule tags Immune system
source organism Homo sapiens
publication title Structural basis for improved efficacy of therapeutic antibodies on defucosylation of their Fc glycans
pubmed doi rcsb
total genus 32
structure length 160
sequence length 170
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ay4C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ay4C02
3H9SA 2FJFA 1QEWA 1VHPA 4GAYB 4HKBB 4JGJA 2ZOKB 3E2HC 4Z0BH 3BQUC 4PJ9B 3R4DA 5DFVC 1BF8A 4R96B 2FBJH 1FNEA 2B2XL 1NKOA 1PY9A 3EGSB 5C7XL 4Y8AA 2A1WH 4LIQE 2GT9A 5KVMC 4U6VH 4Q9BA 4OI9A 5IMLA 2IBGA 3IJHB 5ACMA 4E9LA 5HYSA 3CFJB 2JB5L 4UU9A 5FV1L 3SE9L 5L0QB 2Z92B 3BE1H 3VA6A 2VZTA 1QSFD 5JXEC 1VPOH 3S5LB 3VFVA 3GMNB 1JZ4A 1DQLL 2VLKE 3OJDA 4GQ9H 5FUZH 4LIQL 5C6WH 3NPSC 2DN7A 2Z8WC 4ZDHB 4MAYD 2BC4B 2YD6A 4WTWA 4P46A 3HI6H 4J12A 4U1LA 4NJAL 3OKYA 5C2BH 1KCVH 5A2LH 5GRJH 5JTWA 4KI5E 3IRZA 5JQ6H 2G2RA 2ILLA 2YD1A 5DWUH 4IRSB 2VISB 1NL0H 2AV1B 2JIXD 2I9TB 3HZMB 5MP6L 2XTJB 4P3CL 4K94H 3ZDZF 2NY5C 4ZFOL 3MYJA 4LEOA 2ICEA 1A1OA 4YAQA 3ES6B 1OAQH 4MZ2A 1G7JB 4O2EB 4ODXB 1GIGH 4M48L 4NO0B 5CBAB 1WBYB 2RCSH 5DUBA 2P44B 4WW2C 3B9DA 3W81A 1IRAY 2D7PA 1CE6B 3IXTA 4LLMB 4RA3A 4L4TE 2XKUA 5D1QD 1ZV5A 2FEEI 5DRXA 3DX7A 1AD0A 5I1HH 2PTUA 4ZOCA 1IM9D 2ZJSL 1CFVL 3QJFB 1DQJA 3L3KA 1FYTA 4FFZL 2VL5A 4ZXBC 5C0CA 3FFCE 4OGXH 2NLJB 1P4BH 3EOTH 4QNPE 1KJMA 4NUJB 1K3ZA 1BZ9B 2V7HB 4ZQKB 1LMKA 3GRWA 1X5JA 3GKWL 3QUYA 4P2RD 1U8PA 2HFFB 5E7FA 1CFQA 3KYNB 1ZA6A 3BKJL 3C2AL 5E03A 1KF9B 3SDCD 3BXNA 3DURB 4Y5YC 2Z35B 4NDMB 4RISL 5E7BA 1N0XL 4IRJD 3OB0K 4EOWH 3QHFL 3TBSB 1F11A 1XCQA 4YHZH 2ESVB 2F19H 4JANA 2PO6D 4OD3H 4XRCA 5HVHB 4LF3A 5LQBH 3C5JA 4N0FA 5KSBB 2E7LC 2VXQL 1JZ7A 1ZT4B 3ABZA 4WUUE 4P2OA 1SVCP 1TZIB 4QCIB 4OT1L 4YO0B 1IAKA 2AKRB 3FB8B 5SWZD 4HIIA 4MNGA 3LOWA 1F3JB 1ORQA 4YPGB 2QJDA 3ILPA 4OI8A 3T3PE 3GEWB 1S7WA 3UBXG 3RTQB 2O5XL 3B6SB 2RB8A 4G8GD 3U4AA 4YK4B 3OKNA 5C0JA 3BPLC 1Q94B 1WV7T 5AZ2H 2A77L 5I16A 2YOCA 4YBQC 2UVFA 1TFHA 3PL6D 3OG4B 1T7XA 2ESVD 5ADPH 3WDJA 5F88B 1G7LB 1EEZA 1LK2A 2CDEA 5JZ7C 4OV5A 1Q0YL 4LQFL 1I8LC 1FGNL 1JIBA 1Z9SA 5DUMH 2Y5TB 3L95B 4H88L 2A6IA 3VFSB 4WHYG 4R6UA 3MV7D 4XMLH 4PLKD 4DW2H 1CYGA 4X4MA 3EOTL 3K8KA 4G80B 3LRSA 1S7QA 1FJ1A 1V3MA 5F7KC 5MENA 2O5YL 3FB8A 2Z8VC 5ALBH 1T3FA 2DLEA 1MWAH 1JTTA 1G9MC 1TZIA 2CIIB 2GUOA 3ILQD 3OR6A 5BS0A 1FBIL 1FIGH 4OFIA 3T0DA 5KSBA 4AENA 3HE7D 5E8PA 2X6MA 1AGFA 3KPSB 3L9RB 2DI8A 5IWLC 3PWJB 5L8KB 3EFFB 4W4OA 1XCQB 5T33L 4OLXH 3VWJD 2BFVH 1LDPH 2XN9A 1RIVL 3DSFH 1H3UA 4BK5A 1XGUB 4NC2B 4OGYH 1K4DA 3DIFA 3NIFE 9CGTA 1A7NL 2NXZD 2DLIA 1CFQB 2WK2A 3V5HA 2CRZA 1U8QB 1NL0L 4R7DB 3RL1A 4PRHD 1SMAA 3QH3B 3I50L 2BSED 2FCBA 3F5WA 4ORZC 2AI0H 3DMMD 4M5ZL 4PJ5B 1RV6X 2DDQH 1A2YA 1FL3B 1ORSB 2VLKB 1HIML 3RY4A 5LJYH 3L3KB 2I25N 3TT3L 4GKSB 4I18B 3M1BB 1RSFA 2A9ML 5DRXB 5I0ZA 1PJ9A 1QFUH 4XVSL 4K3JL 5E2WH 4Z78B 2RHEA 4PJDE 1CE6A 4LLMA 2X4OA 4JPVL 4NUGH 4NQVB 1BIHA 1RUPL 3S3SA 3DETD 2X4SA 3L7FA 4NC1C 4ODXA 1MRCH 4PYGA 3ES6A 2PYEA 3IGAA 1DLFL 4NJ9L 4HT1H 4ERSH 3HZMA 4F7MA 3HB3D 1IC1A 1V3KA 4RGNB 2V2TA 4XBGA 5D96B 4GRMB 3EYUH 3VFWA 2G2RB 1KT2B 5J13B 1WT5A 1RZKC 4KRMB 2PXYC 3E2HB 1CVSC 1IQDA 3OWEA 5DMGD 3DHJA 5CD3B 4KJWD 5JXEA 2YZ8A 5CHNA 4ONGL 4HIEA 1R3LA 4GG6F 4AZ8A 5BMFH 2R1WB 4WO4A 3SEPA 4F3FB 4C83A 1P1ZA 3RWGB 3RZCC 3V6OC 1FL5B 2VIRB 1IGJA 3FB6B 3EW3B 4MJ4A 3GMNA 4RFOL 5HYJE 3JV6A 3RY6A 4YIQA 2Q7YB 2A6KA 2XA3A 3DVGB 4GW5A 1JF5A 1JNLH 3CFJA 2KQMA 4FABH 3H9YA 3ARGD 3K0WA 2A0LD 5LGKA 4NQEB 2WINB 4JO2L 5J4MA 5IB1B 1D5MB 1ZA3B 3CLFH 1T6VN 4KQ3L 1F2QA 5E5RB 4OZHF 2ITDA 5F6HI 1RIVH 3DSFL 3MOAH 1D9KB 5GRVK 1MCWM 4PRBA 3HRZB 4LLYA 4F33A 2W0PA 2ZOKA 4WIQA 1QEWB 2EIDA 2F19L 1A7OL 3C6LA 5FUCC 4Z77B 1Q72H 2YN3A 4PJCF 4U6HB 1UH4A 2D7MA 1XGTB 1GC1L 1NDGB 3FTGA 3IU3A 3U48A 4JFEB 3UJIL 3VXUE 3C60D 1XFPA 1LP9E 4P3DB 1S7UB 1XGQB 2HTKD 1CLZL 1OAYL 1NGWB 4OM0H 3VD5A 3V52L 4JEGB 3BGMA 1T04A 1IGIL 2EDNA 4LEXH 3VRIA 5TPWL 3HNVL 5FKAB 1IAMA 3QDJA 3QIBB 3HE6D 2UY7A 2OCFD 1C5CL 1D6EB 1AO7D 2NXZC 3CH1B 3QA3B 2N4IA 4ZPVA 5FUZL 5CEZL 1RUQH 5TFSL 3JSSA 4G3YL 3VG0H 4JPVH 4NUGL 2GY7B 3HI1A 1DEEB 1UWGL 1LP9B 2C3XA 3FRPG 4H8WC 4K7PH 1I4FA 2F74A 1FNHA 2W38A 1NGPH 4XCNB 1BBJB 2PYEE 4MJ2A 1J1OL 1HHHA 2AXFA 4FZEH 4YR6A 1TZHB 3LIZL 5HD8C 1I7RA 3D39A 1QSFE 5ICXA 2J8OA 5HYEA 4QRTA 1CR9H 2VLKD 2JJTC 4D0BA 4L4TA 3D0LA 1AQKH 1JGUL 5BZWA 5JQHC 3PHOA 1AXTH 4JDTL 4LSQH 3PWNB 3ZE2F 1JZ6A 2FZ3B 3H6JA 5GZOC 1EEQA 2F54A 4CW1B 1L7IL 1ACYL 2ZCHL 5KOMC 1TVHB 2JK5B 4MWFA 5EN2A 4OB5L 3MUGB 4LVHC 4PRIE 2BVTA 3DUSB 2CGRL 1WT5C 4XCFH 5A16A 4Y0GA 1NAML 1OT1A 2Z4QA 1M6OB 1NC4D 5CWSA 4KQ4L 4KKCD 2MQCA 3ULVH 3GIVA 5DJCB 1MI5A 2G5RA 3HG1A 4DFHA 4OZGF 5TF0A 3T8XB 5I8CB 5I30L 1MOEA 4Z7VA 5T3XL 3CFEB 3RZCD 1CLYL 4NNYA 4B5EA 5D7KE 1FO0A 3THMH 5H8DA 4HXAL 3KXFE 1X5LA 2Y4SA 4PG9B 5FA4A 4L29A 3VRLE 5JDSB 3AGVA 2NNAB 4FNLH 4PBXA 3BPOC 3D2UD 4UV7L 4AIOA 4NKOB 1TCRB 15C8H 2X7LA 4XHJD 3L5HA 3TLRA 5FFLA 1TZGH 1IC4H 3O3UN 2FGWL 4TQEH 5EFIA 4FTVB 1I85A 5B38A 2W0KA 1FNSL 4QRUB 4RQQA 4YPJA 5D2LE 4QHUB 1JNNH 5E00B 3P30H 3LH2H 1BAFH 1MNUL 1FYTE 1CLOH 1LEKB 1LGVA 3PL6B 3WV0A 3RBSA 1LHZA 2ZNWA 3C6LC 1WCQA 4KMTH 4OUUB 1R0AH 3STZA 3O6MH 5IMMB 3UJTL 1U3ZA 5I71B 1X5YA 2CQVA 2OMBA 5IWLA 2EZ0C 4L9LB 5CSZA 1FG2B 5MERA 4P5TC 1CGWA 4OQ1A 1HCVA 2YEZA 2NX5E 2FJGB 3QFJB 2FSEA 4HG4J 2A73B 2X1PA 3HNTH 5T1KA 1T20B 5K9OB 2ARJB 2W0FB 1QACA 3ZYZA 4CMHC 1E4WL 1MPAL 3HI5L 4C4KO 4NJAH 2VLRA 3DX9A 2CO7B 3HAEG 4F7TB 4Y5VA 3U0WL 5A40E 1OGAA 4O2CB 1LO3H 2OTUA 3PGFH 3O4LA 5B4MD 1TNMA 1M7DA 1NANH 4KV5F 4I9WE 2P5WB 1E4KC 4G8GE 2VLLA 2XT1B 4P2YA 4LPUA 3KWWB 4Y16C 4XAWH 3BKML 5F71A 2VDML 1S9YB 1JZ8A 4AIZA 1ED3A 1XGYL 3NZHH 2ZUXA 4H26B 1BFVH 2C3VA 3G6AB 4EDWH 4RNRA 5DS8B 5IFJA 5C0DB 3BI9X 2XN9E 4LNRB 5GS0C 2IAMB 6FABL 3EUUA 3LN4B 3QSKB 4IMKA 3GZKA 3I6LD 2O26U 1UWGH 2GJZB 3WIFA 2APFA 3LY6A 4OIIL 4YHNA 5ENWA 3UPRA 2BVUA 4MAYC 2A74B 2IPKA 2BNQA 4PJCB 3FQWB 4XTRC 2NX5D 4OAWA 3W39B 1AP2A 5F1SA 1B0RA 2QL1A 1G7MA 3RIAK 5C0ND 1TPXB 3VD7A 3BVNA 3HNVH 4X6DE 4D94A 4KRPD 4K8RD 4FA8A 1QLFB 1ZKAA 4GKOA 2H3NA 3KYKL 3P9LA 3ULVL 2YD2A 1BM3H 3PWPD 1XF1A 4LHUA 1PKQA 3N1FC 4RFEB 4CN6A 5M95B 4BH8A 4PG2C 4WU7A 3VG0L 5ERWB 3ZE0F 1QA9A 3QG6B 3V2AR 4TRPH 2G75B 2X4RA 1EERB 2VZUA 1QFOA 3JTSB 4YDKL 1YNKL 1RHHA 5F7YC 2VXQH 5DRWA 1S8DB 1AH1A 5KSBE 2WLZA 5GGUA 1BWMA 5J57B 2D03H 4XZUB 5FYKU 5J6GA 3MJGX 3P73A 5GGRB 4CVZA 5IJKA 1FL6B 2EDLA 3V6ZB 3U7YH 1TJHH 3LRGA 1FNFA 1CT8B 1QP1A 3MV7B 4AEIL 4AEFA 1JK8B 5JMOC 1B0GA 4KK5D 3T0EA 4Q0XL 5CEXB 1VGKA 3QEQB 4U3CA 1OVZA 3B3IA 1KCLA 1F13A 4Q58C 4F2MB 2D3VA 4M3KB 3ROOA 3L3JA 4UQ2B 3CFCH 1V7MH 1BJMA 4MA8L 4JFED 3DI2B 3WXWL 3O4LE 1HDMB 2DWEB 1Z9OA 3VG9C 2IQAA 3EYFA 2IQ9H 4GS7C 3IDGA 1CU4H 1U8OB 4OFKA 4GG6B 3ALPA 5C70A 4F57H 3AFLA 5D70H 1UFUA 5DVLA 1QPXA 2H1PH 3HS0A 4M7LH 3RA7H 1T4KA 4QXTA 3PWPE 4V1DD 4M8VA 5JIKA 2ENSA 4JREB 4YFEA 3ARGB 5TH2B 5D93C 1IEAA 3F58L 4Q0XH 1JV5A 1UVQA 2OTWA 1CDUA 2EO1A 2VXTH 4EN3A 5HYFA 1A7OH 3R06A 4DEPB 2CR6A 3RNQB 1LO4L 1XIWA 5FDYA 5IQ9B 3WFHA 3AMKA 3ZYOA 5MHSD 4HAGA 3QDJE 4X6EB 5GS0H 4XPHL 2NY6C 2XFXB 1KV3A 3ZE0E 1J5OL 2B20A 1LO0L 3FB7B 1VKXB 5IB3A 2ZWLT 3LD8B 4TUJA 2E6PA 4BQ9A 1CU4L 3DWTA 3LH2L 1KBGH 1QG3A 4FQJL 3BUYA 4PJEB 5MI0B 2XZAH 3MV8A 4L8SC 1RZ8B 5JW5A 4MNQE 1MUJA 4BKLB 1T66D 3STLA 1KNOA 4FG6C 4HKXA 3ZTNH 2ZUUA 5FK9A 2OSLA 1CFVH 3WL9A 3C8KB 1AD9B 3VA2C 4ZUTA 4NPYB 3I9GL 2EIBA 3VMPA 3S36L 2RCSL 3P3YA 2AAVA 4S2SA 3VXQB 1UB6A 4NN7B 2HJKB 3NVQA 1FNAA 1PZ5A 3TT1L 4CMHB 1U8IB 3LQAH 2QSCH 5F96H 3VFNA 1QLEH 5D7SH 5TJWK 4JFFB 1GGBL 4QF1A 3GSQB 3IT8D 3QISA 4LSUH 4NO0D 1TJIH 4POZC 4Y2DB 5IMOB 5HHNB 2A83B 4YXHL 2Q8AH 2CKBA 3TBVA 4KJYB 3H9HA 5TDOB 3H3BC 1Q9WB 3FOLA 2PW2B 1MHPH 1WVZA 3D3VB 3QUMA 3FQNA 2XG5A 4JVWA 2JTDA 3L3GB 3ZZ1A 2OQJB 1IGML 3SDAA 4ZTOL 2IGFH 5EA0H 3UXFA 5GIRB 3PWVB 3BKMH 3EJYD 3IXAB 4EUPB 2XY1A 3ZL4L 5I1KH 4V2CB 5D70L 2BNRE 3VXSB 4YDVA 4S1QH 3H2WA 4C56A 2YPVL 2VLJD 3G6DL 2BOCB 3QPQD 4QOKB 2XRAL 5B8CA 1FQ9C 4JG0L 2R0KL 5C8JA 5C08A 1VFBA 4GW4B 1DN0A 1V7ML 5D8JL 4TUKL 5DGQA 5T1LA 3DTXA 4XNUL 2FX9H 1WGOA 3E8UH 5SWQB 3JTTA 3BKYL 2P1YA 3WXVL 4M61A 4DKFL 2CMRL 5CZXD 2QKIB 5CJOH 5AYUH 1A7RH 5F3HA 1W0WB 5T3ZH 5CFHA 1IGYA 4QRPD 4UT6H 2UYLB 3OHXA 2QHRH 4G3YH 1HSBB 3ZMRA 3SGKA 5IKCA 1BP3B 3BPNB 3CMOL 3F12A 4BM7A 3ZTJH 4LGRB 1KLGA 2WUCH 5SX5H 3QUYC 1BAFL 1MNUH 3EO0A 3HC3H 4F7PA 2G5BA 4CAGA 4KZDL 4X6FB 2AJSH 3PDOB 1MCCA 4PJEF 5D7IB 1BFOA 3BIKB 4GBXC 2VXVH 5FYLE 3LV3A 4LSRL 1T7ZA 2OK0L 3KDMA 3EJZC 1T1ZB 5C0AB 1I3GL 4IOIA 4F15B 5HPMA 5I9QC 4XXDA 1MELA 2VJXA 3REVB 3MR9A 5GJTL 3MLSL 1I1AD 1HI6B 2C3GA 4HDIB 1B4RA 5E4IA 4KROD 1BZ7B 1MAMH 4JFQA 1IC7L 4LQ1A 2Q8BL 3MLRH 4CN1A 3HUJE 4N9GA 1NEUA 2AJXL 4DK6A 5FUCE 1OAXL 1OP9A 4PJHB 1HHKB 5D2LA 3GBNL 4WI9A 2DQDL 1OHQA 1ITCA 3LEYL 2ZUQC 5E8EA 1KB9J 3GMMB 3X14A 3BPCB 3ARWA 2J8UE 5F9JA 1G7QB 5EO0B 4Y5YA 2M8XA 4OCMC 1NC2B 1V8HA 1JHTB 4E0RB 3QJHA 4ODVL 1G7PA 1JPFA 4UILH 4HLZH 4R0LB 2A77H 3HC4H 3SE4C 3CFDA 2DLHA 4JAMA 5GHWH 3LMJH 3MV9D 5IVXA 3R1GH 4D9QE 3G6JF 1J8KA 4PJXB 5F1NB 2ICWI 3CSGA 3MA9L 3L3HA 5C09D 1J0IA 2YR3A 2W0LA 3CSPA 1AY1L 5DYOA 3QXAA 3PWLB 2OR7A 4OZFH 1I1YB 1YUHB 3CNKA 4MNQB 4KKLC 2IADA 3U30C 2VN4A 3PNWB 5BQ7A 3RWEB 1ZVSA 4OCRL 1TTUA 1J18A 1JMZA 3W5MA 5CEZH 1GOHA 2WBJD 4PJEE 1AI1L 2CLVB 1Z3GH 1CG9A 3QRGH 3BRGC 1GHFL 5AD0B 1LEGA 5ILTL 1CFSB 2DIBA 1CGSH 2XTJD 5JR1L 1NFDB 4PRNB 4JY4A 1AC0A 3U0TB 2YRZA 4K3HA 3MREB 3HNTL 5C3LD 1HZHH 3IU4H 4FS0A 3IDYB 5D71H 3NABH 4Z7UB 2MCPL 2A6DA 2H32H 5DJ0B 5EO1A 3QNZB 1MRFH 3HCVB 5IFAH 4FFWC 1CDJA 5FGCE 5DJ8A 3O6KH 1MRDL 1RU9H 5HVGB 4P5TD 5JO5A 3B9EA 2XXMB 1FDLL 2OJEB 4RMTA 4APQD 2D31B 2VERN 3OX8A 4K7FB 1FVCB 3L7EA 1OTUC 4H8WL 1BD2A 1FFPB 4PJIB 2W59A 3TF7C 4TULH 2XZCH 2ITCA 3QIWD 5LXGH 4QRRB 1X5HA 1DFBH 3QDGE 2FHFA 1NGXB 1RK1A 4N0RA 3KYKH 2JCCE 1S5HB 1ES0A 3BP4A 4GRLB 1SJEA 5ILTH 1DSFL 4TPRL 1PEWA 2FYYB 3WLWC 5IOPB 2XWJA 3NIGE 4PJ8C 1U41A 5A2JH 2FWOA 4M3JA 4XHJC 4R90L 1J5OH 5EU3B 1II4E 4LDLB 5DQDH 3NCJH 2R2BB 1DUYA 1F45A 3AREC 4D0DB 4ZUUA 4D0DA 4UDUB 1C8PA 3ARFD 4PGBB 4X5LA 4N90D 3WJJC 1RZKH 3ECBA 4H1LH 4HJ0C 3REWA 3ARSA 5E2UH 5JW4N 1DUZB 2VMFA 3U4EB 2I9LB 3NZHL 1GH7A 3QO1B 2FYYA 4NN6B 1R3JA 3ZE1F 3QEHB 2JJTA 1XGRB 4FQHB 4FZEL 5IM7A 1U92A 1DQLH 1YN7A 3VW3H 1S5HA 4G5ZL 4Z7VF 1B4JL 2YC1B 1UA6H 3CPLB 2NMSA 2ITCB 4NRZA 1EJOL 3MRBB 2NQCA 3UCRA 2IFFL 3KPOB 4DVRL 2ZZUT 4NSKB 4NO3B 4EIZC 3GGWB 2VAJA 3BAEH 4UUJB 2R0WH 4LRNH 3OX8B 5I1JH 1X4YA 5TQ0H 1Q0XL 2OP4L 4E41D 1IGMH 2I24N 4UNVA 2ZG3A 3CFKA 5A2FA 1T83A 4IDJL 1H9VA 1INQA 1FP5A 4X6BB 5MP6H 2Y23A 4I48B 2GQHA 2XA8L 3VH8B 5HD8D 4ODHL 1A3RL 1BQHA 3HCVA 8CGTA 1RZKL 5C07B 3SCMB 3MV7E 1U93B 3S37L 3CMGA 4Z7UA 1P84K 1G6VK 2ERJC 2F15A 3IFLL 5E5UB 3U0TA 1U3HA 1VFMA 3LQAL 5GJTH 5JDJA 3SE8L 2WMPA 4WWKD 3E3QE 3S98A 2DQCL 5D93B 2QSTA 3IFPA 4QRQA 1EGJH 4PTUB 3BISA 3WFEH 4NQXA 3I75B 5D1XB 5IHZB 1QSEA 1JMXA 4Q7DA 1ZVSB 4TPRH 2RR3A 1UM4H 1HH6A 2HTLD 3H0TA 3RTQC 3STBA 3HE7C 4O9HL 4CRPA 4IHOA 3UYRL 4TOYH 4PJBF 1J1PL 4JPKL 1DEDA 2YWZA 1QHOA 1CS6A 5GRZA 4NWTL 5D2NB 5DT1L 2KZWA 2IG2L 1IEHA 5DK3A 3FFCD 1FLRH 3QP3A 1EBPA 2Z93A 1WITA 4FQIL 3IFPB 4W6YB 4YLQT 5D6CA 4YEFA 4Y4HC 4L9LC 3L3OA 4ETQB 1FC2D 1MSPA 4HHAB 5I71C 1G7PB 1WICA 5L7XL 4L4JA 4RGOL 4J2XA 2XA8H 2R0LH 5HPOA 3EOBA 5F9JB 3QBTB 4JKPL 3PL6C 1A7PH 1NGYA 4B50A 3CDGA 4I2XB 3X14B 1NH6A 5GGVL 2P45B 1UCBL 5LGJA 2CPCA 2H2PC 3QDGB 4OZHA 4K3EL 4X6DA 5D2LB 1YPZF 5ICYA 3H3PL 3L6FB 5K9KA 3C5ZD 4JFFD 4MQXD 1JPGB 3DOSA 1YY9D 2NZ9D 3ZKQD 4MLIA 4XX1E 4JZJB 1IQWH 5D7JA 3SDDD 1CL7I 2DQTH 3ULVC 4I0PC 4XCEA 5C86A 2HT3D 5EU7C 2VLMD 3KPPA 4NKMB 1IZJA 3TBWB 4XXDB 1QFWH 5HPMB 5CJ8A 4LLQB 1NC2D 3RWCB 4OCYH 5FCUH 1MFBH 2J8HA 3BGAA 4YWGH 1A6PA 1GZQB 1KGCE 2BVYA 2C4FT 2DAVA 4OLUH 3REWB 3T2OA 3PABA 4KJPC 2CLZA 4WGWB 2MMXA 4XNMB 1H0DA 2LU3A 4HIHA 4X4XA 1ZLWH 5IP4A 3BH9B 1NFDE 2FHBA 4F7PB 1LK3H 5BXFB 5CZVH 2HFEB 4GUPB 2UY6A 4K7PX 1P7KA 1IKNA 1BQSA 4PRDB 5GGTL 4MA8H 4IDLA 1FV1B 3NCEB 1DDHB 2ATKA 2WW8A 5IR1A 3JWOC 3ARFB 5HYJA 5F97E 3ZO0A 3FFDA 5CSGA 5LCVH 2J8UB 4DUWA 2UYLA 5KW9H 4P4RB 1IGYB 4FRWA 3CLFL 5IOPA 4KTYA 1U8MA 5CJQH 5JHDA 1A0QL 1A9EB 1KCUH 4HX1A 3BQUA 3IDNB 3EO1A 1MAML 4HK3J 2WQ8A 3HUJB 3O11B 4QRRA 3FQXA 2AJVL 4ZXBD 3WD5L 5SWQA 5FHBL 1IKFL 3OAUL 4G9FB 1E27B 3K2UL 1D5BA 4UNUA 1MLCA 3IDXL 5GSVB 1ZLSL 3WJLA 1A6AA 2ATPA 4I0CC 4QOKA 1ZTXH 3QUXD 4BH7B 3WN5C 5EORL 3ARBA 1CCZA 4C56B 5T3ZE 1FVDB 1DBAL 3ESVF 1U8NB 1OM3L 5EOQL 4NC0B 3GKZA 1T22B 3QAZC 3SO5A 5GRXG 4P5TB 5EO9A 4CJ0A 4OKVB 4JRXB 4HMDA 4NNPL 4JG1H 3MBED 3MRMB 4WI8A 1ODAA 3ZSTA 2H26B 4L8BB 4JY4B 3VWKC 1PG7L 2VQ1A 5IT2L 3SDAB 1NCDL 1CFSA 4XCYB 1F4AA 2HJFA 3MV9E 3PHQA 4N0CD 1FPTH 4Y2DA 3LB6C 3E6FA 5CJOL 4X7TB 5CS7A 3WXWH 4Z8FL 3U30B 5IV2A 3HC0A 1W72H 3IJYB 4RAVB 4TTDD 1JGEB 3NN8A 2FX8H 4X99B 2DMKA 1UCTA 4HT1L 1OP3K 4OLWL 5HHME 1UGNA 1LEIB 4JM4H 1NFDF 4GKZB 4Q6YA 4S2SB 2D7TL 4R4ND 3BEWB 4U1GC 2APWA 3L3HB 2GI7A 1OAKH 2E8ZA 3E6HB 4NQDE 4NQCD 4MD5A 1AD9A 2WZPD 2UZIL 1A3LH 1QSVA 4BFBD 1I85C 3V6BR 4JCMA 2Z9TA 5IVXB 1KFAH 3ZHKA 3BP7A 5EBLB 3KG5A 4P46D 2Q20A 4NP4H 3CFDB 3MV8B 5JW5B 4KTEH 3DPBA 5E9DE 1CI5A 5GGRY 1XF2B 1JPFB 4P57A 1G7IB 3QEGL 4HD9A 1GVIA 4OF5A 3BD3A 4CNIA 2NY1B 4YXLH 1T7YA 3FB7A 4RZCB 4P46C 3SDCA 4K9EH 4WFHE 4N8CH 5C0BB 4X0KA 4X6EA 2XKNB 3JXAA 4L9DA 4M6MH 3ZDZE 5HY9B 1YMMA 4CMMA 1NQBA 1MEXH 1XIWB 1KPVA 4XX1G 4CN4A 5KANI 3HZYA 4OCSL 3R06B 4E5XA 4Y88A 1JGLH 1A7NH 1G0DA 3I3EA 1F3DH 4N9GB 2OZ4A 3LKQA 2NY5L 3DX6B 3OB0H 1A7BA 3UO1L 3FN0L 1HI6A 2YXFA 4MAUL 2BXYA 3MRQA 1OPGL 3FT3B 4LCIL 4EKXA 4HXBL 5M94B 5KJRH 1AXIB 3DV4B 3TV3H 2NY3D 3REVA 1T7VA 1EAPB 2RQ8A 4H5SA 4ZUWB 3ZYIA 4KJPD 3H8NA 4WNQA 4ELMF 1CTNA 4M7JL 2IQAB 4LCWD 3WD5H 4ZAKA 2JJUA 3UTQB 3ZTNL 2MQ3A 5ID0A 4TNWF 2YZ1A 4KKAD 5EU6B 2BHYA 4WDIA 4MD0B 2BY2A 2OYPA 2IWGA 4L5FH 1FCCA 4LLUB 5HHPA 1P53A 4PJFA 5DI8A 1KLGB 2J5LC 4UIMB 3QXVA 1MCSA 3BO8B 2PO6A 2OS7A 3FZUD 4PJAF 5FYJU 1IVLA 5IKCB 2Y1VA 1DANT 3PV7A 3OHXB 3ARPA 1JGDA 3LSOB 5E8OA 1JK8A 5DUPL 1FZKB 3TCXA 3N9GH 3V0WH 3MV7A 2W9DH 1LVEA 3UROR 4Z7NE 1RJCA 1JZ5A 3BDBA 3RWJB 2FB4L 2Y6SD 3ULVF 1KG0B 1L0YA 4ELKB 3U9UB 4KHTH 4J8RA 4RRPA 5TE7L 3R8QA 2BY1A 1MRCL 1R5IB 4PY8J 5FOBB 1MCPL 2CRYA 3I2CL 4HS3B 5HGDA 2R0KH 3HLAA 2YHGA 3UZEA 1KACB 4GW4A 4PJDB 1C5BH 1QA9B 5LWYH 1QSEE 5B8CB 3UTTA 4XNZB 2X1WL 4G8GA 1NLDL 3U1SL 4GXUM 2X9WA 3MJ8B 4FQPA 4IRZH 5FO9A 1VGEH 3TT3H 2CRMA 4HUVB 2WANA 1YNLH 5ID1B 1I8KA 2IALB 1AKJA 5I1LA 5GS3A 4ZO7A 3IF1B 1Q1JH 1B0RB 3TIDA 3WNMA 1UWXK 1JHLL 5GS1C 3BW9B 4QY8A 2BNQB 4PJCA 3GUTA 4U1MA 4Q2ZA 1R24B 1MFCL 1B88A 2UUDH 2NY4B 2CJUL 3ZT7A 5J56B 4K2UL 3RJDA 3MA7A 4HWZB 3LKRA 2GJZA 3WIFB 3FOLB 1G9EA 1N6VA 5GHWL 3H9HB 1OAYH 3ZDXF 5IG7A 4YDJB 2QSCL 3QDMD 1K85A 5IMOA 3S4SB 5EORH 5DC4B 1HEZA 3X13B 4JFFA 3T0VA 4WFFE 2AERT 5E94B 2C3VB 4OD1H 4TSCH 2AK1H 3MACL 3PWPB 4R26H 4NN7C 2HRPL 4MQSB 1RULH 1V7NL 3VXQA 5D7JD 4ZFFA 1JNNL 3QULB 2E7MA 4LHQB 4U0QB 1FO0L 3SJVA 4YDKH 3GSRB 3C8KA 5C09E 2Z91A 4J7RA 1U8JB 1KNOB 3MBXH 5DA4A 5HVHC 2GK0B 4F7TA 4K23H 2ZKHL 3FB5B 5ITBH 3RPKA 4M5YH 3MCG1 4I2XE 3P9MB 5SWSE 1VKXA 5AAWA 3WS6C 3JUZA 5T1KB 1J87A 4G6AC 2C3WA 4HH8A 3N1GC 5BJTA 5ETUB 5E2VH 3WFHB 2FSEB 2W9EH 4JDTH 2X70A 4LSQL 1NANI 2FJGA 2I27N 5I17B 2DQEH 3LKSA 3F7RA 4PRPD 4EVNB 5DEGA 5MERB 5HI4C 3CVHH 4PBVC 3FQTB 3R8BB 4JRYA 5AYQA 3TH3T 5JHDD 1WWWX 2Z31D 4LFHG 1Q0XH 4J1UA 2YRLA 5IMMA 1I1CA 5EG6C 3ARGA 1WJ3A 5F7DA 5I1LB 1C1EH 4X4ME 1LEKA 1T21B 1T4KB 4F57L 4OD2B 5E00A 1LO2H 3V4PH 4RQQB 1IL1A 2IMMA 5KTEL 2V5MA 5EFIB 4BFIA 2PCPB 3W0WD 3EYFB 5J7CC 5F6IB 4V2BA 3D18B 4YBHA 3ZDXE 1TCRA 2H6PB 2GTWA 5K9QI 1MCPH 4UQ2A 3C2SA 4ELKA 1KG0A 3ROOB 3HFML 3OJMB 5MEPA 2HTKC 4JJ5A 5MEQB 3S5LG 5H37G 3Q6GL 1A02N 5EWIH 4CU7A 1UXWA 1DL7L 3QDJD 4OFYD 4XP5L 3QEQA 3T8XA 1FZKA 3AM8A 3HG1B 2WBWB 2XI9A 1MHHA 1VSCA 1WZ1H 4CADA 1MHHB 5DRZB 1TQCC 1WEJL 5A16B 5EU6D 4MQTB 2J6EH 3DGGB 4L3ED 2XWBA 4JR9L 3UJTH 5IBTH 1KB5L 2YMXL 5EN2B 1QYGH 4M03A 4QTHB 1MHEB 5HI3D 4YDLC 1IGFH 1P69B 2V7NA 3GBNH 1BJ1J 2DQDH 1IT9L 1NUGA 2P24B 3BIBX 1URLA 3ZKNC 4K94C 4ZODA 1RZFH 4O2FB 3V4VL 5ERWA 2UWEF 4U1KA 4H5SB 4ZUWA 5IF0A 1F8TH 2EDTA 2GITB 3DV4A 4OD2A 1UM6H 2HRPH 4QRTB 4TVPH 3LQMA 1UJTA 1QFWI 2R2HA 3MLYL 2DI7A 3S6CA 4YR6B 2AXFB 3WSQH 1G7MB 4HQQH 2X44D 3K2UH 3LMJL 1SY6H 2PXYD 4RAHA 1Q8MA 2A74A 4LASH 1I3VA 3HE6A 1ZAGA 4HKZA 4Z7UE 3JWDL 1QRND 1WEJH 1F4YL 3HB3C 2W07A 4A6YH 4AY0A 4EVNA 2AJSL 5E9DA 3TNNA 3VCLA 3BKYH 4X6CF 4ZAKC 4NFCA 5L9DL 4M1GH 4HKJB 4UIKL 2GTZB 5C0BA 3NCYS 3PJSA 1HH9B 3J8F7 2J88H 1JFQH 5HDLA 4OB5H 1G7IA 3DXAB 5EU6E 1S9YA 5I1EH 3VFMB 3BGMB 4LU5H 1QFHA 5BZDB 1HHJB 4PB0H 1IEBB 1SVZA 3D39D 5JIHA 5H94A 3PGFL 4PP1D 1U8JA 1NDGA 5J89A 3GSRA 4MD5B 4U6HA 3DMMC 4P9HC 4KGJA 4Z18A 3CVIL 5JHLL 35C8H 4EI5D 3GIZH 4GKZA 4LLWB 5E70A 4MA3B 4QTIL 2DQTL 5TQ0L 1EEUA 3IJYA 2R0LL 4WI6A 2X42A 3JV0A 3E6FB 4OCWL 2O93L 1FZOA 1I1AC 2WBJC 3N9GL 3V0WL 3I84A 3WCYA 2Q7YA 2YEZB 2XXCB 5J12B 3LKRB 4H1LA 4JB9H 3MA7B 2J6EA 1IGJB 2X89D 1MJ8L 3DECA 3FB6A 4M1CC 3ARZA 2FIKB 2H26A 3GUTB 2EDDA 3KPTA 1IFHL 4OZHE 3BW9A 3V6OA 4KMTL 5C0FA 5C0IA 3VMNA 5CHNB 3B5TA 4YDIH 3LEYH 3QAZB 5CD3A 3P9WB 2EH7L 1TQBB 1OM3H 3T2PA 2F8OA 4QHUA 3SDYH 3LKOA 4NBYB 1EK3A 5AAMA 4D0CB 4N8PA 3TT1H 3ARBC 2VR4A 2MKWA 3DHMA 3SPVB 1CDGA 3HLAB 4NGHH 1MLCB 4KH2A 5D1ZD 1QRKA 4HS3A 4A2LA 4G9FA 5ITFA 1QD0A 3FN0H 3L5WB 2FJHA 3U9UA 4XGZB 1VEMA 1KCKA 1RD6A 4WUKH 3P0GB 3BQUB 5GZND 1FO0B 1KULA 1ZVYA 3B5GA 4K3GA 4LHJB 1DL7H 3LSOA 5E8OB 1A1MA 3L5IA 1BM3L 1MHCB 5HYJB 4H25B 2KKQA 5F9WB 1J1XH 2PO6B 5BRZE 2VDQH 5D6DA 4K71C 5J8OA 3QPQC 1RZJC 1XGYH 5D7KD 4XXCC 4R7DA 5T1KD 4MD0A 3WFCL 1NC4B 4DZBA 5KSAB 4Q9QL 4WDIB 1Q1JL 3BZEA 4KVNL 2F54B 2GFBB 3PGCB 1LK3L 3B8SA 2N56A 4C59B 2AABH 2XV6B 4ODUA 3EJZD 3H9SE 1XGUA 2Q8BH 4ODHH 1GZQA 1J10A 4N0YH 1MCBA 2AEPL 2DQIL 4AEHL 1KEMH 4JQVA 3Q6GH 5IBLC 3PHOB 1BOYA 2MWCA 2QQQA 4JGMA 1GSMA 1OSPL 4NKMA 3TBWA 1P4LA 4XCEB 5KS9B 1NFKA 3ULUL 1OLZA 3MRQB 5CAYB 4GKNA 3D39B 3DROB 1TZHA 1CE1L 4IRJC 5D7JB 1HHHB 1QFWL 1FNGB 4NZRH 5K9QG 3OAYH 4XCNA 3SDCC 4WI2A 1IILE 1M05B 4UILL 2PN5A 3DO3A 4Y16A 5MENB 5DO2C 1E6OH 1FJ1B 3MLWL 5B38G 3SOBL 4QXGH 3L6FA 5K9KB 5JIIA 5E99L 2QQNL 2DQUH 4E5XB 5BOZG 4OTXH 3QDGA 2DQGH 2VSCA 3G5XA 1E6JH 4WI3A 2HWZH 2D4FA 4PRPA 2XKNA 3TESA 3TM6A 3D69A 2AI0L 3L95A 3TN0D 1UJ3A 4EXPX 3GSVB 5KVFL 2F8XC 1A3QA 3MX0A 1YA5A 2ZKHH 3VWJB 3IDIA 2CDEB 2UWEB 4S1SL 4CNIB 2NYYD 3VRIB 2UZYB 1J0KA 4F58L 2Q8AL 1NGWA 2V5SA 1IGTB 1S78D 3BP5B 2HMIC 3F8UB 2R8SL 1CD1B 4JFEA 4RRPG 3VXRD 2DTMH 3MLSH 3RJQB 3OKNB 1JBJA 1DVFB 4HPYH 4HG4K 1YPZE 3MMEA 3FZUC 1SQ2N 4YQXL 1S78C 4F33B 5JW4R 1OGAE 2R23B 3ILPB 3OZ9L 1DQDL 3H7LA 2IC2A 3O2VH 1QBMH 1CD0A 3IU4L 4QXWA 1D5MA 1ZA3A 3HC0B 1HH6B 4Y1AE 3U4BH 4MNGB 5IEKB 2O5YH 5IHZA 5D1XA 3SBWA 1FO0H 1MWAL 2MJWA 4QCIA 2HJFB 4XVUD 2A6KB 1PQZA 4DZ8B 3DYPA 4YIQB 1W72A 5ISZA 4XCYA 3TWCH 4WEBH 4I0PA 2XQBH 3OKOB 4N0FB 1FL5A 5I75B 3VI3E 2VQ1B 1IM3A 4ZTOH 2VH5H 2HVKB 1N4XH 5FF6A 2ESVA 5J1SC 1PGRB 2DBLL 4UBDD 5F7NC 1FRGL 1FZMA 4RGND 3UO1H 3AC0A 5AEAA 1UKTA 2G60H 3TO4D 3U1SH 3QWRA 5C07A 3KJ6L 1BQHG 3BXNB 4X7SH 3KPRA 3LVEA 4X6BA 1INQB 1T5WB 4GRMA 1S7SB 3VFWB 3KYNA 1A6UH 2W92A 2PR4H 3FN3A 4NHCL 3TPKA 4HCRA 3OG6B 5IBLD 2EE3A 3GM0A 3NCFB 1CN4A 4KK5C 4NO3A 3K2MC 4GLRI 4UB0L 2D7TH 2ZUWA 3SKJL 4OZGA 4MCYA 2YS4A 1M4KA 4YHKH 1EPFA 3RIAF 2K7PA 1K8DB 4BZ1H 5L6YH 1VEOA 4NQVA 3CPLA 5CUSL 1ZHBB 5F9OH 1PLGL 3MO1A 4Z95H 5IM7B 3CX2A 4PJ5D 5JHDB 1QBML 4HWEH 3M1BA 5E0QA 2P49B 3U4EA 1X5XA 1DUZA 4YC2C 4WV1C 4NO0A 5CBAA 2DB8A 1G7JA 4O2EA 4MXVF 5IR1B 1A2YB 5ECJE 3ECBB 1G84A 2AQ1A 3F5WB 4R4NC 1EV2E 5GISH 2Q7NA 4PRDA 5KVGL 1X5AA 4UDUA 1FGVL 1JI1A 3VGAC 1YEFL 4P2RB 4PRHA 2I9TA 8FABB 1NGQL 2VISA 1EA9C 2H8PA 2PETA 1GGBH 3KLHD 1IAIM 5EU3A 3FO2A 3PABB 5D1ZC 1J05B 4OV6F 2XN9B 1GAFH 3KR3H 2NXYC 5CEYB 1KJ2H 5CJXA 3O2WL 4XVUC 4OCXL 2BOBB 3BZFA 5IW3A 3EFFA 3KPPB 2VLJA 1ES0B 3BP4B 2PTTA 3MRNB 3RI5K 3KPSA 3L9RA 2HA1A 2E7LA 1AGFB 2WLYA 4XP1H 3KPQA 1UH2A 3OJDB 1H5BB 1ZSDA 3BN3B 4EI5A 3VFVB 3FMGL 2DOCA 3QHZL 1FFPA 3T4AB 1IMHC 3L7EB 5HYSB 3H42L 1KBGL 4JN1H 4G43A 5IMLB 4XWOD 5ISZE 5LGHH 2NW3A 4YQXH 4JHAL 5KJRL 3RPIB 2EC9U 4YUEH 3LPFA 4JHBA 3FO0H 3ESUF 4HGMA 3MROA 3S36H 2DICA 5FYLL 4JKWA 4WHTB 3ARDA 2QADB 3O0RL 3DBXA 5I76A 4L3CA 3T3MF 1D5XB 5EZOL 3EOBB 3DUUB 5C07E 1IE5A 1IAOA 1BJ8A 4KK8C 3MLPA 1Y0LA 1F4XL 4FP8H 3DX8B 3V6FA 2X41A 5CEZE 5DJDA 2IH1A 4FQCH 4TYUA 5I75C 1NFDA 4EI5C 4P5KA 5JR1H 4IOFD 35C8L 4C56D 1KPRB 1NCCH 3LZFL 4KRPC 4NZTL 1AQDB 3U0PB 4LSTH 3BRDA 3TO2A 1T2XA 4F9LA 3MQIA 1E6JL 3SJVE 5M7QA 3B6SA 4K23L 1BX2B 4MNQA 1KEGL 4B0MM 2EZ0D 4ONFH 1ZHLA 5I1EL 4Y4FA 2P5WE 2Q87A 4GRWE 1KLFA 5C0EB 2DQHL 4X98B 1OARL 5DYOB 1T1YB 3QI9B 4YFDB 1F3JA 1NLDH 1HINL 3GSXA 3QQ9D 2ZCLH 1QSEB 3FMGH 2AKRA 3C6LD 4JVUA 4GMTH 3BDXA 5L8JB 4PJXA 1V7NH 1RZ7H 5EZLA 3MCLH 1PG7H 3INUH 4QRQB 4RBPH 3Q3GA 3LKPB 3C60A 1G1CA 5HTSA 5J11B 1NMAH 1CICD 4M4PA 1NFIA 4U1IB 3GI9L 1U3HB 4MHHG 5SWSD 1A6ZB 3AREA 4NM4L 1RUKL 5HBBA 4XPFL 5TGBA 1F11B 4S1DC 4OKDA 2VZVA 4Y5YB 2R29L 4D9RD 4NDMA 3NIDF 1CK0L 1BQHB 3A6CH 4JQIH 3BPCA 5DJXA 2P5EB 4LHUG 5DJYB 3TH2T 1VDGA 5T1MB 3KAAA 3U46A 1UH3A 2VXSL 1L7IH 1PG7X 1U8PB 2HFFA 2VLJE 4OQTA 5FEBA 5J06A 1RFDL 5JHDE 2H2PD 2V7HA 3WFZA 4QT5B 1J1XL 4LP5A 3VFOA 1BZ7A 3TVMD 3NIFF 3G5ZA 3KPOA 2CH8A 3MRBA 4OLZL 4QRRE 5C0AD 2XZCL 4NRZB 2W1NA 3DV6B 4LKCA 2IH3A 4Y4KB 1CBVL 1KPUB 4JN2B 4YBLB 1OP3H 1A64A 3VXNB 2Y06H 5CCKH 1U92B 4L4TD 3SKOB 1AR2A 4GRLD 2VE6B 1L6ZA 4P23B 2VZOA 5GZOD 2BSRA 3QO1A 1HXYA 4PG2A 1E4XL 5DUBB 4BYHA 4LVOB 4PUBH 3VXUA 1FN4B 4LAQL 4JO2H 3J7HA 2CKBL 4FFYL 3PDOA 1A6UL 3FAWA 4X6FA 1ZHKB 5E8NA 4R2GD 3B8YA 3GJFK 3ORJA 6FABH 2DKSA 4H1LG 2R2BA 1MCLA 1NPUA 5I8KH 4P9ML 5JOEA 4NWUH 5DTFB 4MHHI 4MX7B 4I77H 3ARDC 1CF8L 1N26A 3QCTH 4GRWF 3H9SD 1HSBA 1XH3A 1CIDA 2FR4B 4K9EL 3BZDA 1SJEB 2GAZB 3I6LE 2OJZL 3RZCA 1RURH 2AEIT 5TQ2H 1JN6B 1LO2L 4APQA 5HGAB 3S5LA 3OXSB 4G8IB 3GSOA 1A5FL 1NMAL 1FGVH 4UU9B 4K7FA 2XZQH 4QXUL 3MUJA 3LQAC 3V4UH 5D1XD 3EGSA 5JHLH 4ZSOE 4LAJH 2I07B 1Q9OA 3GIZL 5SX4I 4AMKL 3RWIA 1INDH 4KK9C 1C7TA 3P2TA 3S35L 4KVCH 2DQHH 4WTZG 3VXSA 4WFGD 4NCC2 1YY8A 5EU7E 3H9SB 1T0MB 4AG4H 5EZOH 2FDBP 2PW1A 1KGCD 4RGMB 1OCWL 5IW1B 2JE8A 4PP2B 3D6GA 3WNOA 3D25B 1K6QL 1QRNE 3JWDC 3RAJH 5I19H 2OBGA 2OQJA 4PGEA 2DDQL 5CIPA 4DAGH 5E2TL 1LEGB 1C08B 5AD0A 2A0LC 1X7QB 2IBZY 4X9BA 4UDTB 3TA3D 5IBTL 5KSAC 2YD7A 4G7VH 4TSBH 4PJFE 3QUXB 3D0VA 3QUKA 2OR9H 3RU8H 3GSQA 3RWEA 1N64L 4QF1B 4HJ0D 3V52H 4QLRA 3PUCA 4UNTA 5IW6A 1MFAH 1U8IA 4PJAB 1PZ5B 3F7VB 1WC7A 4X4YB 1BVZA 1KUMA 4JM2F 4N5UA 4TSAH 4LAQH 1U91B 5ESVA 4P2QD 4EXKA 2MPAH 3UZQA 3FJTA 2X1QA 4ZUTB 3MLYH 43C9A 3S8WA 2YK1L 3PG2A 2OSLB 2PUQT 4LCCA 4Q97A 5GS2H 4JAMB 1MUJB 3HE6C 1RZ8A 5CSBA 3WO4C 1YQVL 4E41A 3ISWA 2UUDK 4KUCF 4OCLC 2V5RA 2AEPH 1S3KL 4TUJB 3QJHB 2NY3B 4HK0B 4PFEA 1NDMA 1ND0A 4LFHD 4Y4KD 3FHAA 4Z7UF 1DANU 1HSAB 4WFGE 3CCHB 4OD1L 4TSCL 1SYVB 2WM0A 3GMMA 4L4VB 2YD3A 5E8EB 5I1JL 4X6CE 5BV7C 2YPKB 3RAJL 4PD4J 3TNMB 1SJHA 3P0YH 1S7RB 5K93A 3GK8L 3SKNB 3O3EB 1JP5A 1WWCA 4LSDA 2ARWA 4PRHE 1GGIH 3T1FA 2J3SA 5DJAB 3Q6FB 4Z9KB 1JTPA 5TH2A 4PJBB 5GISL 5KVGH 3ARGC 2EYRB 1NLBL 5EB9A 4FQQB 3SDDB 4K07A 1KXQE 2V2XB 2Y6SC 4HC1H 5IVZA 3UEZA 3CAFA 1QKZL 3HZVA 5HHMD 2MKLC 4RX4D 1Z0NA 4KUCD 4EBQH 3LV3B 2DYPD 3SO3C 2QSVA 4P48A 3EFDL 4H0IA 3FFCA 2HN7A 3TZVD 4NO2A 1ZWIA 1F00I 4YHIA 4HK3N 1MIML 1Q9KB 2G5BB 1UA6L 5I66B 1QBBA 3QI9D 4RFNC 4Y4FC 1P5VA 1CR9L 4KV5E 4U6XA 3T4YB 1X44A 1LE9B 1MHPL 1CQYA 1GZPA 1RJZA 4XCCH 4Y89A 1KTLA 1H15A 3B3IB 3F12B 3N0PB 5LG1A 2H45A 3UJJH 1KCRH 1FAIH 5CKAA 3T65A 3I50H 1LNUB 3LS5H 4D9LL 5EUKB 4UT9L 5T1DL 3U4BL 3CSYB 4GXVH 5TQ2L 4LASL 5L7XH 4OIAA 3P73B 5GGRA 4CVZB 3TV3L 3QQ3B 5MEND 3NBNA 2GSGA 3T2QA 3PDGA 4G42A 1R3KA 2VB5A 5LGHL 5C6PB 1W0VA 4QHLA 1DN0B 1VFBB 4LVOC 5C8JB 4U6TA 3QG6A 4LARL 4NGHL 3RKDC 5EUOA 4HBQA 3HE7A 5JNYA 4YBQD 3RU8L 3D85B 4PV8A 3WUWG 3L5XH 4E41E 3CFBA 4FQJH 4IIQC 4ZO6A 2EYSA 1DBAH 2ARJQ 1DQML 2XN9D 2A2QT 3KYAA 4NZUH 1ZLUH 3ZKMD 4EUPA 4UV7H 4KK8D 5I1GH 1CE1H 5E8DL 3TBYA 1GOFA 3ULUE 1A9BB 1A47A 3IDJB 1YJDH 3CJJA 3IETA 3O4OB 2R8SH 3MNWA 3LN4A 4KJYA 5HGHB 5GSRA 3MLWH 2CKBB 2RAMA 4F9PC 4DCQB 1YEHL 4S0SD 4OGYL 4U7SA 5TE4L 3VFNB 3ILQC 3B9VA 4PJGA 3G6AA 4N5EC 4OJFH 2OX5A 5GSRB 2P5ED 5DD0L 2HJKA 4U0RC 1A6WH 4NKDB 1KJ2A 1U8HA 4GAFB 4TTDC 1S9VB 2Q6WB 2Q76B 1VFUA 5DK0A 1U3YA 4JFHD 4B7IA 3O45B 4RMVA 3WL9B 2AXGA 1O7VA 4Y1AA 5EC1B 3MOQA 5BO1H 1NBYA 4EI6A 3RVUC 5ANMB 3AU1B 1QR4A 5DMIL 4Y5VB 2HLFD 1B6UA 2EYSB 2FEEL 5CP7B 2J1KA 2VLRB 3P0VH 3VWKD 3T09A 3U2SA 4NWUL 1L0QA 2R69H 4XBPB 2VABB 2A73A 5DZNA 3TO4B 7FABL 4NRYA 4TUKH 4O58H 2D7QA 2NY7L 1TJGH 2D7OA 3CLEH 3FQUB 1UC6A 4WO4D 4A6YB 5HXMA 3S7GA 5DD1L 3QQ3A 2ZG2A 5ADPL 4BQCA 1BGXH 4ODVH 1JWSA 4GXUN 4M7ZC 3CSYA 3KS0J 5I1IL 4GRWH 1P4IH 1IEAB 1YYMH 5BV7H 1WAAE 4OUUA 4HPOL 1MQKL 5C92A 3T65B 4QRRD 3EJYC 2QR0B 1QBLH 1JWUB 4NHUB 1H15B 1MCNA 3HHRB 4QHNA 3U7AA 4JHZA 1NAMB 2XZZA 1EHLL 1GGUA 1T2QL 4FTVA 1RVFH 4J3WA 3P0VL 3IDGB 4FP8L 5IVXF 3U9PL 2CDFB 4KZDH 4HUNB 5C08D 4Z5RA 4YHIB 4PY7A 2YD9A 1F58L 3G04B 4NKOA 3FFCB 1P9MC 1EO8L 3TO4C 4HPYL 4LCWB 5KZCB 5JDSA 5DFTA 3VXSD 5FA4B 4ONHB 4XC1H 3HZVB 3GRWH 3B2VL 4NFBA 5L2JA 4F2MA 4OZIE 3TYGH 3LEVL 1Y18B 2XTLA 2CIKB 1GGTA 1U8KA 5DJCA 2NR6D 2DLFL 3T0EB 5EU5A 3ZLQC 1DVFD 1J0JA 3BSZH 1NCWH 3MRIB 1CT8A 2NX5B 3Q6FA 1YEGH 3O0RH 2V2WA 3QCVL 4DGVH 1RFDH 4OGAD 5F8QC 2BRRL 2XICA 3F6IA 4JZNB 5FOJA 3SDXB 4XZUA 5J6GB 2JK5A 4U0RB 4JDVA 1BEYH 3BH8A 4G9DB 4OTXL 2YPKA 1S8DA 5DMKA 3GKWH 1ZANL 2FZ3A 3G5YB 5IFHH 2NZ9C 3G08A 2EH8L 4XB7A 4O00A 2YA0A 5HHVL 2ZUSA 3SCMD 5IB4A 1YEKH 3PWNA 5DD3H 1OD9A 4R97C 2YKLL 1OOAA 4M7LT 5GGQL 4OGXL 4LSSH 1CFTA 1PKQB 4RFEA 1ND0B 3GHEL 4W6WB 5B39B 3WHE0 5L6YL 5LXGL 4U6VL 2ZSVB 3IKCA 1C7SA 4L4TB 4RIRA 2HMID 2H3NB 3RZWA 1U9KA 2GJ6A 5FYJH 4M8QB 4L8SA 3CLEL 1F6AB 3ARYA 4WV1B 1AP2B 5I8OL 4OAWB 3W39A 5K9JL 4LCCB 3QEUB 3O6LL 3G5VB 3RVUD 3UPRB 5KOVC 3LB6D 1YEGL 3G6DH 1DBMH 4P99A 2NXYD 4DKAA 2J12B 4Z95L 1K4CB 4R4BB 2Z8SA 4ZPTA 3F7VA 2M1KA 4XMPH 5DDHA 5IGXH 5IW6B 5DO2D 4NQCE 4U1SB 3QUKB 5DS8A 3EHBD 3MUY1 1AHWB 4Y19D 3UYOD 3JWOL 4FQXB 1P6FA 3ZKXB 2ZP0T 5CIPB 2VDQL 4F7EA 3WIHA 3DO7A 1F4XH 2YA1A 4O9HH 4P3DA 1KN2L 4LIQH 4P2QE 3UTSD 2P5WA 1HQ4B 4DUXA 4RMRA 1T2JA 2P8PB 2ADIA 1QOKA 3R0NA 1NCUA 1OGAB 5EOCL 3TYGL 3O2WH 5E6ZA 3RWIB 1RUMH 4LRIC 3FONB 4YHYC 3QIUD 5C7XH 4NCDA 3MJ9H 1KC5H 3AXLA 3HZKB 2WINA 3ME0A 3I2CH 3WNNA 4ZS7H 5DRNB 4UV4L 2EH7H 5FUOL 2WBJA 2XG4A 5T5NF 3DVGA 4PJIF 4BELD 2EDQA 3OXSA 1N3NB 4PJAE 2DIJA 3MGTB 4AL8H 2VDKH 4HUXA 4APQB 5CSZB 3JWOH 4JLRA 2VUOA 1P1ZB 3RWGA 3AS2A 5DHVA 4F3FA 3RZCB 4KI5F 2ZPKL 2C7UA 3UBXB 3BX7C 5E1AB 1R3LB 2YPLB 2H1PL 5LBSL 3PHSA 4OFVA 5DGRA 1NMCC 1GXEA 1IQDB 3QPXH 4XP4L 1ZEAH 5F7MC 2EIEA 4LCYB 4Y2DC 5BRZB 5DXWA 3LHPL 1CK0H 2W60B 3AS1A 2CO6B 2DWDB 4D3CH 3T1WA 1Y6MR 4J3TA 1FH5L 1NSNL 4ALAL 2UZXB 4NN5B 3VFRB 4RWHA 4ELMB 4MJID 5D1QA 2X7LB 3MNVA 1NEZG 3RWHB 2PYEB 4JFEE 3VXUB 2W9LA 1MFBL 3MCKA 1QSFA 2NNAA 2DTML 2DRUA 1JHKL 2BSRB 1OQOA 1YY9C 2AK4D 4ZUSB 2BCKB 2VKWA 1MCJA 4MQXC 1DN2A 4BSVA 3BWAB 1I9EA 3C5ZC 3QRFM 3RGVA 1ZGLM 3V4PL 3C9NB 1BQLH 5DD5L 2Z4QB 4MXWL 1EO7A 4UV4H 3G5ZB 4YDIL 3SGJA 1NGZB 3FOMA 2JCCA 5B4MC 5DURB 3QXDB 3HPJA 3MV9B 1ZT1B 3ULUH 1R3HA 3QH3A 5GGVH 2F58H 2CUHA 4NO5B 1BEYL 4XC3L 3V5HB 3MJ7A 4FFVD 3MLXH 4A6YL 4OFDA 1NLBH 2Z31A 2P5EA 4NOFA 3GSNA 4NQSB 3UAJC 3L5XL 4YXKL 4IMKC 3C09C 3MRPB 4LCCC 3RWDB 3I85A 5TGBB 2OXGA 4PP1C 4P2OD 5DD6A 5IHLB 1TXKA 3PWJA 1ZLSH 1JTOA 4Y1AD 2VC2H 3RDTB 5CCKL 4J6RH 4Y4KC 4AENB 2QV2A 3O8XB 4LNVA 1OTSD 5C9KA 2GKIA 5JA8B 5C0CD 3BJ91 3Q3GB 3CXDL 5EC2A 1BBJA 4PRAA 3AY4A 5TDNA 3OR6B 3ALXA 1KIQB 2DBJA 5BS0B 1QPPA 2CIIA 2GUOB 3B9KB 3NAAH 5L88L 3P4NB 3QWQB 4HWBA 1S7QB 1XZ0B 2HG5B 1YJDC 5I15H 4X98A 2VLME 2WWKT 5C0EA 1RMFL 4RFNB 4Y4FB 2F53A 3OKMA 3UC0L 1JUFA 3PGDA 3VI4F 4DW2L 4OFYA 1BX2A 2AV7A 2B7DT 3DJ9A 4MS8D 1M7XA 2EE9A 1D6EA 2X4TA 3P4OA 1NCAH 5FXCH 5KS9E 4Z76A 5GRUL 3OPZH 2JELH 4KFZC 2BJMH 4JPWH 2B0SH 3QDHA 1RAMA 4KAQH 1DBKL 3HAEH 3RRQA 1A21A 3ULSB 1MFEL 1ADQH 3QQ4A 3IFNL 1X5KA 3BYTA 1OAZH 2HAZA 3K1KC 5CBEA 1WZ1L 1FAKT 3A67H 3LEXB 4TVPE 4YGVA 4HS8H 1A7QL 1QO3A 2VWEC 3DUUA 5I76B 2FBJL 4N1CA 3DVNB 1MQ8A 4WGVB 5EOTA 2F53B 5HI3C 5BS0D 3S36X 3MZGB 4ODSH 1ETZB 1F02I 3RPIA 3D2UB 3MLVH 5IB1A 3OGOE 4V1DA 4NQEA 1XZ0A 4QHKJ 5TE6L 4HIIB 2IQ9L 5D1XC 3SBWC 2VZ3A 4GW5B 4N0UA 4EBQL 3VXOA 5TDNB 1P7QA 5BO1L 3M07A 3EOAA 3MA9H 1WFNA 1HIMH 5J6HA 1D5IH 4EI5B 1NBVL 2NY0D 4FXKB 1G0YR 5L2KB 3X11B 4S1RL 2Q3AA 1JNHB 1S5IL 1RIHH 4C83B 2VLJB 1MQKH 1H3PH 3GMOB 3NGBB 1J12A 4JHWL 3LIZH 3TBSA 4HEME 1GGCL 5DEZA 1G0XA 1R5VA 3MRPA 1BFSA 3AS3A 2P7TB 4KZEH 6CGTA 3T0EE 3MFFA 2VQTA 3GSNB 5DLML 2VXTL 1A1NB 4JRYE 4Z8FH 1N64H 4JQVC 2H8PB 3MJ7B 4XP5H 3ZL4H 2V2TB 1ADQL 4FQXC 4JO1H 4OCNC 4F7MB 5T1DH 4MJ5B 1CIUA 3WLWD 2M26A 4HXBH 3GJFB 5EULV 1KJ3H 4ZQKA 4F9LC 4AH2A 1BZ9A 2F58L 1NGZA 3FOMB 3FO1A 1AC6A 3C08H 2Y36H 3QIWC 2J8UF 1I8IB 2J7LA 2HFGH 4RA0C 4U7KA 1AD0B 3DMMA 2EC9T 1JF6A 1PKQE 1ZE3C 1V05A 3CXHK 1T1WA 1OTSC 2C5DC 3K80A 5HI4D 5IHUL 3CK0L 4APQC 1Z2KA 2CXKA 3LS4H 1I8IA 2EDBA 4WW2B 1FFOA 1KJ2L 1WIUA 3MV11 4P2OC 1FL3A 3Q48A 4MCYB 1RULL 1A1OB 3MNVB 4XPGH 2VZSA 1K2DB 4S11A 4ELMA 4TVPL 3A67L 5DLMH 1HHIA 1T80A 4R3SA 5FHAL 4FQ2L 4UOJA 5E6IC 5FCSH 1L9MA 1S7SA 4CJ1A 2OR8A 5DMIH 4LCYA 3KPRB 1WISA 5AG8A 4CU6A 1GGIL 2AP2A 2R2CA 1YEIL 2OP4H 5DJ6B 1FZMB 5GRJL 5IBUB 1HXMB 3GMOA 1UWEL 4HFUL 4JLRB 3X11A 1YEDA 3RQ3A 2APXA 1BPVA 4V1DE 2DTSA 1O0VA 5JW4M 4TNVK 4NZUL 1MCQA 5ISZB 1Z9MA 3MRJA 1PQZB 2XACC 4U1JA 3PQYD 4JY6A 1RK0B 1EEYB 3NACH 3TCLB 5L88H 4KJWC 1YECL 5CKGA 5IEKA 2GT9B 5F21B 3JVGC 1I8MA 3RIFF 4V1DB 1FFQA 2LV4A 5A43C 4HPOH 1FNEB 3QXWA 1YZZA 4W68A 5BW7A 2WUBH 3JV5A 1E4WH 1MPAH 4YHLH 1K8IB 4KDWA 3BT2L 7CGTA 1E4JA 1FVEB 2MHAA 4L8CA 2LAGB 4YGVB 2E6QA 3CH8A 5CBEB 3SGDH 3DO7B 2W9DL 1TVBB 3BWUC 3M45A 4JM2C 5BCAA 2I60H 3ULSA 1QSZA 2X4PA 2BFVL 1N5AB 4XVTL 3NFPA 1UACL 3AB0B 5FO8A 3GI8L 5EIIB 3UTSE 1GGCH 1CLOL 2NXYB 3GSVA 1DP0A 2X4TB 2OTPA 3UC0H 5KS9F 5DJZA 5ELIA 1CBVH 1IAIH 1S7WB 1NBQA 5CINL 4KPHH 4UQ3A 3G5XB 4X5XA 5E6IB 4RMUA 4PREA 3KLAA 3PE9A 5F9AC 2KZ1B 2FATL 2HG5A 4JVPA 4GSDL 4Y16B 3P4NA 2AK4A 2FGWH 2H9GA 3B9KA 2YMXH 1U0QA 3D87B 4P2OB 1DBML 4MB5A 4WV1A 3CIQA 1CGYA 1F6AA 5HHOD 2ED8A 3NTCL 3GMQB 5T33H 1A14L 1OAQL 4GBXD 1QZ1A 1G9NH 3DROA 3ZDYF 4LCIH 4M8QA 5I74C 4XRCB 3VFUA 2AJVH 1MH5B 4NQDA 4NZDA 1Y6KR 2NZIA 3UTPE 1MLBB 3ETBF 4LPXA 4M93C 1K3IA 1DLHB 5KVDL 1EBAA 4HS6B 3CXHJ 4D8PA 4ODUB 5DMKB 1OB1B 3WE6B 1RURL 1YDPB 1ACYH 2ZCHH 1ZT7B 3BH8B 1NC4A 3O2DL 3DYMA 4DZBB 4YNYA 3WFEL 3KYMB 2D9QB 3KJ4C 1R6VA 4JZNA 4IRSD 1KJ3L 2BMKB 3MV9A 2JCCB 4KK6D 3EYSH 1KJMB 4MLSA 4IJ3B 5F7FA 1M1SA 1YC8A 2E7CA 5GGTA 2VL5B 2X4NB 3FRUB 1A1MB 1DQJB 2NY4D 5I15L 2ADJA 4X8JA 2JB5H 4BSVB 5HSFA 1FSKB 2BCKA 1A14H 4ZUSA 1JYXA 5I6XB 4K3EH 4W4OC 3LEVH 1RZGB 1WCBB 2FL5B 4LL9A 3O6FB 1BLNA 1KYOJ 1I9IH 1TMCB 1I7TA 5FM8A 1WFTA 3O9WD 1QSFB 4LCWA 3L5WA 2JB6B 4N68A 4XNQB 3RVWC 1MFNA 3RWHA 3WJLC 5I2IA 2WQRA 3SPVA 2ZUVA 4Z5RB 3ULVE 1IQWL 1OGTB 5ALCL 2LTQB 3DUHA 3EOYG 2AV1A 2DWDA 3LKOB 4Q6IB 4FQ2H 1RJLA 4K55A 3MFGB 4QHNB 5BRZA 5CUSH 3MBEB 4MMXC 1NAMH 2F53E 5FM5O 5AWNH 2EH8H 4U1LB 5JORB 4I5BA 4JRWA 3KGRA 3SQOH 2BSTB 1VACA 3QFJD 3UBXA 4OM0L 2E7BA 2RFXB 5DHVB 2ICWJ 2PF6A 4WCYH 1MY5A 2HRLA 5E56A 4FMFA 4X6DF 3MGTA 4DGVL 3ZDYE 4AG4L 1YJDL 1UENA 3FQUA 2NTSP 1U3JA 1BD2D 3OGCA 5D1ZB 1E4XH 1XAUA 4ZFZA 1MFEH 4P59L 1PX4A 4NQED 4N0CC 4OLVL 5C0AE 3X17A 3BKJH 3C2AH 1XT5A 2JJSC 1ULVA 3T08A 4XC1L 4MA3A 4NC1E 1P7QD 5CP7A 4MCZA 4JFPA 1AGDA 3KNBB 4P4KD 5I30H 4GAYA 5ANMA 4HIXL 2FJFB 2N7BA 1NBYB 4KZEL 3QIUB 5E2JA 2ADIB 5ALBL 1MCKA 4ZS6D 4PD4K 4UTBH 3O45A 1T0NA 3NFNB 2NY6D 1UZ8B 1L0XA 3MLVL 4IRJB 3EYSL 3S3PA 1T89A 2HT4D 1OGAD 1S9VA 2IFGA 15C8L 1KJ2B 1U8HB 1EUUA 1WBXB 2HH0L 5ADOL 2I60L 5LCVL 3QUZD 4FQXA 5K59F 2DD8H 1AHWA 4PJGB 1FGNH 4PV9B 4DJMA 1A7RL 4JRXE 2WAHA 4HFWA 3Q5TA 1MRDH 1RU9L 3GB7B 4XMPL 5JOPD 1YQVH 4XAKD 1LQSR 4HKJA 2HT4C 4AM0A 5TE6H 5DDHB 2ADGA 2IANA 3MNWB 5E9DB 5FB8A 1K4CA 3IDJA 1M7IB 3SE9H 1CFNB 5E6YA 4K7PY 5I6XC 4JO4H 1JRHH 3O4LD 3MRCB 1KCVL 4GMTL 4JFFE 4P4KC 4WI4A 3WS3B 5J9PA 2BZDA 1QHPA 2HLFC 4ZSOA 2X4QB 3OV6A 1BD2E 2NY1C 3NFSH 2NY3C 1W8NA 1KLUB 3C5ZB 5FDWB 4L8SB 3OBAA 4MXVE 4OSUH 3BIAX 3CFBB 2ZSVA 3IKCB 5I1KL 5IF0B 4U1KB 4OF6A 3BMWA 5EUOB 3RX8A 4O2FA 4YJZL 4QHLB 5EA0L 3G5YA 2EDKA 3D85D 4B53A 4G42B 3PWUB 5B3NA 4JKMA 1CXEA 2VXSH 1B90A 3BKCL 4JDVB 2D0FA 1I1FB 4WWKA 1E28B 3CUPB 4ELME 1QRNB 3F6LA 4BUGA 1MCWW 1AXSA 1GPOL 4QYOA 5ALCH 2V2WB 3RNKB 2NX5A 1KN4H 2FO4A 4Q74A 5FM4A 5J12C 3SDDC 5ABDE 43CAA 1Z5LA 5DFWH 4NYLB 5GS2D 3OKLA 4JZOA 3QIBD 1RUQL 3FO9B 5TFSH 1UXWB 1XGPB 2YA2A 1BZQK 3CD4A 1LE9A 3ZKMC 3JVGA 4JJ5B 3ZSSA 3FT2A 3H7BA 4RMQA 3PP3H 5D2NC 1XR9B 2BNUB 3O9WC 1MF2L 4KKCC 1ZWIB 4H0HB 3WDHA 5CJBA 1T6WA 2H6PA 4MXQC 3OXRB 1DFBL 4TTGA 3KYOA 5IB2B 3MV8E 4PY7B 4M62H 1INEL 3N85L 1KEGH 1OTTC 1EMTH 5FGSA 4BFIB 3TFKC 3H3KA 2L4OA 4OSUL 1J0ZA 1NAMA 1YEJL 5IVZB 1AY1H 3U82B 3EIFA 1JWUA 3B9KC 4X6CA 1RIUH 3M8OL 1CXKA 2VNCA 4WW1B 1FLTX 3MCLL 5CMAA 3OQ3B 2FX7L 1EFXA 3MNZB 2NTFA 4KDVA 1VFAA 4P3CH 3OAYK 5EU4A 4WCYL 3O3EA 2P8MB 1I1FA 4WWKB 3LHPH 2NY7H 3BT2H 3TNMA 5FA3B 4WTXA 4HZAA 4XI5D 4DAGL 5F89B 2X70B 3TVMA 1EGJA 4Y4FD 4RDQF 3QUXC 4WUUA 4P3WA 3B2VH 5FHBH 5DQJA 1SEQL 4JG0H 4P23C 1KIRB 5B21A 3QUZB 1CWVA 2AQ2A 4GJTB 4DN3L 2ICES 2FEDD 4OF8A 2VQUA 3S35H 4HH9B 5FDWA 2GK0A 5HHOA 3AU1A 4GBXA 4EI6B 4MA7L 2LQRA 4ZSOB 1A6TB 1IC4L 2AXGB 1U58B 2P8LB 2XWTA 3SJVB 2MOVA 1CGUA 1A6WL 3KJ4B 4XVTH 1NGPL 4HC1A 3I02B 4EN3D 3O3BA 5CGYC 5ACZB 4CVUA 4MYWB 4IS6A 1WC7B 5DUML 3QEQE 2ADGB 2IANB 5H2BA 2AJ3A 4RISH 3GMPA 4F9PA 3HC4L 5F1IB 3TGXA 4P2QB 5T3XH 4G8FA 4HFWB 2AABL 4QRPB 4Z0XB 3WFBL 5IK3A 5HGHA 4Y7MA 2WWMC 4UDTA 3TBTA 1EVUA 1FCGA 1JVKA 3IAQA 4EDXA 4Q9CA 2XPGB 4O5LH 4BQ6A 1UZ8A 1R24A 2IGFL 5KANG 4Q2ZB 1T0NB 2EE6A 2ZG1A 3D25A 1NBZB 3NCYP 3NFNA 2OK0H 1EFQA 5IW1A 3BPLB 4NOBA 4NQCB 5IESH 4YHOH 3IF1A 5EPMB 5SV4A 4TOYL 4KUZL 1AKJB 1F5WA 1F4WL 2IALA 4JFPB 4ODBD 3QI9C 3T3ME 1BBDH 1HK6A 1E6OL 5C3TA 2FHCA 3MRKB 5H35A 2C4FU 2LTQC 1HYRC 3BP6A 2N7AA 3HE7B 4UZGA 4JPIB 4YHPA 3IDXH 2ZSWB 1CD9B 2JIXB 3M17B 3WEXB 3QG7H 2JCCF 1C5DA 1N6QH 1L9NA 5LQBL 3QQNA 3GSOB 2GSGB 1FIGL 1D6VL 2VXVL 3LDBB 4J8RB 1JN6A 4U1HB 2HJLA 5HGGS 1KELL 3RWJA 5IUSA 3TA3C 3U6RB 2Y25A 2E9JA 4YZFF 4MAYB 2EXYC 4MSWB 3KPNB 5TF1L 1DQQA 1JGDB 3W9EA 1X5IA 4I5BB 1QR1B 4DN3H 2QADC 2JELL 3SY0B 1G6RA 5D7LD 4UIMA 4TNVF 1KTLB 4M6OH 4MD4B 4KGLA 5DI8B 2DLGA 4P9MH 4F7CB 4Q6IA 3O2DH 4RWYH 1K5NA 1JL8A 1QQDB 3ZE2E 3C5SA 4ZFGH 3PP3K 5C09B 5E8NB 3UTZB 3DYOA 2D2OA 1NCWL 2XKSA 5FGBC 2HN7B 3S37X 2R2EB 1FN4A 4ERSL 5IESL 1XF3B 4OZIB 3UTQA 1HWHB 3MLZH 5KSVA 4HLJA 4ZXBB 1X3DA 3O41B 2HTLC 3O6FA 3RTQD 1WCBA 3UBXI 1D7FA 3UYPA 2XQBL 5I74B 3QO0A 4DVBA 4X8JB 2IH3B 4Y4KA 3HUJF 1SMOA 3EDKA 2MNUA 5KN5B 2X4NA 2YPVH 3SGKC 2O5ZL 4PGZA 1NAKL 4P23D 3FQRA 4MA7H 1MCFA 3VWJC 4FQXD 3LKQB 4J4PA 2XTJE 4KHXL 4X4ZA 2BVEA 1I1AA 3VXMD 5JQ6L 4NFDA 4I4WA 3FKUS 4HQQL 2IF7A 3U46B 4PGCB 4LRNL 4HJJH 1SYVA 4L4VA 4AQ1B 5EZIL 1BFVL 1YMMB 5KSAD 4BK4A 2BVQA 3VGDA 3ET9F 4X0KB 3SO3B 4MNHA 4RGOH 4M1DH 1F6LL 4LMQI 3SDCB 1NUNB 3RIFK 3VGAB 2R29H 1G1YA 4HK0A 3G6JE 3K46A 4PJ7E 1LDPL 1JPTH 1J8HE 4IM8A 4RCAA 1J0HA 1KC5L 2DIAA 4JFDA 2APVA 4OIBA 4ZO8A 1CFBA 2DYPA 5DA0B 3ZE1E 5C08E 1CDBA 1UZ6E 4MAUH 32C2A 3LS4L 1I8LA 4ODWB 3MLZL 4I9WD 4TSAL 3BEWA 2FECL 2YRPA 4HC1L 4XPTL 3BZ4A 1T1YA 3QI9A 1BVLA 1KYOK 4PREB 1T7WA 5E6IA 3UZVB 1F4WH 1BQUA 4PJAA 3OR7A 3CC5A 4P5MB 2Q86B 1JZ3A 2F5BH 5ANME 4X7CC 4CBPA 4PRIB 1MEXL 3GM8A 4PJ9C 4KI5D 3X3FL 3PIQA 3WKML 1J0YA 3PHQB 4DTGL 3QIBC 2FRGP 1GAFL 3KR3L 1QUNA 2X4PB 2HYMA 2GEEA 3MXWH 4K3DH 5IVOA 1TVBA 2IH1B 4Z7QE 5KSUB 3WHE1 4S1DD 5ADOH 5I1AA 1WFOA 1SM3H 4JRXA 1FVEA 1AO7E 2VITA 4U31A 3NGBC 4AEIH 4WHTA 3UDWA 4I0KA 4PS4L 1LE5B 1BREA 3ARBB 1Q9OB 3E3QC 3LDBC 1WIOA 1OW0C 1R5WA 5L2KE 1DE4B 1G6RH 3AY4C 2NW3B 5LBSH 3QZWG 1I8MB 1YEEH 2ZCKH 2MTPA 3A0OA 4PR5A 3SE3A 4B7LA 4G43B 1MCDA 1JGVH 2DQIH 3T4AA 1PYWB 4U1JB 4XNXH 4D9QD 2FBOJ 3MRJB 1E27A 3VDCA 3O9WB 5LAXA 1CDIA 5HGAA 3FQXB 3VGEA 1UKQA 3HUJA 1YEDB 5CGYD 1J86A 3BUTA 3MRNA 1EFXD 3N1PC 2UWEE 1A9EA 1HXMA 3BZFB 1U42A 2FR4A 3OKDA 5JOFB 5BV7L 5CEYA 1NCBH 4L4VE 1HILB 2J8UA 3QWRD 5C07D 3OJ2C 5EOQH 2ATKB 3FO2B 3IAPA 3P30L 2E27H 4XXCA 4P2RA 2SEBA 4PRHB 1CTOA 3CFIC 4KAQL 3ZHLA 1H8SA 2V9QA 4WUUD 4XMKL 1GPOH 2DL2A 3BH9A 4JQXA 4XPTH 4TQEL 4KU1A 5EBGA 2CLZB 4LLDA 3F7YB 3RX5A 3V7AG 1FFOB 2HVJB 2ID5A 3QIWA 4HJJL 4S1RH 4R2GB 3QZWA 4ZS6C 2VE6A 2OL3B 3SDYL 1SBSL 3MO1B 1FORH 1KPUA 4JN2A 4JY5H 3HR5A 1ZHBA 5MENE 5CJQL 4GOSA 1BMGA 2KUTA 1JGVL 5DJ2B 3QHZH 1NAKH 5DR5H 4OZGB 1HNGA 5ESQA 2EDXA 4JDZA 4QT5A 4AH2B 2DJ4A 2LFGA 1JPGA 3GJFA 1IFHH 1DBJL 2VZ1A 2YK1H 4XNZC 5JZ7D 5MEOA 3I6KA 5B8CC 3C09B 4QWWD 4ZG1A 5LGJB 3BN9C 3VFTB 4HS8L 1U3HD 5F3BB 5FM5M 5D71L 3D3VE 2P7TA 5TPWH 3BHBA 2XYCA 1HQRA 1N0XH 1WZMA 1T66C 2DLFH 4HULB 5FF6B 1A6ZA 3GJEA 2HVKA 4U1IA 1NFIB 5SWZA 4FXKA 4XNUH 5L2KA 5IB5B 4I0PB 3K74B 4X5WB 5GGSB 4NQUA 3LKPA 5D9SB 1V3LA 4OF3A 4PIRF 4WHDA 3RWFB 2BJML 1P7QB 4JPWL 2D9CA 3S34L 2VDMH 1XF4A 3QIUC 4G6FD 4NQEE 4KY1L 5J0BA 4O4YL 4PTTB 3GFUA 3GSXB 5DR5L 3KPSE 4X9IA 1EO5A 1HHGB 1WBZA 5HHXL 1P9MA 3ULUD 1OCWH 2A9MH 3S88L 2EIZB 3RVWD 1OF2A 1RVFL 5CIPH 4TUOA 1JWMB 1SBSH 5DHVH 5L8LB 3O81A 3T77A 1X6LA 1X5FA 1MFDL 4H8WH 4JFHE 1U95B 3TO2B 1DVFA 1TQCB 1NMBL 4OUOA 4AQOA 2CDGB 3PQYB 4WEMB 1OAXH 3T3PF 4C54A 1HOCA 2VDOH 1EH9A 4PTUA 1N59B 4L3EA 2P5EE 3BP5A 3EHBC 3RDTC 1OWRM 4BFGA 4JFYB 3E0GA 2QEJA 5D7IE 2OM5A 4Q6IC 4YHMH 3DX8A 4ONOA 3V6FB 5FYJE 3VXPA 3CDFA 3IDIB 4LU5L 3VWJA 3KLHC 4Z7WB 5TDPB 4L3CB 4U6YA 5EDXA 1NUDA 1UJ3B 3QDAA 3D3VD 3ARDB 4XCFL 2EKSB 4ZYKA 2WP3O 4MDJA 4PRPB 2AV7B 3MBEC 4EIGB 3VH8A 3MTRA 3OKMB 1QYGL 4TRPL 1T5XA 4N8CL 1H3VA 4GQPH 5JUEH 1VERA 5DT1H 2EDWA 5F1OB 3NIDE 4ZTPH 3W5NA 3S88H 3UMTA 5F9DC 2AXHA 3GGWA 1X5GA 1YEKL 5DD3L 2YUVA 4PRAB 2CR3A 1UB5A 2N1KA 5EC2B 1E4KA 1QLEL 4UI2A 1ZSDB 3MRRB 2X9YA 3LN5A 3RDTA 5HGBA 3CFCL 5KS9A 1I3GH 1P4LB 5SWSA 1Q9LB 4HCRH 2BOBA 2NY2B 1IC5H 4NZJA 4IMLA 3BFOA 4J4PD 4PB9L 5CP3H 3W0WE 3VJ6B 3VXMA 4UTAH 4KJQD 1J05A 2CLRB 3VRJA 3ARQA 4IJ3C 3JWDH 2WSKA 3PGCA 2FH8A 3ZKXC 4M93B 5KSAA 8FABA 1IZKA 3IS1X 2WBKA 2X4UB 1GGYA 2EYTA 1CL7H 5DEFB 2NY6B 3HPJB 1ZLVH 3MRGA 1SEBA 4XAWL 1I7UA 2BK8A 4LK4A 4QWWC 2JJVA 1CF8H 1NMCB 2FX8L 5E5MA 5JXED 4U05A 5FYLD 4DEPC 1CXFA 2O61A 2XWJB 3BWAA 4GAJL 1ZHNB 2D4DA 1RUAH 5F7LB 3BEVA 3RFZC 1GOGA 4OCRH 2QHLA 2LABA 3BD5A 1N8ZB 1H3WM 5INCB 4I3RL 4ZUVB 1NGXA 1PY4A 1RK1B 3BESR 4JY5L 4FMKA 2VDRH 5CINH 2A9NL 1AQKL 4LKXA 2ED9A 3MCKB 3TC9A 4OZFB 4J6RL 3U0WH 3EKCA 3HRPA 4XH2B 2AJUH 4FXGB 4PGDA 3BQUD 4ZO9A 1J1OH 1F4HA 5FYJL 1RUML 3VFRA 1LO4H 3KHOA 4L3EE 2VDNH 2X89A 1HE7A 4LLVB 4HV8A 2W60A 4KQ3H 5CD5D 2X05A 5DJ8B 1AGCB 5D4QA 1N6UA 4PJ7B 3TP4A 1OAUL 1JPTL 4M6OL 2IJ0C 4R90H 4PJ8B 3U83A 4NKIL 4DOHE 5GS1B 3G9VA 2YPLA 3TPUB 4KRLB 3UTSA 4OF7A 4FZ8H 5FO7B 2NYYC 4WO4C 1RJYA 5EBWA 1IM3B 4LCUB 2PTVA 1DBBL 3OKOA 4HUXB 4PRNA 4I3SL 1W72B 5IMKA 1Y6NR 1IGIH 4LEXL 5GPRA 4DZ8A 3F7QA 3IS0X 1A7PL 4P2CG 2B1AH 1S9XA 1YNLL 4YXLL 5HHOE 3RVTC 4KK6C 2VO5A 1PSKH 5A2KH 5BQ7B 3U7YL 4X9GA 3MC0A 1FNLA 5HHXH 1YUHA 4ISVA 1OQXA 4PJIE 3ARBD 2BSSB 1MIEL 1B4JH 3W9DB 3VMOA 3HI5H 3MMEB 3TIEA 1TPXC 4RAUB 3V0VB 1FHGA 1NMBH 4HUWA 2H32B 4ODTH 1HQ4A 2V17L 4DKEH 5HHQA 5HYSG 2HP4A 1PZUB 2B4CC 1IGCL 3CVIH 5H94B 2XQYG 4U7MA 2E27L 1IEBA 1IGTA 1X6NA 4F7EB 1SM3L 2R9HC 3GMRA 4YBLC 3RVVD 4UOW1 3VFMA 1P2CB 2D03L 4Z7NF 2X5PA 2UWEA 3MOBL 4Z6AT 1HH9A 5EO0A 4U1SA 3PJSB 3D69B 4HUUB 4M6ML 5F7HA 2EDJA 4GW1B 5F7EL 4KHTL 3TNNB 3VCLB 3MBXL 4IBLT 2P48B 1YNTA 1REIA 4HWUA 1UM5L 4NNPH 4KI5C 3G5VA 2C3HA 2BVPA 5AUMA 1KIUA 2KDGA 3C8DA 3MUHL 1H3TA 3TJEH 2BNRD 2EC8A 2R69L 1D6VH 1FNGA 5EIQA 1NJ9A 3RGVD 1U3HC 1TIUA 2R2HB 1MVUB 3DRQA 1MCRA 4CDGC 1BVKA 4PS4H 1A4JB 5DVOA 4Y4HB 3SE4A 4RIRB 1FFNB 3OAZK 1AR1C 3IB4A 1M71B 3WNPA 1CGTA 1AJ7L 1T1ZA 4HF5H 1KXVC 2D0HA 1QLRB 4HGWB 3MRDB 3QWOB 4OM1L 4AK1A 3G08B 1CDHA 3KPLA 2Q3ZA 3BIKA 3EDJA 3WFCH 3VD3A 4OCSH 5FYKE 3BZEB 5IT2H 3HA0A 3IDYC 1CLCA 2ORBH 4WJ5B 1NCCL 4ZAKD 1MI5D 1LO5A 1QVOB 4HBCH 1T83C 4F80A 3O3DA 2F54D 1B9ZA 3MRIA 1KIPB 4NHCH 4GG8B 1MHCA 5EU5B 3QNXA 1WFUA 1HYSD 3QEGH 1MCOH 1U8KB 4M1CD 4ORGA 3GMLA 5E2VL 3IVKB 1W0WA 5F3HB 3S37H 3MRHB 4KMLB 2QKIA 4BZ1L 2FGZA 3TZVC 4PJ8D 4EUPH 2B4CL 3MGOB 4ONHA 1GL4B 1SY6A 3WHXB 4OQTH 3HG1D 2CUMA 4FNLL 3LKNB 5ITFB 1CXHA 2YN5A 5FV2A 2FH6A 2BX5A 2WIMA 3OKEA 4LBEA 2CDFA 2LVCA 3BAEL 5C0RH 4J3XA 4D0CA 2PCPA 5CLTA 4O51A 5AZEL 4ZD3H 1XEDA 3ZT5A 2HFGL 4J3OC 4NHUA 4YDVB 4KY1H 5F7EH 1RUAL 3NZ8A