3AY4C

Crystal structure of nonfucosylated fc complexed with bis-glycosylated soluble form of fc gamma receptor iiia
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
170
structure length
160
Chain Sequence
LPKAVVFLEPQWYRVLEKDSVTLKCQQWFHNESLISSQASSYFIDAATVDDSGEYRCQTQLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVQITITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for improved efficacy of therapeutic antibodies on defucosylation of their Fc glycans
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 32
structure length 160
sequence length 170
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ay4C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ay4C02
1NGYB 1I1AB 4MGXA 5DGQA 5GGRY 3HCVB 3RGVC 2BNRB 1N64L 1F5WA 1DP0A 4OF6A 1RU9L 1A5FH 4F8QA 5GRJL 4MQ7A 2C7UB 1UZ8A 4UTBL 5IESH 5E2WL 3WHXB 3HMXH 1A6UH 2PR4H 4P5MA 5I6XB 4P57A 3MJ9A 1IT9L 1OW0A 4PLJD 1FFOB 5ERWB 1YEKH 4GKSA 7FABL 4PRAB 3TJEH 4LSUH 1V3MA 3RTQC 4L3EA 4S0TD 4JKPH 2GSGB 1KTDB 2W65A 3OKNA 3VG9B 2BZDA 4D8PB 3DROA 3P0GB 5DS8A 2P8MB 3DXAA 1VPOL 1A6WL 5EU6D 1P1ZA 5D93C 1MVFA 3QIUC 1HXMB 1KNOB 3ELAT 4NFDA 1F3JA 5F89A 4IOIA 2CRYA 5A40E 2N56A 2XKSA 1QQDB 1RY7B 1W0VB 1Z0NA 1LEIB 2OMNA 5KSAA 1LO0H 3B9DA 4G7YH 5CP3H 3SDDA 4OZHA 3K8MA 2X10A 2PW1B 3I2CH 4OCXH 2QHRL 1JMXA 4P4KD 3O4OC 4WFED 5JOEA 4PJEB 3S36X 2W38A 4HXBL 1H0DB 4JGJA 3FOLB 4TYUA 4PRNB 1RVFL 3QFJA 3SPVB 1RMFL 4JM4L 2WK2A 4R7DA 2CKBA 5MEPA 4M48H 3B83A 5F9WB 5LGHH 4R90H 3G6AB 4ZPTB 1A7OL 3S37H 3JVGC 2ZKHL 5KOMC 1R3KB 3JWOC 4FTVD 4G5ZL 5GXBB 4PBWD 1Z9SA 4M43L 4QHLB 5DRWA 1IM9D 5GGQH 1OAZH 3PWJA 5HHQA 4K23L 1QEWA 1UM5H 2BHUA 2XZAH 2OZ4L 2ZOLA 2WV3A 5I8EA 1CF8L 1QPPA 1MI5A 5BXFB 4QRRD 1I3GH 4CNIA 1KYOK 1ZT1A 4DK3A 2H8PA 5C6WH 2KUTA 3RWGB 4YO0B 1KPUB 5IGXH 1GGUA 4BZ1H 4F9LC 4J2XA 4UDTA 2X4PA 4IRSB 5L8KB 4OIIL 1F4HA 1L0XA 5IBTL 3EOAA 4U7KA 5DK2A 4LVOB 3O0RH 4KHTH 4TVPD 3RX8A 2IG2H 2APBA 1HQRB 4OV5A 3KR3H 5FA4B 1X4XA 1CGSH 1RJYB 1RHFA 4NKDA 3BGAA 43C9B 1KNOA 3UEZA 3BMWA 3PV6B 5BVPL 3VGFA 2BFVH 3GKZA 1ZHLA 3S36L 3EJZC 3OJDB 4PTUA 2JCCA 1A1OA 4XVTL 3BXNB 4LBEB 1RUQL 4ODBD 3LDBC 1IARB 1YUHA 1U36A 1BOGA 1KTLB 3NACH 4JGUA 4Z7WB 4DEPC 2ZNWA 1WT5A 2Y07H 1EO8H 3MLXL 1GSMA 2NX5A 3WHXA 3QCUL 2AERT 3GB7B 4WWKD 1YYLH 5JORA 3N0PB 3HLAB 5JHLH 3NABL 1ZOXA 5GHWL 4OAWA 2G9HA 4ZAKC 1L9MA 2ZJSH 4FQCL 5IB1A 1X5GA 3EGSA 5MP6H 3W11C 3DX6B 4WDIB 1XGRB 3GGWA 5I1DA 4FFVC 5HGDB 1WT5C 4DAGH 4AG4L 4YDIL 3P77B 1V5JA 2RBLA 1MFCL 1TTUA 5J9PA 3SDCC 3BD5A 1P9MC 3RGVB 4M62L 1DBAL 1CFSA 2ICWJ 3IRPX 4GW5A 2DQUL 5MI0B 4PJGB 4C56D 5F7EL 2VLRA 3C5SB 3ZKND 2Z92B 4JB9L 4EVNA 1G7PA 5EZIH 1UC6A 1SMAA 4KJPC 5E6IA 8FABB 1E4XL 4ZTOL 3NIGE 1S7SB 5I16B 5HHOE 1JGUL 4QRPD 3VXUD 3STZA 2NY4C 3RIFK 1QVOA 4PRPA 5MENA 4XPTL 3VXNA 5FO7A 1WC7A 4LCWE 1NFDF 1JL8A 1DSFL 2YD8A 5BS0E 3QIWD 1AH1A 2NY7L 5IJVB 4HQQH 3DO7B 4TOYH 3F7QA 4A6YA 4I3GA 4LHQB 3HC4H 3WNLA 4OLXL 3CVHH 2X89D 1IAOA 4FZ8L 5HGAB 3EOTH 3GRWA 3IFOB 3U0WH 4L4VD 4LRNH 1QHOA 1IKFL 2Y5EA 1KIRA 4O51A 2N4IA 3FO1B 2XY1A 5D7JC 3T0EB 1INDL 2LABA 3GFUA 2VLME 4KJWC 4DGYH 4HUUB 5FYKD 2QSTA 3OZ9L 2FBJH 3V6OC 4HIHA 5D7IA 2AJYH 4OLWL 3D25A 5CSGA 3W2DH 4PGEA 1AC0A 1CLCA 2J12B 4Y2DB 1U8MA 5DYOB 5DVMA 5IW6B 4HMDA 3V6BR 1WWAX 2HT2C 4K8RC 5GRVK 5IB5A 3G5VA 3TJEL 1OP5H 2R9HC 1TCRA 1QLRA 1CICC 4EXKA 3C2AH 4OZFA 2X4NB 4OLUH 4LCWA 4L4VE 2XA8H 3ZKQD 5GRWA 2PO6A 3ZKSD 1YEFL 3QIUB 4R4BA 3U46B 4NKOA 3ULUF 2WQ8A 4U1MB 4Y5VA 4AJ0A 4F8TA 1HEZA 2RHEA 3RWCB 2I25N 1Q72H 1YEEH 2BDNL 1KXQE 1PKQE 2FWOA 3OKYA 3ZYJA 3VD4A 4YZFF 3P40A 5K9JH 1IGML 3QXAB 3MUZ1 4MA7H 2YD1A 3TN0A 1F11A 4OBSA 4C58B 4NKOB 4TNWK 4KRPC 3VGHA 2HJFA 4PY8I 4QF1A 2DQDL 5AUMB 3O0RL 1S5HB 2OSLA 2VLLA 2ZCLL 3HRZB 4HGMA 4G9FB 1OPGL 3GI9H 1MJ8H 5KN5A 1UVQA 4JFFD 3L3JA 3H6JA 5TGBB 4GRWH 4C57C 4L1DA 4NC0B 3QIBB 3HC3L 3JV0A 3LOWA 5K9QG 1NCUA 1I1CA 3JSSA 3QP3A 4LF3A 5T1DH 4K7PL 3QRGL 4HK3N 2Z8WC 2RB8A 3H8NA 5FXCH 5D7IB 4TNVF 1P53A 5KG9B 4X9GA 3OR7B 4ENEC 5IKCA 3BSZH 3BPOB 3RA7L 4PJ9D 3KXFD 1MAJA 1R3IH 4NC1C 2FBJL 3ULVH 1XH3B 4K71B 4Z7UA 3VFRA 4WEMB 5CLTA 1IL1B 3OKKB 4PIRF 5EUOB 25C8L 2H1PH 1MUJA 1SYVB 3BEVB 4PGCA 3IVKA 4JHWH 1QRKA 15C8H 3F58H 3N50A 4EDXA 3MV8B 4HWEH 1MCKA 3PQYE 5C0IA 3RJQB 3TFKC 2IJ0C 4R26H 4L3CB 5KVMC 4DJMA 1FN4B 3SKNB 1S7XA 1KIQA 4HUWA 4JDVB 4PJHE 3SY0B 3QCVL 5FIEA 1TXKA 1ZVSA 1NSNL 1PG7L 4HSQA 4NQDB 5D6DC 1T83C 4WHCA 4XNQB 1CL7L 1OF2A 3BKYH 3HC0A 4EQ3A 2CXKA 1UCBH 4EVNB 4ZTPH 1RK0B 5CEYB 3GEWB 1X5XA 3P30L 3OXRB 3O3AA 5J11B 3VG0L 2HTKC 2RQ8A 4HUXB 3CSYA 2NY5C 2XFXA 5J9PB 3SDAD 4QXGH 4B53A 1S7TB 1KB5L 1RHHB 1S9XB 4JJ5A 4NIKB 3ES6B 3KYOB 1EH9A 1IVLA 1G6RB 1N6QH 1FVCB 3D0LB 4H1LH 3ILQC 5JZ7D 1PZUB 3L9RB 4FXLA 3PP3K 3GJEA 5F7MC 2NQCA 1PDKA 3FHAA 2VQUA 2ERJB 3T4YB 1YMMB 3W82A 2XTLA 3I9GL 1VFMA 3QQ4B 2HVJA 4IOFD 3V9FA 5I17A 1KPRA 4DAGL 1FPTH 1LWRA 5JR1L 1KXVC 5SX5K 5FDWA 3NTCL 4HW6A 4QNPE 2YD7A 2OP4L 3X14B 1HNGA 4KKBC 4YHYC 3L3GA 2DQHL 4HGWB 5CLWA 1DBJL 4NQXA 4OT1H 5I0ZA 4M9PA 5GZNC 1I9IL 5AWNL 1N2RA 3ZL4L 4PGDB 1GC1C 4RQQB 3SCMB 4XBEH 1A47A 4KWUA 1CGTA 4WEUD 3ZTJG 1P4IH 1QFOA 3E6FB 1NUDA 2BHZA 1RJYA 4TULH 5FA4A 3ZTNL 4Y4HD 1BX2B 5JW4N 2IALA 1QFUH 1PG7H 3TO2B 1Q9WA 5F1SA 3REVB 1C5CH 4KC3B 2BX5A 1ES0A 2PN5A 5JO5B 3JZ7A 4PJ8C 1U3JA 4JDTH 4AM0B 1BBDL 1CDYA 2V2WA 3C6LA 3SDYL 4QXTB 1R5WA 4K3JL 5KSBF 1K4DA 4DKAA 4CMMA 3CMGA 1MEXH 2C3XA 3QFJD 5FB8A 4YO0A 3DSNA 3O3BB 4GO6B 3VFMB 3MO1B 1WVZA 5IVNA 3N9GH 3SE9L 5I8EB 3H9HA 3GMRB 4OSUH 5CEXB 3MROA 2X4OB 1H3PL 3IJYA 2PYED 3WLBB 3KPLB 1BQSA 2YRLA 2AV7B 5CHNA 1QNZH 2I24N 3B9KB 1AGFA 2HG5B 1BZ7A 5DUBB 2QQLL 4FFZL 1S7RA 3MCKB 3TBTB 1ZWIA 4NQSA 4N8VG 2FD6L 4M6OL 5FUOH 5D5ME 1JGVH 4Z7UF 4OCYL 3O4LD 1JNNH 1EX0A 1CDBA 3F7VA 5DJAB 1QR1A 3VFTB 5TE4L 3TO4B 1S9VB 1AY1H 3I02A 4KJQD 4OZIA 5I74C 5HGHA 2DQTH 4XAWL 4NUJA 3TVMD 3PV7A 5E2UL 5DHYA 5TPWL 2JJSC 4U1LA 3ARFB 1YY8A 1QFUL 2LAAA 3DTXB 2WLYA 3TIEA 4ZAKB 4ZAKA 3FO2B 5LWYH 2FH6A 2EE3A 1B0RA 3MCLL 1F3JB 4UV4L 3V4PL 1MJUH 1VENA 3U9PH 4S1RL 1FP5A 3TIDB 1AFVL 4ACPA 2FEDC 5GGSY 3QDGB 5FGBC 2VRAA 5D6CA 3U0PA 4L9DA 1K2DB 2KPNA 3CVIL 1B88A 1OARL 4JKWA 4C4KT 3OKNB 4V2CB 3PQYA 4NUGH 12E8H 2CUMA 4Z7QE 3HN3A 4WHYG 5AD0A 4JR9L 1YYLL 1I85C 2IANB 3LRGA 4TSBH 5DD5L 4XNYH 3HG1A 2ORBL 1RFDL 5L2KE 3SDCB 1PBYA 4YQXL 4I5BB 2F5AL 1KB5A 3HMWH 4W4OC 1KT2B 1A2YA 4Z7OE 3DLQR 4DTGH 3CZJA 1N5AA 2BNRA 1E4WL 4X6FB 2Q87A 2C3WA 1IAIM 3HCVA 1OAQH 4PRIA 3WUZA 2Z31A 3E3QC 4M5YH 2BOCA 3LN9A 3IFNH 1RSFA 2DQCH 4V2BA 3BGFB 4WHDA 4DGIL 1FVEA 3K1KC 2BSSB 2EH8H 4N0FA 5IV2A 4JRYA 1BQHG 1BD2E 2HKFL 2ENSA 3WL9B 3FFCB 1E6OL 4FZEL 1PG7W 5C08E 3ZDYE 1NKOA 2BSSA 5IV2B 1Y6KR 2J88L 1QSVA 2QEJA 5DUPL 3RTQD 3BX7C 1I3RB 4H5SB 2JJVA 3SGKA 5EBMA 1Z9OA 4ZUVB 3I6KA 3MV11 4LHJB 3SCMA 2BVYA 1ZTXH 5T1KD 1MF2H 1K8IB 4XPHL 3HAEA 3VI4E 3EKCA 3LV3A 3BP5B 5T1LD 1GC1L 3QYCA 3TV3L 1ZT4A 5F96L 3R06B 1OAXL 4LRIC 4PJHB 3MJ7B 3ME0A 5BV7H 1CFBA 1R0AH 1H15A 4PY8J 4LP5A 1B0WA 1W0WB 4R4ND 3MFFB 4LVOC 1R3LB 4NBXB 1WFTA 5CBAA 1MRCL 2E6PA 4Z0BH 3VXSD 4P2OB 3I6LD 4JRYE 2OZ4H 5HVHB 1FG9C 1PD6A 2ORBH 1TETH 3NZ8B 2AK4D 3S7GA 3MRMA 4DGVL 3T3ME 1EEQA 5EU4B 2YK1H 4M8QB 1ODAA 3O9WB 3BP7B 3WUWB 1U93A 4KI1A 1U8LB 1O7SA 4Z7OF 3PWNA 4GMSH 1KEGL 3STLA 4LSSH 3OXRA 3HTLX 4AZ8A 1U8QA 4X5XB 2YN3A 2Y36H 2MNUA 1F58L 1JBJA 4OCWH 3RTQA 5L2KA 3L3DA 2EYTB 3O6FD 3WV0A 3UMTA 1S9KC 1UCBL 3VFTA 3O81A 1D5ZB 4N0YH 4HC1L 3FQXB 4L3CA 3MJ8A 5EUKA 3RVVD 5HHVH 4NO2A 1LQSR 4P2YA 2JCCF 1F4AA 4ZSOB 1QG3A 1V3KA 1NCWL 3TBWB 2CGRH 1DL7H 2ZPKL 2NZ9D 3HE7D 4Q9RL 1NC2D 1Q9KB 3AY4C 2ZUUA 3OKKA 1E4JA 2MCPL 5ISZB 5EO9B 1O7VA 4O9HL 3BKMH 4HF5L 3VFMA 3ZDXF 4L8CA 2XG5A 4G6KL 3RX5A 1R0AL 2NR6D 1D6EB 3CH8A 2I07B 4HKBB 4L29B 5F7NC 1EUUA 1JVKA 3AREA 2VDRL 1KB9K 4HJ0C 2VDLH 1NBVL 3CAFA 3KPRA 2GUOB 4I13B 1CU4L 3REVA 1F2XK 2VZSA 3BD3A 4PP2B 4ZYKA 1H5BA 3TH2T 3EYFB 1RUAL 2P43B 3CFDA 3NOIA 4K9EL 5DDHB 1FSKB 1QSFE 5BZWB 3ILPA 4MAUL 4U1SA 5IB2A 5IHLB 3LN5A 2F8XC 4NQCB 4OI8A 3CZFB 2ARJA 1C1EL 3I84A 3JUYA 2VC2H 1IC7L 3HAEG 1EFQA 1KN4H 2EDHA 3GHBH 4ONFL 4X6CE 3Q5OA 5J8OA 1XGUB 2RR3A 4CVWA 4DZBA 4G7YL 4YZFE 3L3GB 2BVQB 4IRJD 4WCYH 4XPBH 3ROOA 2FEEL 3B6SB 4QTHB 2DLFH 1CIUA 5DQDH 1KPRB 1AKJA 1AI1L 4LCIH 3WN5A 1B3JA 4OFDA 1JZ7A 4NDMA 4JM2F 4UT7H 2VKXA 4LCWB 2GJZB 4UT6L 1Q0YL 5B39B 1WV7T 4WNQB 5E9DA 3DV4A 3V95A 1FL5B 4XPAH 2X4UA 4ERSH 1FVCA 2H41A 1DQLH 3D25B 3VMNA 1BVLA 4HF5H 3U36B 3GMOA 4LQFH 1S7TA 4JFXA 3UBXA 2AJUH 1J1OL 1KGCE 4HUXA 3MLXH 5EZOL 5F96H 3RL2B 4ODHL 3LKPA 3BIAX 4G6AC 4WENB 4WTZG 1DUZA 5D1QA 3JWDH 4Z78B 2V17H 5HGAA 3KPSE 2R2HB 5IB3A 4BQ9A 4LSQH 1NMBL 3QDAA 4GS7B 2Q76B 1YEIH 4DUXA 1FC2D 2AEQH 2XN9E 4ONFH 3BYTA 5FKPA 5HGGS 4XCFL 3RVWC 4FQIH 3MV8A 1AD9B 4CKVX 3VXNB 5KAQG 4K94L 2W60B 1RZKC 4IBLT 2P8LB 2QADC 3NA9L 4UV7H 5EZIL 1UWEH 15C8L 2R2HA 3GSNH 1N4XL 2OJZH 1JGLL 3QFJE 1AJ7H 5DJZA 4NNYB 1DVFB 1ETZB 4LSSL 3FJTA 4N8VA 1JGUH 2ZCKL 2R4SH 2QADB 4UB0H 4H8WH 5FK9B 1RJLB 3QXWA 2A9MH 5IFJB 4PJIA 4FQXB 5EWIH 4FFYH 3QJHA 4JZOB 5KG9A 2P5WB 1OSPH 1X7QA 3RWIB 1K4CA 4UINH 1RFDH 5D70H 1KCSL 4JN1L 4TTDC 2WWMC 4GS7C 4YGAB 1XF2B 1NUGA 2GJ6B 1BD2D 1I3GL 4NO0A 2DLHA 2ICES 2R0KL 4YEFA 1BFVL 4WNQA 5F6HI 2NW3A 1U3HB 1VADA 1IT9H 1M6OA 5CJ8A 4PLOB 4N90E 4ELMA 3EHBD 5DURD 4HBCL 4LPXA 5MHSD 5A3ID 4POZD 1T1XA 3O6LL 1JV5B 3ROOB 1YUHB 2ZZUT 3QXAA 3HS0B 4LHUA 4MAYD 4YDJB 4ZUSA 4KK9D 5D7JB 3CFEB 4G6JL 5GGRA 3CX2A 4QRUA 1SJHA 2B0SL 2O5YL 4K8RD 4JDZA 1AHWC 3PV6A 2EEBA 5IMLA 1ZS8A 1AGEA 3O6FB 3V5KB 2PXYD 1A6VL 3LS5L 1C5DB 2KBGA 4NKDB 5DJCB 2D4DA 3THMH 5K9JL 3PWPB 5T3XH 4EOWH 2RCSL 2MFNA 4TNVK 4NWTL 1J1XL 4TTGA 4MDJB 2GJ6E 4ZUWB 3G5VB 5IVXE 3MOAL 4QRSB 3UXFA 3VXRE 1YQVL 1FRGH 4P3CL 4FQCH 4RMQA 3EO1B 4Y2OA 3C6SB 1U8KA 4JY4A 1T20B 1MIML 2AXJA 2Q8BL 3VXSB 3VU2A 2EZ0D 5SWZE 1F90H 4TNWF 4WTZA 1PJ9A 2J8UB 2EDYA 1F2QA 4APQB 1FZOA 2OK0L 1GXEA 1KIRB 4O51B 3FKUS 1QEWB 1OTSC 2NMSA 2EECA 3PWJB 2Y25A 2MOVA 1DLHA 1RZ8B 2VLKA 4KHXL 2AV1B 1IZJA 2IQ9H 3D85D 4JG0H 3SBWC 2P46B 1JNHB 3OKLA 4JFEB 2CK0L 1S8DB 4MB4A 5AYQA 1IC4L 4Y8AA 4YHLH 2IPKB 5KBNC 2R39A 5AYUL 4JHAL 3LDBB 4WWID 5MEPB 1NJ9A 1EFXA 5JXAL 1PX4A 3ULVC 5HHNB 1BM3L 3CH1A 2CO6B 3CPLB 5FCSH 5JA8B 3UC0H 4P49A 4MAUH 4S2SA 5IW3A 4YHOH 1CXIA 3IDJA 3QXVA 3WNOA 5D9SA 4HIIB 1NCDH 1C5BL 1XF5A 5E6IB 3RTQB 4KMLB 3CXDL 2YKLL 2JB6A 1I1YA 2GIYA 5HDBE 3D2UD 3I2CL 1U8QB 3FO9B 4GW5B 3IDXL 4LCCC 4HWEL 5J6HA 5DLMH 3RGVA 4PLKD 4HIJA 1HQ4A 2CUHA 1LILA 3SKMB 3B3IB 2V7HA 2XICA 3DX6A 2LQRA 4G6MH 5IHZB 5AZEL 2W9EH 1JPSL 3CFKB 4K3EH 4L4TA 4P2OA 4YHZH 4CBPA 4P99A 3KJ4C 1JNLH 5DQ9A 4CN6A 2AK1L 5DVLA 1KIPA 3LMJL 1U9KA 3P11H 4UTBH 5IESL 3S35X 5JHLL 2XNAB 4P57B 2DIJA 5BO1L 1DQLL 2IAND 2ERJC 2WM0A 1EO8L 3X13A 5MP6L 2ZCHH 4WFFE 1YPZB 4O02H 4PJFE 2W0PA 4RDQG 4P2QA 4NKMA 3GSRB 1AD0B 2D31B 4YXHL 5EWIL 5GRYA 5E94A 3NABH 2JJUA 3D3VD 2EEAA 4GG8A 3MBXH 4PG2C 1J5OL 5E08H 4Z95L 1QLFB 4XNUL 5FYLD 4HKZB 3RVUC 2R0ZL 1DBKL 1C5BH 3H0TA 1NAKL 2VDKH 3BGMB 1R24B 5D96B 3P0VH 4JZJB 5J3HC 1QFWH 1X44A 2IGFH 5IJKC 1OGAA 2DF3A 4ZAKD 5ESAB 1YEGL 2Z91B 4HV8B 1ZK9A 1R6VA 1TTFA 4Y4FA 2XZCL 5EC2B 1EEYA 4KDWA 4LMQI 1NGZA 2BY0A 2Y06L 4MNQB 2X4PB 4IRSA 4ORZC 3OJMB 1U58A 3GI8L 4PLJC 1MAML 4PS4H 1NFKA 1T22A 5DD1L 2P47B 1Y18A 5D4QA 2PTUA 4B41A 2H8PB 2E8ZA 4HG4J 3MRJA 4ZOCA 1MI5B 5BXFA 1BFSA 3QUMB 4NQCE 4OZHF 3B9KD 3OKOB 5DZNA 2DMBA 3G5ZA 3LQZB 1YNTB 5I1CL 4OUUA 2EC9T 2HT3C 5DRWB 3BSZL 4G6KH 3HZYA 4HIXL 5DT1L 3EO9L 4NRYA 1ZANL 4X7CC 4XHJD 5EZLA 1TJIL 2B8OT 3HPLA 5I6XC 4R7DB 3UTTA 3CGTA 5DD3L 2VOTA 3CK0L 2Y9RT 3QFJB 3U0PB 3R1GL 2QSCH 2EIZB 1K3ZA 4PJEA 5HHOB 4F3FA 1C16A 2X4QA 4I2XE 5HYJA 2IC2A 4WI3A 4M7JL 1EVUA 2ZG1A 4XVJH 3T1FB 4JO1L 1JN6A 1YNKH 3DMMC 4DZ8A 3FL7A 2Q3AA 4RBPH 3IKKA 3OKDA 1RK1A 2I9TB 3WDHA 3NVQA 5DHYB 5F7WC 3WFDH 4NUJB 2QHRH 1AIFB 5I9QB 1P6FA 3HZKB 4W6WB 4Z7VF 1S9VA 4HLJA 1SEQH 3OAYK 5E70A 4Z7WE 4XMKL 4G8GD 3C08L 3LKSB 5ESQA 4UNTA 3UYRH 4LKXB 1JPTL 5C07A 3VFPA 3K3QA 5KW9H 2AJ3A 5D2LE 1BZ7B 1A9BB 4M5ZL 5L8JB 3GKWH 1BWMA 4U49A 3IDYC 1A02N 4RSVA 3KPLA 4HJGB 1HXYA 3Q3GA 5HGBA 1GRWA 4G80B 4X8JB 5TF1L 3U4EB 2HJKA 1YMMD 4Q97A 1LO5A 4CUCA 3CVIH 4JFPA 3GHEH 4WFHE 2YPLB 1EIBA 4M9OA 1W72H 2GYSA 4W6YB 3P0YL 4HDIA 5E2WH 4ZO8A 5J11C 1QBLL 2GTZA 3WCYA 1LP9A 4M93B 4BQBA 3VFGL 1K6QL 5DJDB 4P23C 2OL3L 4PY7B 4LLAA 3NAAL 1YY9D 3V5HA 2ESVE 4NBZB 4TULL 4IRSC 1PZ5B 1MCPH 5LCVL 1JF1B 2X1WL 4KAQH 4NNXB 5FYLH 1M7IA 1JPFB 4NRXA 2NY7H 4LASH 5TE4H 5K9KA 1O5DT 4M61A 3IDYB 1G7HA 1HILA 4NQDD 2Y7QA 4IOFC 2FRGP 1OCWH 5ITBH 1FG2A 3ZZ1A 5TQ0L 1SBSH 4BQ8A 2YD2A 4EUPH 1KV3A 4NNPH 3MYJB 2JK5A 3P4MA 1Z5LB 1OT1A 4O58L 3C9NB 3U30C 1UB5A 5CUSH 1YMHB 1ND0B 3VFWB 3QG6B 1NGPL 4NZRH 2YPLE 1PAMA 2PCPA 4R96B 3VWKD 4K8RH 3OBAA 5AZEH 1CE6B 2EO9A 1JWSB 1MHPH 1N6QL 5EZOH 1KCSH 4PJ9B 5MERA 1FNSH 3NH7L 3REWB 3WJLA 4F2MB 2XZQH 4KVCL 3O2DA 3ARQA 4QYOA 1EAPB 1RUPL 4J1UB 4WW2B 4LLYA 3AU1A 1R5IB 5CZVH 5JPMA 2M1KA 3ZKXB 1ADQA 3RDTC 4JY5L 4H20L 3GM8A 1NBYA 4FQXC 4HWBL 1VSCA 1A9EA 1LO3H 1DQDL 4G9FD 1MCDA 3AS3A 5FYJL 1QFWM 3W0WA 1L9NA 1MCNA 4AL8L 3S36H 1LE9A 3ARGD 1T5XB 1W72A 4WIQA 1O0VA 4ISVA 4ZD3H 4JM2C 1IAIH 4XVTH 2VL5A 4YR6A 4MDIA 3BW9B 3OV6A 3PHOA 3SJVA 2QJDA 4WI9A 4X5WB 4PD4K 1KEGH 3ARGB 3CFCL 3L3OA 4M1CD 4PJHF 3LKRB 4GXUN 4IJ3B 5DWUL 4M6AA 1Q9OB 1E4KA 2J1KA 3SDXF 1JI2A 2XQYG 1KELH 4DWHA 3FB5A 1PLGL 4X9IA 4Z7UE 3UJTL 5BVJA 3NGBC 1YN6A 2E7LA 3K2MC 4RAVA 5ID0A 1NCAL 2J8OA 3NCBB 3HZVA 4PJAB 4L9LB 4PV9B 1Q94A 4WFGD 1FGVL 1CD9B 4U3CA 3JXAA 5HI5C 2UYLA 3W2DL 1OB1B 4X4ZA 3RAJH 1IQWL 1CT8B 4KRPB 3TZVA 4UNVA 2DJSA 5INCA 1GJIA 2FB4H 4YHKL 1DANT 4RIRA 2XWBA 4J3OC 4OSUL 3PXHA 4JM2B 5DMJB 2DD8L 5C0ND 5EC1A 4LU5L 4GAYA 1OT2A 1QZ1A 1FH5L 4MSWB 4GAJL 1EHLH 3HNSL 2YC1A 5EBLA 2GY7B 2O5ZH 5IFHH 4OM0L 5KSUB 3AB0C 4BELD 3Q48A 3STBA 2KQNA 1KCUH 4PGBA 1JZ2A 4JPWL 4X6DA 3MZGB 1P6AB 3UTQA 5F9WC 3WNNA 1YEGH 1B2WL 1J18A 2AABH 3RDTB 4XMPL 1C1EH 4AK1A 4WCYL 5I2IB 3SDXE 2OTWA 5HDQL 1MRDH 4PJ9C 4LVHB 5FM4A 5IVOA 1DBML 2FL5A 5DEZA 2W0KA 3IDIB 4KROC 4KH2A 3KLHC 5C7XL 4YNYB 3QQNA 4KZEL 4QHKI 4HULB 4X7DC 3KPRE 4Y4KA 3UTPD 4L3EE 4X4XB 3UTSB 1WICA 1NPUA 3LS4H 5C2BH 2BOBB 5J1SC 2DTSA 3A6OA 5HYEA 4LAJH 2UZIL 1EHAA 2D0HA 3WN5C 3P9MB 5ENWA 3MRIA 3TC9A 4P2QE 3K1DA 5J1TC 3G5YA 1NEZB 2A73A 3UTSD 2WUCH 3O45B 4NNPL 2VABA 1WIUA 4NUGL 4NM8H 4YK4B 2G2RB 3RY4A 5IBLD 5J12C 2XQBL 1OP9A 1DBBL 2H26A 1BZQK 1P2CB 1D5IL 4QT5A 3H3PH 4G8GB 3SOBL 1Y6MR 1UM6L 3DV6B 2DS4A 1LK3L 3BZFB 2R23B 5DR5L 4L8BA 1FNHA 1YEHL 2Y4SA 4PRPE 3RDTD 5ICZB 1R5VB 3KYMA 3QUZC 4LP4A 1E4XH 1A4JA 4ZTOH 2VQ1B 5ANMA 5JDSA 2WUBH 2MCG1 1S7SA 5I16A 4KVNL 2ICWB 3EYSL 1DLFH 3KR3L 1PFCA 1XCTA 3IYLW 4MJ6B 3C8HA 1B0GB 1NDGB 4LSQL 4I48A 5I1EL 2Z92A 1UJ3C 2GTWA 3BQUA 1KJVB 1UM4H 1FE8L 2MWCA 3BH9A 3IF1B 3GMQA 2MTPA 5HHOD 1FBIL 5D7KE 2G5BB 4U0RB 4DKFH 2H3NB 4PJBE 3K4AA 5D7IF 5J12B 1JTOA 4NP4L 1HSAA 4K2UL 1KEMH 4FQJH 4IRSD 5DK0A 3JV5A 5EOQH 2JTDA 4GBXC 4KRPD 5CINH 4ELMF 1P4BL 3F5WA 1Q0YH 4R0LB 1GGYA 4J7RA 3HUJB 1UXSA 1MQ8A 1A7RL 1KJ2A 1W8NA 3QIWC 2Y07L 2EDFA 4MWFB 1A7PL 1RZKL 1LNUA 3UYRL 1T03H 3SDYH 1GPOH 4L8SA 1MI5D 3QDMB 1RIHH 4N1EA 2EE2A 4K7PH 3VJ6B 1P4LA 1XR9B 3E6HB 2OM5A 5JQ6L 4MB3A 1FNGA 4D94A 4XAKD 1E28B 2DQIH 5SX5H 4MNQD 5E7FA 1V7NL 1I75A 1YN7B 3B43A 1KLGB 3ZO0A 4P5TA 1J0YA 1EMTL 4M6ML 1TJGH 4AEFA 3VW3H 3S37X 1LE5B 3MREB 1MJUL 2VLKE 3N1FC 1OCWL 3HB3C 5FYLE 1ONQB 4K7FB 1IAKA 5F9JB 1R3JB 5CKGA 1RULH 4FQLL 1KPVA 4TUOA 5E8PB 3ZDZE 3VFGH 1T04B 1BAFH 3O6FC 4KQ3H 3LZFL 3LY6A 3QG7H 3NPSB 1BEYH 2BC4A 5D1ZA 5E8NA 4U6YA 3EAKA 5C0CA 4MXVE 1BOYA 2X42A 4X5LA 1CXFA 4BYHA 1V7MH 1ZVHA 1DVFC 5ID1A 4XWGL 2ZSVB 2B1HH 5C0BE 1UJ3B 5BW7A 3IFPA 5SWQB 3L6FA 4LIQE 32C2B 1TNMA 5DGRA 1QSZA 3U79A 3VWKB 5CCKH 2XY2A 5L2JB 4FABH 4TUJB 5F1NA 4JFFE 2VXSH 3TT1L 3BD4A 3MUHL 4H26A 5ILTL 5KTEH 5H37G 2YXMA 5MEOB 3N85H 4LCUA 5BJTB 4POUB 3GNML 3X12B 3ZE1E 1J0ZA 3PDOA 1GZQA 2BNRD 3WXVH 1XFPA 3SE4C 5AG9A 4XVSH 1ZGLM 2F74A 4OZHE 1AQKH 1UJTA 1NGQH 2X9XA 5BZDB 3D0VB 5K9OB 3D48R 4FFVD 4O2EB 4U6VH 3FB8B 3WFCL 3DX9A 4E41A 2NNAB 4YC2C 5E6ID 3VW3L 3TBVB 3M17B 3WMSA 4BM7A 4URTB 5FECB 2K7QA 2CPCA 2DBLL 4O2CA 2EXYC 3BHBA 2APXA 3GSUB 3NN8A 3O11A 2J4WL 1P1ZB 3G6JB 2GCYA 4JFOA 3BPOC 3GZKA 1IGIH 4WFHD 1NGXB 2Z4QA 5DZLA 3QWRA 4NYLA 3PWLA 2YPLD 4JFED 2R1WA 3D85B 4HZLA 4HS3A 3TPUA 2MKWA 3DUHA 2LAGB 3TCXA 3UJJH 5KVGH 1F4WL 1SJEA 3K81A 4JO3L 3QH3A 4J23A 2CD0A 4Y5YC 8CGTA 4LLVA 4OZGE 3MXWH 3KYKL 1DDHB 3PIQA 2E9BA 4XPAL 5C0EA 3LHPL 3PABA 4E42A 1MEXL 5BQ7B 3KPQA 4K3EL 1K9TA 5JOPD 2R56H 4FP8H 3IETA 1S7UA 2JJSA 1A0QL 3RWFB 4UU9B 2BRQA 2DQGH 5GJSL 2FX7H 3VWJA 1FJ1A 2VN4A 5IHUL 1VFUA 3PDGA 3DXAE 2HT4C 4Q9QL 4WRLA 2YEZA 4U6TA 3WFBL 1PY9A 4U6VL 5GSRB 4RGNE 2VL4A 4HS6B 2X6MA 3PDDA 4YHOL 1BF8A 5FUCC 3VFUA 5I74B 3MODH 5E6YA 1HI6B 3O4LE 4MAYB 1MFDH 1T0NA 3G08B 3NGBB 4XNMA 4WV1A 4MNGE 3OL2A 4UIKL 5F9DC 2YPKB 4JN2B 2R2BB 4B0MM 1CBVH 3JWDC 3D69A 4KUCF 1I1FB 3QI9B 5FCUL 2I9LA 1U42A 1HIML 1S7VB 4KFZC 1B4RA 1I9JH 1NC2A 4AT6A 4F33B 4JVWA 1Q0XL 2K9UA 4HWBA 5DQJA 4CVXB 2FSEB 3NFSH 4HIEB 1BD2B 4OQ1A 4XH2A 2K1MA 3LEVL 3NCYS 1OARH 3WJJC 4NPYB 5F3HB 1F3DJ 3GBNL 1AHWB 3ARWA 4O58H 5GS0L 1P7QB 3M1BA 4XP1L 5GISL 1WJ3A 4HKJB 4Y16C 4ZFFA 5E8DL 1HSBA 2B39A 5DO2D 4ZSOE 3OAUH 2ED8A 2QADD 4FXGA 5HVHC 2X2YA 5HVGB 4JFDA 4CL7A 3QEHB 4POYA 1DVFD 3ULVD 1IGMH 4LCYA 4DW2L 4PREA 2EKSB 2NY5H 3CDGA 2UZYB 3JV4A 4GRLA 2D7MA 5CJ5A 1MJ7L 2B2XH 3BKJL 9CGTA 4PJ5A 1DN0B 1OAUL 5A1AA 1MCPL 1FZKB 1SHMA 4Y89A 1NBZB 4CN1A 5EN2B 4I9WD 3MRGB 4NO5A 4QO1A 4Y5YA 1EJOL 4YHIA 2XN9D 4JANA 4LNRA 5D7SL 1HINH 5F7DB 1G1YA 4OFIA 3QQ9C 4AMKL 1RIUL 1KC5H 4GUPB 1HIMH 4DVBB 1WAAF 5TDNB 4AENB 2DQJH 3BO8A 3EO0B 3JV6A 4DQOL 1FAIL 5JNYA 4N0CC 5ADOL 4UOW1 4OZFG 1M05A 5GS1B 1EXUA 1F6LL 4XTRD 1ZGLA 4C56E 5GJTL 2H6PA 3DRTB 3RIAF 4UIMA 1I4FB 2HN7A 25C8H 4YPJA 4RDQF 4Y5XC 4WW1B 4CVUA 4X7TA 2JJTC 3QA3B 3K8LA 4RFNC 3CX5K 4X80L 4XWOD 5EU3A 3UYPA 3QUXA 2Y6SD 1CLYL 3UBXG 3U9UA 1PLGH 3UJTH 2WSKA 2OCFD 4AH2B 5A2IH 4LLUB 1LK2B 2RIKA 1VGKB 5EPMA 4RX4A 2OL3B 1E4KC 3RFZC 1X9QA 4KK6D 1RU9H 4NZTH 5L6YH 1VESA 2EDBA 5DTFA 2P24A 3T65A 4PJ8A 4ZXBA 5C0JB 3TT3H 4MAYC 2B2XL 3BKJH 3L7EA 5IBUB 3QFDA 3DUSA 4XPFL 2O5XL 1HOCB 5EIVA 1NANH 3ZL4H 5J89A 1GGCH 4YBLB 5INDA 1JWUB 2X05A 4G3YH 3T4AB 1SJVA 2Z35B 4BA8A 1RQ5A 4PJ7B 5ALBL 2YRPA 3RKPA 2BNQA 1DQQB 5C08B 5B8CC 4NQCD 5JIPA 4G43B 5LQBL 4QOKE 4I2XB 1G7LB 1IGCL 2VZ3A 3ARDA 2FJGA 1KJ3L 2D0FA 3I50H 2WWMD 5EOCH 5TFSH 4TSCH 3GMPA 5T3ZH 4L4VA 2BVUA 3VMPA 1I9EA 3B5GA 4XB7A 4APQD 1ZT7B 2WLZA 1OLLA 2GI7A 4J4PD 5CP7A 5JW5A 5I30L 2VE6B 4A6YL 4NFBA 5C0BA 4KK6C 1JNLL 5C9JB 2AKRA 3O6ML 5I73B 1AQDB 1MI5E 5E4IA 4CU8A 3B8YA 5ISZD 5I19L 1D9KA 1G0DA 1SM3L 3CUPB 5FKAB 4M48L 5LGHL 5DJ8A 2E7MA 5I73C 1CFNB 4MQXD 4P2CG 3TCLA 5GGVY 1GOHA 3WFZA 5I8CB 5C0FB 4Y5VC 4JFYB 4PJCB 4HUVA 2F8OA 5DVOA 3S34L 2VC2L 2PXYB 4XMLH 1QTYT 4JKLA 4RMVA 5HVWA 5EO0B 2GSIA 2HWZL 4F37K 3IDNA 1MREL 4LARH 4U1NB 3VA6A 3RBGA 2O5ZL 5IFHL 4IMLA 2AXFB 3WD5L 1NAKH 3FT3B 3QCVH 4K94H 2XWTB 5DMKB 2VMFA 4Y5XB 3IRZA 3QFDB 2R1XA 3C8KA 3MV01 4D9RD 1XF3A 5IM7B 2Y72A 5A2KH 3HNVL 2E9JA 5DURB 4FZEH 5L8LB 5HHPB 4O2FB 2FDBP 4QTIL 3VCLA 4RRPG 3HZMA 3PGFL 4IDLA 4D9LH 1JPGA 2HA1A 2XRAH 2XWJA 4X7SL 3X17A 5ADPH 3GSNB 2FIKB 4ELKA 4DN3H 5IVXF 4BZ2L 1T4KB 1NLDL 4R4NC 4FQQB 1RZFL 5C2UB 2AK4B 1LD9A 3EHBC 4PRHE 5E8EA 5F6HJ 3QA3A 4M7KL 1A7PH 1RZKH 4JZNA 1JK8A 4JQXA 4LDLB 5ICYA 2PO6C 3BUYA 4QRQB 5E7BA 5EO1A 4JPIB 2P5WD 4QHMA 3MA9L 3FRPG 4MMZC 2DMCA 4MX7A 4C83A 4PJCF 3SO3B 4WHYH 3N1QC 2EYRB 4FQ2L 4NZDA 1JP5A 1KEML 5DMGD 2YUVA 4TUKH 2ICEA 3AAZA 3KPOB 4LK4A 1N26A 3GSVA 3BPLB 2Q7YA 4LARL 4YAQB 4QRPA 4Z18A 3VXUA 4KTYA 5T3ZD 4NQTA 2CRMA 4UTAL 5T1KB 3RUGB 5IMKB 5DRXA 1OW0C 2DICA 4W81A 1I8MA 4R7NB 2BY1A 3T0DA 1P7KA 3GSXA 3HA0A 4K3GA 2NY5L 4PJ5B 5SV3A 3QISA 3FQTB 5FYJU 1INQA 4H1LA 2VLJA 3HRPA 3FT2A 3MRLB 5EOTA 1J12A 1NCBL 4MQTB 3FRPA 1KJ2L 4H25A 2XIDA 4OIAA 3GBMH 2XKUA 3SGDH 1CE1H 1CLOL 1H3VA 3W39A 2COQA 1Y6NR 2V7NB 4HK0A 3LIZH 3MACH 4S1QH 4HKJA 4P9HL 1IRAY 4KKLC 3MR9B 3B9VA 1A7QL 1PGRB 5IWLA 4YXLH 3TYFB 1PKQB 1BLNB 1NDMB 3V6FB 2GEEA 4R3SA 5E6IC 1D5MA 4HCRH 3HE7C 2NZ9C 3SDCD 3NCFB 2Q8BH 4WHTA 3DX8A 2VITA 2A74A 4HIEA 1RAMA 3F7YB 1JMZA 3D9AL 1IAII 5DQJB 3EW3B 1OWWA 4OLYL 3KYKH 5F1KC 4UIKH 1BVKA 4QLRA 3LS4L 5C2BL 1AGBB 1FYTB 3L95A 4O4YH 1XGYH 5DEGB 2I5YH 4HWUA 4GSDL 4IRJB 5DR5H 3ECBA 3RL1A 5CP3A 5EU6A 1HI6A 4FMKA 5HY9B 1IM3A 4K3HA 3VFUB 4MYWB 4JQIH 3ZLQC 1NMAL 4GG6A 1I8IA 4MA3A 3DIFB 2Y06H 2VDKL 3MCG1 1ORSB 2EXWC 4ZD3L 3VDAA 5C1MB 2H2PD 2X1QA 4AEHH 1CD1A 3C5JB 3ZT6A 4XX1E 3MLSL 2D7TH 3FONA 1MCCA 1G7JA 2JE8A 3VRJA 2JIXA 1J11A 5T33H 3O4LB 3EZ8A 1IC5H 2HVKA 2R1YA 2GFBA 1F4XH 3V0AC 3H9SD 4LOUD 2D7OA 4M4PA 5BQ7A 4ZO6A 4MXWL 4KZDL 2FECL 3VFSB 1RZIA 4I0CC 3KWWB 3DX7B 5DT1H 1A7QH 4EJ1C 2BY2A 4P5KB 4UINL 2UWEE 3QI9D 2Z8RA 5TE6L 4XNYL 5T5NF 4ZG1A 4DFHA 3O41B 4HZLB 4F57L 1XAUA 3RUGE 3HE7B 5D1XD 3WIHH 3S98A 4PJDA 1INEL 4QXUL 5I1AA 1C08A 5J06A 1A6TA 4OD2B 3G6JA 5IEHB 3MV7E 3OSKA 4OLZH 5DHVA 2P49B 3VRLE 4DKDC 1SY6H 4G9FE 3QIBC 4AY0A 1LEKB 2BNQE 4OI7A 3V7AE 1M1SA 1QKZH 4MJ5B 3U1SL 5FDYA 3C5ZA 2VZ1A 4Y4HB 5IK3A 1A8JH 4DCQA 1I9RL 1CN4A 4F7TB 5HYSB 2I27N 2Q6WA 2DQCL 4QWWC 1G7QA 4KKLD 4QHNA 4BKLB 2PW2A 5C09A 5D96C 3OGCB 2D03H 3WKNA 5HDBF 3MV9B 3K74B 1E6JH 5DZOA 1IM3B 2X40A 4TSAL 3DBXA 4Y19A 4LCUB 1NAML 3HB3D 4YC2B 2BCKA 5DJYB 1CFVL 3CFBA 5CEZE 4HFUH 2BP3A 3QNZA 4X4YA 2G60H 3RNQA 1S7WB 1F42A 2G75B 2KDGA 1TPXC 4CMHC 5EB9A 2DIAA 4KKCC 3SGJA 1TJHL 1MFDL 1YPZF 5GJTH 1A6AB 1JPTH 3DWTA 1GZPA 1CLOH 1S78C 1YEJH 4KPHL 2WIIB 4X9HA 4LVHC 4LAQH 2QSQA 2HTKD 1PKQA 3BRDA 1K5NA 3CCHB 3GUTA 3QUKA 4OTXL 3VH8B 4YX2L 1ORQB 2AEIT 3DI2B 3SDAB 4P23A 3EOYG 4X6CB 2PYFA 3N06B 3BT2H 4K07A 3U1SH 4RFOH 1BWWA 5C70A 4XC1H 1KPVB 5KVFH 4OZFH 4DCQB 4EUPB 1YNKL 1RV6X 1T5WB 3VRLF 4Z7VA 5J1AA 3H7BA 4OCWL 4JO2L 1GGCL 1KUMA 3MRLA 3VXTB 4S11A 4H1LB 2VR4A 5C0AA 4RAUA 2CIIB 4X98A 1I8LA 3FT4B 1WFNA 3NZHL 3WXVL 1R3HB 3SO5A 1A6TB 4OI9A 4FQHB 3ULUD 1M7XA 5I18L 2EXWD 2B0SH 1UWXK 5DD6B 3U7WL 3LCYA 3X3FL 3SKJH 3P73B 5HSFA 1D7FA 2PXYC 3Q6FB 1SVCP 5GS3A 5FOJA 3QDMA 3KDMB 5I1CH 4JVUA 3WNMA 43CAA 1SQ2N 3UPRA 4LSVH 4DFIA 5KSBA 3EO9H 2R29H 3CX5J 5LGJB 2ILLA 2MJWA 3KXFB 2HLAB 3R8QA 4RISL 3RWHA 4NZUH 4Z7NE 4UQ2A 1I9JL 3TP4A 4FXKB 1XCQB 1AO7B 4QRQA 2BVOB 4IJ3C 5TF0A 3BWAA 4K55A 2J7LA 2PF6A 4DGYL 2VXQL 5IG7A 2DQJL 3IB4A 1NCNA 2OQJA 1YQ2A 3B2VL 4JAMA 3MJ9H 1WISA 3MLZH 4C54A 4W4NA 1RZ7L 2JJWA 2G5BA 3QDGD 1EPFA 1T4KA 4EBQH 1HKLH 3EBAA 2GAZB 4YHML 3ARBA 3VXOB 1ZLWH 2A6JA 3TBYA 4X9FA 1HHKB 4D2NA 4F7MA 1W8OA 4O2FA 3VCLB 3P4NA 5I1IH 4TTDD 4YPGB 4KTEL 4I18A 4PRBB 5JHDB 4MA3B 3BEWB 1JGLH 1NCBH 3MNWB 4L8DA 3TVMB 4ZXBC 3QO0A 3MLRH 3RZCA 4CRPA 1QR4A 3P0VL 3BRFA 4KI5F 4H20H 3NIFE 3WFEH 5GJSH 4F7PB 4I0PA 2R15A 4OF5A 3KXFE 5JXAH 4NQVB 2NTFA 5IVXA 1EDQA 1BZ9A 4ODXA 1J0HA 1I3VA 1LK3H 1CZ8H 1FYTA 3OPZL 5E0QA 3V6ZB 1P2CA 4LNVA 3QDMD 4ZNEA 5KS9A 2DLGA 2C4XA 4HK3J 1HZHH 2J3SA 2PKDA 4WI4A 2LE9A 3ISWA 3TFKD 3CD4A 2VABB 5JA9A 2ADJB 2H32A 4RBPK 2J8UF 2XZZA 1AQDA 3V6FA 1BLNA 1F4WH 3MNZB 5GGTL 1FC1A 1U8JB 3BN3B 5ACZB 1IQWH 1X5HA 4PJXB 2FATL 3DYOA 2J6EA 3FHQA 3GIVA 3C2SA 3OF6A 2FO4A 1UCTA 3QDJE 4B7LA 1E27A 1YYML 3INUL 4L4VB 2A83B 1HHIA 2VR9A 4KI5D 5H8DA 3IKCB 1PW3A 2IFFL 4PJ8D 1IQDA 2FJGB 2PYEA 3LS5H 4U6HB 3BP6B 3X3GH 2ITCB 1HHHA 1MRDL 4I77L 1AC6A 4JPWH 4JO1H 7CGTA 3MV7A 2BY3A 1MCQA 4BFIB 4NZJA 5DRXB 3OG6B 4XBGB 5T1KA 5E2JA 3S9DB 1AY1L 2OTUA 4YX2H 3G9AB 4PJDE 4QRPB 4J6RL 3VXUB 4G6AD 4LGSB 1SMOA 2ADIA 5F88B 3QQ9D 4Y16A 1GCFA 1Q1JL 4Q6IA 5HPMA 1DQTA 3DVFA 3TF7C 1I7RA 4MSWA 1T89C 4KZDH 3K4DA 3PXJA 3MMEA 4OKVB 4GAYB 2GK0B 4LSRL 5EC1B 1LHZA 4U6XA 3S88H 1OM3L 2CLZA 1ZSDA 4PFEA 4W68A 2IF7A 2ICCA 3MRRB 2C1OB 2AJXL 4ODUA 4UNUA 3ZSSA 4OGXH 2G60L 1P4BH 3W9EB 4UBDD 2R2EA 1XGPA 3N9GL 3DVNB 3SE9H 4UILH 4E41E 4Y1AA 4PV9A 4XC3H 2X4RA 1ZLWK 2AK1H 1OAKH 4X7TB 1IKFH 2DQFB 4X7FC 2NW2A 1NKRA 2PETA 2FIKA 3L5WA 4PJ5E 1JPGB 1G9NH 1VHPA 5DFWH 1FNEB 3BKML 4JDTL 4PUBH 3HHRB 5IM7A 1IGTA 2VXTH 5DUMH 3VXMD 4Z7VE 1EGJH 1M7DA 5I8OL 3ARXA 2R0LH 5D71H 2VZTA 4NBYB 1MWAL 3RPIA 5M95B 4GXVL 3QSKB 4D3CL 3AM8C 4Y5YB 3CFCH 1MH5B 4EI6B 2DYPA 5JDJA 5D5MA 3FTGB 3QZWA 4OKDA 3O6LH 3RI5F 3MV8D 4NM4H 3D18A 4NWUH 4D0BB 3DXAD 5E99H 3FQNA 1IQDB 4M62H 4F7EB 4AL8H 4OFKA 3ZHLA 2VIRA 1F6FB 1HHIB 4NQEE 2FHCA 1V8HA 1N0XH 3VXME 3AXLA 3B8SA 4FHBD 4JM2D 1C7TA 2M26A 4FXGB 1KENH 2V2XA 4A6YH 4D9QD 3O2WH 1WLHA 5C9JA 5IMOA 2AQ2A 3K7UA 1WBYB 4M1GL 4M03A 2L4OA 1HE7A 2L0DA 1W72L 2H2SD 3K2UH 4CAGA 2VZVA 3AS1A 5CIPH 3W9DB 4LCIL 4ERSL 4OB5L 4QRRB 4OGXL 4Q6YA 1YNLH 3QIBD 4LLWA 2FSEA 2WAHA 4LLMB 5T1LA 5DI8A 3S3SA 2N7BA 4JFHD 3VXMA 3U0WL 1MLCA 3BWUC 3LSOA 4Z6AT 2VDOL 2C3HA 3GO1H 3VFOB 4E0RB 5DVKA 3QI9A 1C8PA 1B4JH 5FHBL 3CFJA 4JRXA 4N1HB 2LV4A 4LKCA 4FMFA 4YHNB 1IGYA 3Q1SL 4WV1B 3VWKC 3L3KB 2IH3B 4MAYA 5HYIA 5B38B 2Y7QB 1SBSL 3CXHJ 4YHYB 3T0EC 3SE4A 1JZ5A 2YD9A 3MRBB 5BVPH 1TJGL 2V17L 5GSRA 3BEWA 1TZIB 4ONOA 4GSDH 1I9RH 3R4DA 1U8PA 5DTFB 3QIUD 3F58L 1FFRA 2Z31C 1MCHA 3EDFA 3OX8B 1FZMB 1JF5A 3EFFB 5CJQH 2A6JB 1VACA 4N0UA 2GQHA 1FCCA 3QULB 4LLDB 3WXWH 3U9UB 4OZGF 3SDDD 3DUUA 4LSVL 3CDYA 4RWHA 2D3VA 1XZ0B 1WFOA 2Y1VA 4Y1AE 3O9WC 4P4KA 5E1AB 3BWAB 2FZ3A 1RD6A 5JLZB 4UIMB 4M3JA 1N5YL 5F7LB 4E42B 1MJ8L 4B50A 2DBJA 5DEFA 3F6IA 2V9TA 5CWSA 4YXLL 4FNLL 4YDLB 3VD9A 1Q1JH 5E8OA 1JPST 2ATPB 1A3QA 2P48B 3T0ED 4EI5B 4OZGA 1RMFH 4K23H 4I3SH 2IQAB 4PB0L 4DUVA 2YUZA 3VFPB 4PB9H 3MGTB 4PBXA 1HYRC 1AR1D 2Y5TA 3AS2A 5GGUA 2NY3C 4JANB 4LNRB 4G5ZH 1VEPA 1MIEL 2JLLA 2NLJB 4LPYA 4CDGC 4MVBC 1EZVX 1XF1A 4Q74A 3S5LB 4JFFA 1IJ9A 1I1AD 2EDRA 4PG9B 1J87A 3UCRA 1SEQL 3QUXC 2BERA 3MLRL 4O2CB 4MLSA 4AYFA 1ADQL 3X3GL 2VLRD 2Y23A 4QXUH 4XCYA 4PR5B 5C8JB 3VE0B 4E5XA 1OSZB 3QEHA 4H0GA 4U7SA 3VGAC 3ORJA 4XCYB 3SOBH 3T1FA 3RI5K 3UZQA 1DR9A 5FHAH 1BJ1J 4G7VL 1UKQA 2PYFB 3ULUL 2V2TB 2ZOKA 2FYYA 4XNXL 3KPMB 3GUTB 4MJIA 4BH8B 1HH9B 1UG9A 3S35L 1FIEA 4D0CB 3HZYB 4TQEL 1QSEE 4ZS7L 4OUUB 1DUYB 1Z9MA 1YEKL 4OZGB 7FABH 4WWKB 3EOBB 1MCEA 4OV6F 1MPAH 3MOQA 3TWCL 2FJHB 2R69H 3BMVA 5ABDE 3G9VA 3BH8A 5CWSB 5IBUG 3I6GB 4DQOH 4PYHA 4YDKH 3QO1A 2VN7A 5KVGL 4KMTH 3NCMA 4OJFL 2NY3D 2HKHH 4IRZL 5DJYA 1K8DA 2ZSVA 1CGYA 4LASL 1KN2L 1W0YT 5HTSA 5E1AA 4KK8D 1T89A 4RFEB 3MV9A 3PJSB 1YJDH 1SEBB 4XRCA 3WD5H 3NMEA 4PJFA 4WUUA 1A3LL 2YZ1A 1AXSB 5I1IL 2EH8L 4FQLH 4WO4B 5IHUH 3MJGX 3QXDA 5FA3B 3ALXA 3SJVE 3OR6B 2LFGA 3RY5A 4JZJA 1E6OH 1A1NB 4GMSL 4MS8D 3RBSA 1JYVA 3MRPB 5DJXB 4Z76B 5FM5M 1F58H 3U2SA 1S7UB 3RWFA 4OGYH 3KAAA 1YN7A 3OKEB 2DQHH 2VLJE 4HFWB 5GSVB 4HT1H 3BRGC 5B38A 2ADFL 4JHBA 1QYGL 5EG6C 4PRPD 1A14H 1JZ6A 1AD0A 4Y4HC 4KJYB 4Z5RB 1BPVA 2BXYA 3BKCL 3ALWA 1OTTC 3OQ3B 2VJXA 3X13B 2EE9A 4XGZA 5I76A 2NY1D 4KVCH 1ZVYA 5M94B 4RISH 4RGMC 4EDWH 3LSOB 1VEMA 2APTA 3MV9E 3TEUA 1EO5A 4PJ7E 3QB7C 2BK8A 4RGNB 2BVTA 3MRNA 3RWEB 1CBVL 1WWBX 1VB9A 4PRDA 4LPTA 1A6UL 2PR4L 5FCUH 3JTTA 3LPFA 1QFWI 3B3IA 3M8OL 4GT7A 1JHKH 4FFWD 4HXAH 3GSUA 5GS1C 4HIJB 5DA4A 2G5RA 4XI5C 3KJ6H 2EZ0C 1G6RL 3U7YL 2Q86A 3UZVB 4JPVH 4ZFOL 5I1KL 3QEQE 5JZ7C 4LDOB 3HI5L 4EIZC 2DQTL 3P2TA 1SYSA 3S4SG 2H2SC 2VAAB 1AP2A 3LN4B 3QUYC 4X83A 4HIIA 3PUCA 1ORSA 5FYLL 1JNNL 3OXSA 3VXRA 3MRHA 2VQ1A 2X1PA 2VXTL 3IXTB 4XAWH 5C0AD 3QZWB 1IKNA 3D3VB 3L7FB 1I8LC 2F58H 1NH6A 5EU6B 4KROD 4OCYH 1FSKC 1VGEL 3ZT5A 4AIOA 5MEOA 2X1OA 1MCLA 2MMXA 1T0PB 1CG9B 4HCRL 4AIZB 5DEGA 5I1JH 3MXWL 1CTNA 2BNUA 4IOSD 2J8UA 4HCRA 5I71C 2X4TA 5B8CB 4HMEA 2OJEA 12E8L 5D2NB 3EYVB 4K94C 1TZHB 5CINL 5SWZB 3W9EA 4GW4B 4ODUB 4J3WA 3UTSA 1T3FA 2AK4E 2J2ZA 5SX4I 1PYWA 3D2UB 3HPJB 2CR3A 1ACYH 1S9YB 1Y0LB 5TDOB 4I77H 3MMEB 4OKVA 4LEOB 3RWJA 4NRZA 4XBEL 1FFPA 1JYNA 2FGZA 2R8SH 1IGJA 5HPMB 2RFXA 2X1XR 4HKXB 2R56L 1T0MB 2YSSB 4OT1L 1AQKL 3LRHA 2ZUXA 4BFGA 5JQ6H 5ETUA 3AGVA 3WFCH 4HMCA 1BQHB 3NCCB 3OHXB 4M7JH 2ZUTA 1U2CA 5CS7A 4YK4C 4JKMA 1F6AA 3OHXA 1BQHA 3MZTA 1T83A 3V8CA 5ITFB 1T1XB 1UQSB 2GY5A 3FQUB 4U6HA 2VDMH 4HEPG 1RURH 3IXTA 4U7MA 3NCEB 1A1MA 3WJLC 3NCJL 1GH7A 5FGBA 4ELME 4YBQC 1E27B 2ESVB 4CW1B 4WW2C 3V6OA 4RA3A 1MJJA 2J5LC 3UJJL 4YHPB 5EO1B 1MIMH 3BGFC 2GITA 1YMME 5ECJE 1FGVH 2Q86B 4QEGA 5DK0B 1CT8A 2AI0L 5SWSD 2UYLB 3S8WA 5EBGA 3QRGH 1QYGH 1Q94B 2IAMA 3H42H 4FQQA 1EERB 5A16A 3HZVB 5IVZB 5IFJA 5CGTA 4LRNL 3MBEA 3GI8H 1NGQL 4BQCA 2KZWA 4PJEE 1CXKA 2OJEB 2QQNL 3PWPD 1V3JA 4N8VB 3RWEA 2R8SL 4O5LL 1FLTX 5ICXA 1U91A 5HYQB 3K0WA 2BSTB 4WTXA 4XX1G 4Y5XA 4LFHD 4GBXB 4KTEH 4WU7A 3SGEI 4J8RA 3BESR 1CG9A 3FT3A 1QKZL 3LQAC 4U2ZA 3NFPA 1G7MA 4NT6B 4QCIA 1XGYL 1A64A 5D7JD 3KLHD 4N9GB 3WE6B 1JI1A 1G0XA 4ZUUB 2B5IB 1V05A 3TVMA 2GSIB 4GBXA 4XPTH 3LEYL 3MNWA 4OZ4A 4Z78A 5EFIA 3OXSB 5JHDA 3VRIB 4M7LL 3NFNB 4MLIA 3RVVC 5E00B 3LN4A 3DHMA 1U3HD 5FKAA 5IQ7H 1DQJB 3D1MC 2GJ6D 3PG2A 4NQEB 1R5IA 5C6PB 2BHYA 3NCJH 3UTOA 1T03L 4G6ML 3GMOB 3RPKA 4KJWD 1J1XH 3P9MA 5ENWB 2O93L 1AXSA 4JN1H 3WNPA 3WFHA 4CVZB 4FQXD 1GC1H 3JTTB 5BMFH 3OZ9H 2QSVA 3LEVH 5FYJD 3RWHB 1NLDH 1MHCA 3MRQA 2KL6A 1KJMB 2A6KA 4QHUA 5LGJA 2R4SL 4NN5C 1WCQA 2Y6SC 3I6GA 5HI5D 5FYKH 1KFAL 3QCUH 2CDGB 1FL6B 1Z5LA 1A3RH 1CL7I 3PHQB 4Z7NF 2JELH 4R8WL 4P3WA 1URLA 2XXCB 3LD8B 4XGZB 3KLAA 2EH7H 3D39B 3EJYC 3RZCC 2XACC 4PJ7A 4PP1D 1YEFH 5C0RH 2D9CA 3DVGB 5GRZA 1N59B 4JHWL 4OBRA 4K9EH 4BSWA 5IQ9B 2CIIA 1IAIL 1G7HB 3LN5B 2DM4A 5BZWA 3DPBA 1F13A 1UM6H 2YC1B 5IT2H 3CFDB 5HYJD 4WV1C 2OMBA 1OTTD 3MRPA 1I8KB 1JFQL 1KCVL 5LXGH 5C0DB 1RUAH 3OR6A 4PY7A 1PYWB 3ZE0E 4F7CA 1OSZA 2XV6B 4PG2A 5C8JA 4PR5A 3WKMH 2QQKL 3LKNA 4YDVB 5C86A 4MNQE 3I3DA 4JZJC 4QGYA 3S35H 1L4IA 4XRCB 1YECH 2YR3A 3HC3H 4LPCA 5ID0B 2LU7A 4GRMA 4MHHG 5IGXL 4LCWD 5MEQB 2BSRA 3PL6C 1DEEA 4D0DA 1T1ZB 1UH4A 4U1JA 1L0QA 4U31A 5DHVH 3JV6B 4OD1H 3QT2A 1DUYA 2DJ4A 4XP9H 5H35A 3UAJC 5JMRA 1IBGL 4Y4FC 5GGQL 3L3OB 2ATKB 1MFBL 4LKXA 5CMAA 3PHOB 3SJVB 1YPZE 5L0QC 3FQXA 1F97A 4JG1L 5DEFB 1ED3A 1ADQH 1DEEB 3MRGA 1YYMH 1GHFH 2HJLB 4ISVB 4ZMAT 1DZBA 2PYEE 3DOSA 1BJMA 1V7NH 1DE4B 2FHBA 4LCCA 2FZ3B 1FZKA 2IADB 2FYYB 3WBDA 5JW4Q 4I1NB 3H7LA 2V2TA 3MRHB 3GJFA 1ZV5A 4PV8B 5GPRA 3E2HB 4F7CB 2E7LC 2C4FU 2NY4D 5DMIH 3BQUD 3V4VL 3T8XA 1MLBB 2YA1A 3O9WA 4P4KC 2SEBB 4TQEH 3PNWB 1S7QA 3EJJX 1B9ZA 2AJVL 3ZDZF 4FG6C 4NO3B 5I1LB 3MA9H 3QEUA 4FFYL 3MRCB 4KKAD 3MLUL 4UOJA 3S5LA 3TZVD 2HT4D 1JWSA 4EQ2A 2E6JA 5D70L 5L0QB 3K8KA 4H8WL 2UWEF 3L3KA 4G7VH 5I30H 3O41A 1JZ3A 5T33L 2XRAL 4LKCB 3FAXA 5CCKL 1UKTA 2NX5E 3CFJB 1NC2B 4IMKC 4AT6B 5DC0A 1JGDA 3L3IA 3W11D 1X5JA 3OTTA 2E3VA 3PHQA 4KUZH 4Q0XL 4S1SH 4ZS6D 2WINB 2EDXA 3MLVL 4X6DF 2EYSB 3RUGF 1BQLH 1UA6L 5GS0D 1FFNB 4AEEA 4JKKA 1CR9L 4PJBB 4JFQA 3AFLA 2HT3D 4JY6B 3SO3C 3OKEA 3QI9C 5DMGC 3U2SB 4NO3A 4NRXB 3EUUA 3PNWA 4OJFH 4HV8A 5BW7C 1QFWL 4JLRA 1MJ7H 3D3VE 5DJ6B 1OGAB 3H3PL 3V5HB 3QZWG 3UO1H 3ULSB 5ALCH 1T2JA 2E9WA 2PO6D 5DJDA 3VXPB 3F8UB 1EHNA 1NCTA 4JLRB 3O9WD 3QHZH 1PSKH 1NLBH 3O3EA 3L1OH 1XGTA 3SDDC 4F7EA 1DQMH 5TE7L 3HNTH 4XAKE 4P2OD 1N5YH 5B21A 4ODSH 4JFQB 2UUDK 5E94B 4EIGB 5J3HD 3GBNH 2HJLA 3PWPE 3PQYD 4JR9H 1KENL 1KTKE 5C0EB 2CLVB 1ZHKB 4JRXB 1HXYB 5DJ0B 1DEDA 1BVKB 4UZGA 4HT1L 5T3ZL 4LPUA 5AD0B 2W1NA 3S96B 4NQUA 1MLCB 3QCTH 5T1LB 2P5EE 2VSCA 4RMRA 3VG0H 5L9DL 3S4SA 5C7XH 1A6ZA 3CFKA 4L4TB 4TVPH 3RWDB 4QRRA 1D5MB 3SE3A 1Z3GL 1WUNT 4GRMB 3U48A 4PGJA 2GCYB 4JFOB 4NSKA 5T5FL 4ZFZB 4JO2H 3OJVC 3BHBB 4XP6H 4WUUD 5HHME 4FQ1L 4UTAH 3FFCD 2ED7A 4OCNC 3W0WE 5JTWA 5KVFL 3M17A 2BFVL 4PB9L 1ZSDB 4M3KB 4PV8A 3BI9X 5K9OA 1NFDB 3LEXB 5D7LE 3IDJB 3FT2B 5LCVH 4OZIB 4F3FB 4OQTH 1FZJA 3D18B 5CJBA 3CH1B 4K71C 2XQBH 5JOFB 1DE4A 2ADIB 3FQUA 2DI8A 2DYPB 5EIIA 4ESKA 2OTUB 3MCKA 2IPKA 3QUYA 2R4RL 1TTGA 1ZA6A 3BAEL 5JHDE 5CMAB 4LLQB 5DRZB 4XWGH 4NZUL 5SWSE 3DETD 3T2QA 3LQZA 3ZKMC 3F62A 3WLBA 1EFXD 2BSED 1OY3B 1WCBB 3IJYB 4XPGL 1M7DB 4LSTH 1HCVA 2XYCA 3QBTB 4HEME 5A2LH 1Q0XH 4ZS7H 4APQA 2X09A 3CU1A 5CUSL 2X89A 1AKJD 2NY0C 4I4WB 1INDH 1V3LA 2MCPH 2YRZA 1OQXA 4NRZB 4QHMB 4EN3B 1DLFL 4HC1A 1S9YA 2FO4B 2HTLC 4P3CH 1K4DB 1F3DH 3MFGB 5DWUH 2NW2B 5JLZA 1TPXB 4CMHB 5ID1B 4ZFGL 2NXYC 2X4RB 3HFMH 1XZ0A 4MCZB 2UWEB 3MUGA 1NAMA 2IAMD 4P5TD 1KGCD 4Y4FB 1FGNH 3MNZA 1C12B 1PG7X 1VACB 4U6XB 2VWEC 2H32B 3ARFD 4KXZH 4KAQL 4ENED 1JGEB 1KTRL 5F9JA 1R24A 5KSAD 1DQJA 4FQ1H 5FO8B 4PUBL 5B3NA 3TO4D 1CL7H 1LDPL 4DKEL 3OJ2C 2E27H 3DSFH 5H94B 1F4YL 3MNVB 1DBKH 3GSWA 4XVSL 3ZKXC 2GK2A 5IQ9A 1VA9A 4QNPF 4XTRC 3SEPA 5FV1L 4J3VA 2I26N 1ZA3A 1J5OH 5IROC 3IDNB 3WHE0 3KLAB 1G7MB 3NFPB 3EYQD 4NT6A 4QCIB 1BBJA 3JVGA 1T66D 4P46B 5I17B 3P4OB 4JFYA 5IROA 2PYEB 2NYYC 3T0VA 4B5EA 2BSTA 4ELMB 3J7HA 1FAIH 3QHTC 5DI8B 5GZND 2HRLA 4TSBL 3T4YA 3CUPA 4MNHB 4K8RL 3IU3A 4I18B 1A5FL 2VAAA 3VGGA 2JF1A 1X5IA 4HJJH 3VGBA 5BV7L 3W9DA 3ARGC 4Y1AD 4HFUL 4IS6B 4LMQE 3MBEB 1UGNA 5GRXG 2OJZL 4HD9A 2W9EL 5A16B 4HBQA 3A67L 1HQ4B 3RHWK 3TGXA 1DL7L 5B3JE 4JFHE 2ZWLT 3BUTA 5FGCE 3CLFH 3ZYZA 1SVZA 3LB6D 3ZYOA 4AIXA 4K3DL 2GITB 1XGQB 2QKIA 4PJEF 3T0EE 1WZ1L 4PRDB 2HLAA 4ODWA 4CW1A 1GGIL 3VRIA 4TVSa 5KS9B 4D0BA 5GIRB 5FUOL 5JDSB 4I2XA 5HYJE 5AYUH 1NCDL 3SCMD 1A4JB 4LPVA 2WMPA 1AD9A 4PJ7F 1I7ZB 2Y36L 3KYMB 4APQC 5JIKA 3CC5A 4NM8L 2VDLL 3BZFA 3MV7D 3Q6FA 4F7PA 4PJXE 4HLZH 5CZVL 1QPXA 3FCTA 5HYSG 4WU7B 1QHPA 5LGKA 2AXHA 4IM8A 5GSVA 4HWBH 4XNXH 4Y8DC 3O2DL 4KTDL 5ICXB 3O8XD 4HWZA 2G2RA 4Z7UB 1IGJB 3MC0A 4Y4KD 3ZYIA 4LEOA 3RWJB 2A73B 5TDOA 2B5IC 2DL2A 1T2XA 3P11L 3ULVL 2GHWB 5KW9L 4C59B 3QUXB 5F71A 4X6CA 3SDAA 2EKJA 4WW1A 1D9KD 3L3JB 4MA1B 5JW3L 1KG0B 3A6CH 1EV2E 1RIVL 2YBRA 1MNUL 5I9QC 4Z0XA 4EN3A 5D2LB 5F7HA 3WN5B 5DJCA 1A6AA 4QF1B 2IPUK 5B8CA 2VUOA 4XWOC 5KJRL 5TDNA 4I4WA 4PJDF 4AENA 4MXQC 3B6SA 4QTHA 5EZJB 4L5FH 2VQTA 5ITFA 1SJHB 1F6AB 1NMAH 4FQIL 4LLQA 5DRZA 1NUFA 1KACB 1N0LA 5MHSE 1JTPA 2ITCA 4LEXH 5B4MD 4MJIB 1Q9LA 3M07A 3FO0L 5JOFA 3CMOL 2YMXH 1AO7E 1T2QL 4MMXC 2ZOKB 3TYGH 1FZJB 2PW2B 2AEPL 3NAAH 1N7ML 3VXRB 4LCYB 4ALAH 1J1PL 4RA0C 1TCRB 1CGWA 1AP2B 4HPOH 5DC4B 3KPRB 4M7LH 2R4RH 1OSPL 5H2BB 4C56A 1T3FB 3AREB 4P59H 4X6EB 3RZWA 1CZ8L 1Z0MA 2Z8SA 3OPZH 4GW4A 2P5WA 2OXGA 3ARYA 3V5DA 2W07A 5K33A 3T0BA 3FB7B 3FN9A 1A7NL 4UUJB 3RKDC 4NPYA 5F3HA 1L7IH 1AJ7L 4JFFB 4OZIE 2WIIA 1YN6B 5DO2C 1UXWA 5EORH 5D7LD 4LIQH 5BS0D 2YZ8A 3QIWA 2BNUB 4YXKH 3X11B 1IAOB 1GAFH 4TVPE 1P5VA 4MXVF 2NR6C 2VZOA 1KCRH 3S96A 1U8NB 4YUEL 5D1ZC 1ITCA 3WLWC 4OCSH 1BZ9B 2CK0H 2VUYA 5E8OB 3L5HA 1AE6H 2NTFB 2BCKB 3NIGF 1RZIB 4I0PB 1A3LH 4OTXH 5GGSA 3WUWG 4KJYA 2EIDA 3QO0B 4XVJL 2O61B 3WFDL 1UB6B 3LRSB 4XCEA 2HVKB 2WW8A 1LE9B 2C3VA 4PTTA 3WS6C 1X5KA 4QOKB 5GISH 4HG4K 3P9WB 2A1WL 4F7TA 3F7RA 4W4OA 4WJ5B 3UJIL 2R29L 4OM1H 1SYSB 3VXPA 3ARRA 1A1NA 2OXHA 3QUZA 3AM8A 1UWGL 4OUOA 4Y2DD 4DUWA 3KLDA 3U4AA 1K85A 2D2OA 1CI5A 4L8SC 5ESVA 5JPNB 1FL5A 1TVHB 5IG7B 3U7WH 3X3FH 4QXGL 4FXKA 1MSPA 2C5DC 4JY6A 5GGSB 3QHFH 4R4FH 5ISZE 3QO1B 4BSJA 3VFWA 2EYSA 4ZO7A 1P84K 2F53B 3QH3B 4X6CF 4LFHG 1OAZL 3FZUC 1SJEB 5A43C 2DRUA 3BFOA 2R0WH 4LBEA 5IF0A 2FH8A 3QIWB 5IP4A 4X6DE 3HAEB 5DD6A 3LH2L 5D1XC 3OJDA 4Z5RA 1MAKA 2PTVA 3PGDB 3QEQD 2BNRE 3VGAB 5CZXC 2ARJB 4UUJA 3TYFA 4YJZL 3MRCA 3V5DB 5D8JH 3HFML 5IB2B 3WFBH 1MIEH 1KCUL 4X6EA 1JPFA 4NOFA 4X80H 4XMLL 4RMWA 1ZANH 5IMOB 4C56B 1T5WA 3EJZD 5L88L 4I0PC 1DBJH 1WWWX 3FB8A 3RGVD 2FEDD 5CZKA 2IG2L 3D0VA 5IWLC 4H25B 2GTZB 2XTJB 3BVNA 1JFQH 3MUJA 1AR1C 3GIZL 1MFCH 4P23B 2GJJA 3WLWD 4XP5L 3QUKB 1Q9LB 4G8EA 1K5NB 3F12A 3G5XA 3QWOA 1KPUA 4JFPB 3MLYH 4LCCB 3U4BH 2H2PC 2IBBA 3DMMB 1YQVH 3DO3A 4X8JA 5IUSA 4KUCD 2I60L 2ZUSA 1G7IA 2FJHA 1WEJL 4FQPA 3GJFK 1TFHA 5HI3D 2AAVA 3EOBA 3LZFH 5EZJA 1R3KA 4XHJC 4NO2B 4MJ2A 2EYRA 2ATPA 3F7YA 4JHZA 4LQ1A 4Z0XB 3DX8B 5GRUL 5GGTA 4C83B 4DVRL 1KG0A 3KJ6L 1RJZA 5D6CB 5CBEB 1MNUH 1EJ6A 1OAYL 5AG8A 1IE5A 2ZUWA 2VDNH 3LPGA 4JG1H 3ARVA 1QBBA 4G8IA 5C09B 1MWAH 1XGPB 4HK0B 1TQBB 5C0GA 3EDDA 1SJXA 4NO0D 4TVPL 4LLDA 4HH8A 4U33A 3TH3T 4MNGA 3GSNA 4R26L 2ZCHL 4KY1H 4OM0H 3C5ZB 2C9AA 1FZMA 4IOIB 3JWOL 1TENA 4HWZB 1TQCB 1TVBB 1U95B 2OS7A 4GAGH 4YDLC 1I7RB 3IDUA 3MRMB 5I1HH 3OGOE 4YIQB 2P8MA 3HUJE 2LTQC 5IEHA 2DIBA 4XPGH 3ARZA 1A14L 3O3DB 4NQSB 4R2GC 5EOQL 2WNGA 4XBGA 1J86A 4YAQA 2IBGA 3O2WL 4WI5A 3TVMC 1IGYB 3Q0HA 4DKFL 1KB5H 1IM9B 2P7TB 3VI4F 1UZ8B 1G9ML 5CEXA 4FTVB 3DARA 2GKIA 5JXED 2M2DA 3RP1A 2A6IB 1CFNA 4RGOL 4OF8A 1ZLSH 1YC7A 3MRQB 1R5WB 1FRGL 4GH7B 2HP4A 4GQPH 4P4KB 3O4LA 5E8EB 5ACLA 1CDCA 2FX7L 1F02I 5EUOE 1GAFL 3MYZA 1EEYB 1U0QA 4O5LH 3QULA 3GMLA 5E08L 4N0UB 5JW5B 4XPFH 1BGXH 3OF6D 4I48B 5CP7B 2IALB 4JRYB 3IS1X 1G84A 1XCTB 5FOBB 1FVEB 2R0LL 2R0ZH 1D5IH 4N0FB 5D7IE 5D71L 5TQ2L 4QY8A 5J13B 1NFIA 3NTCH 1DQDH 3U6RA 4U05A 3ARSA 4XXDB 5IBTH 2D7PA 3MRBA 3GSOA 1N7MH 2XWTA 5DMKA 4R97B 4OZ4B 2DQEL 4P46A 5E5UB 5CD3B 1N2RB 1BBJB 4G43A 3V4UL 4CU6A 2B20A 2BNQB 3DV6A 1H8SA 5D5MB 3PGCA 1FV1A 4P2QB 4IRJA 1JHTA 1JHTB 4ZUTB 1JPSH 5GGVH 3BZDA 4O9HH 4MXWH 5CD3A 3RZCB 5C07E 5B3JF 4J8RB 3MNVA 5FHAL 1HOCA 1VDGA 3S5LG 4E0RA 3RVWD 2XNAA 3LD8C 5FV2A 4LEXL 1KELL 2UZXB 4YWGH 5TE7H 4UT6H 4QY8B 1JGEA 4LLWB 1OVZA 3R0NA 4TPRH 4YPGA 3G5YB 4NHUA 3S97C 2HRPH 2AKRB 2F5BH 3F65A 2D7QA 3ZE2E 3Q6GL 5IVZA 1WBZB 3WIFB 3SGJC 4MHHI 1MELA 1ZAGA 3QXTA 4RNRB 4GOSA 4ODVL 2VE6A 5K59F 3CSYB 2VB5A 3S34H 1KB9J 5I1GL 3DRTA 2H6PB 1YEHH 3ILQD 1RK0A 1MJJB 4R8WH 2JB6B 2A0LC 4M4RA 2FX9H 4Q6IC 4IRZH 1BFOB 4YFDB 5EOTB 3ARUA 5FO9A 1K6QH 4HHAB 3HMXA 4NJ9H 4BH7A 2FX8L 5C08A 3SKNA 3QDJB 3FTGA 5E8DH 1T80A 1ZA6B 1MH5A 3UTTE 3ZE0F 1HYSD 3UX9B 4MJIE 2RJMA 3O3DA 2HG5A 1JWUA 4BFIA 3RPIB 2DQEH 4WEBH 4FQHA 5E95B 2VDPH 2VLKB 1ZMYA 1HHHB 3MGOA 4PJAE 5ETUB 4LVNB 4RAUB 5ADOH 4IDJL 3MROB 1IGTB 1T0MA 2YSSA 3JV4B 4GRLB 5FO9B 4J4PA 3OAZK 2RFXB 2E7HA 1BFOA 3WHE1 2EKSA 3MO1A 4LQFL 4OGZA 4JPIA 4EUPA 2HTLD 3EOTL 4K9EC 3OR7A 1LK2A 5ICYB 5FM8A 5T1DL 1EJOH 3VA2C 4YHZL 5FFLA 2CMRL 1NCWH 5EU3B 1HINL 4PJXA 5D1QC 1JE6A 4JPVL 3BPNC 1OP3H 4OFVA 1CDIA 1F8TH 1U8JA 1RUMH 1TZHA 2VXVH 3CCHA 2FIRT 3KPPB 5F1IA 4L5FL 1RJZB 5BVJB 4NHUB 3WIIL 5GS1A 2UVEA 1HKFA 3LQAH 4PRIE 3CIQA 1QP1A 2ADJA 4LSDA 3TT3L 4C4KO 1E4WH 4M6MH 3E6FA 1ZS8B 4MA1C 2OL3H 4M7ZB 4Y16B 3HMWL 4OD3H 2DQIL 1EO7A 5F7DA 5TE6H 1S7WA 3QPQD 5IMMA 2OP4H 1NL0L 4IMLB 3EIFA 4J3UA 3RU8L 4ODXB 2YA2A 5BRZD 3CFEA 4ZUTA 1EK3A 3DMMA 4NQVA 1T0NB 4LHUB 3BPLC 3PGCB 1NBZA 4JGMA 3AVEA 1MOEA 4DOHB 4G8EB 35C8H 3C60B 3HE6D 2HVJB 1G0YR 3E1F1 3TCLB 3V4VH 1NBYB 4P2RE 1QRND 3ARBC 3BVNB 2E27L 3DSFL 3V0WH 1NFIB 2NY6D 5IQ7L 2VLMD 2BXZA 4TN9A 4JFDB 3L9RA 3U7AA 5KZCB 3LEYH 3LMJH 4Z9KB 4FA8A 1AI1H 3PF2A 5L2KD 3S3JA 3ARBB 3VXOA 4XBPB 3VD3A 4UOW0 2B1HL 1RZFH 3ES6A 3GMMB 4UU9A 4XPHH 4ALAL 5I8KH 4UI2A 5DA0B 3MLWL 2XFXB 5DHVB 4S1DD 3V52H 4PJBA 1KCRL 1AO7A 4MD5B 4UAOC 3T3MF 3CFIC 4XH2B 5I1AB 1I1RA 1VEOA 3FO1A 5D2NC 4CVXA 3IS0X 2P5EB 3HE7A 5JUEL 3C9NA 5C0RL 2VXVL 3PE9A 2P8LA 1WEJH 3CSPA 5I1KH 1HCFX 3O6KH 3V6ZA 2W60A 1KIQB 4HUWB 3CJJA 3KDMA 4YHMH 3PL6B 5F6IB 5FYKL 3VFSA 1NMBH 5IJKA 5GS0H 4OIIH 1UH3A 4NYLB 1NCCH 2W0FB 1CK0L 3QEUB 1TVHA 4HUMB 4HS6A 5DRNB 4L8DB 2W92A 1S7QB 2N1KA 5F7EH 5EUOA 1IL1A 3VRJB 4PRBA 1PZ5A 3V0WL 4EDWL 1TVBA 1U95A 2IMNA 1MLBA 3QUZB 3C5JA 4NC1E 2X5PA 3EYUH 3TBYB 4F7MB 3O2DH 2F15A 3DX9B 3B5HA 1TDQA 3MLUH 3GJFB 1BVLB 3U36A 4M6NH 2PUQT 4Q9RH 2FX8H 2F74B 4PTTB 1XIWD 2NY0D 4JAMB 2C3VB 5EOCL 4WDIA 1CFVH 1JUFA 4PJFB 5HHVL 1CICD 3VH8A 1SEBA 4KRLB 3PDOB 3DV4B 2G9HB 5E9DB 5CJXA 1JZ4A 5CBEA 2QTEA 2HJKB 3P4LA 5D7KD 5JORB 3HRZA 1KF9B 5D2LF 3VG9C 1HK6A 1GZPB 1A22B 1P69B 5L9DH 2F53E 5H35B 43CAB 4JQXC 4TUJA 3UPRB 3TN0B 2CH8A 3RVTC 1CXEA 1AGCB 3TN0D 2UUDH 4P48A 2APFA 2BVQA 5C07B 2FWOB 1YJDL 1XGUA 4RGMB 5C92A 3BZ4A 3SKOA 3RJDA 3HG1D 4NO5B 2BSRB 3A0OA 4WWKC 3EDKA 4Y5VB 4XNZC 1UYWH 2E8YA 3DBXB 4Y19B 4D9QE 1S3KL 1EUTA 2QQNH 3FT4A 5E9DD 1A6WH 4G6JH 3MLPA 4G6FB 3F12B 3G5XB 4I3RL 3QIUA 4R4BB 3C2AL 2DLTA 1AXTL 4PYGA 1FIGL 4HPYL 1CCZA 1KXTB 2NY2D 1KSRA 1UFUA 2DM7A 1H3WM 3KS0H 4Z7VB 5F7YC 1HH6A 4LPWA 4DGIH 4PP2A 5HYSA 4O00A 3RGHA 5C0DA 4O2EA 3TYGL 2FO1A 5IK3B 3MLYL 3VE0A 2DN7A 3KG5A 2VDML 4YLQT 2MQ0A 4OQTA 2F58L 3TN0C 4WI6A 2CR6A 1D6EA 1TQBC 2AJXH 4YEEA 3WIHA 1QFPA 3HPLB 4BZYA 1IGIL 4BSWB 4AMKH 4HAFA 3DVGA 1I8MB 3BE1H 1EEUA 3QWRD 4R90L 5CEZH 1UM5L 4JCLA 1C08B 3T0EA 3C08H 1NSNH 1FORH 3BZ4B 2D03L 2NLJA 3PL6D 3SKOB 5ELIA 2DM3A 2Y5TB 5GGUB 3VJ6A 1S7VA 2Q7YB 2G75A 4B7IA 3VWKA 1YA5A 2IQAA 1GGIH 3AC0A 1LNUB 3L6FB 1FDLL 3GDBA 5SWQA 3UTTD 3DX7A 3KWWA 2Q8AH 1MHCB 4EI5C 3U7YH 1EMTH 2WBJD 3JWDL 2YHGA 3MLVH 3B9KC 1D6VH 1JUFB 3NCYP 2EO1A 2AK4A 5EOCJ 1RIHL 1G7JB 2L7UA 4PJGA 1WF5A 1CGVA 3W0WD 3CXHK 2XWJB 4Y4HA 5DD0L 5BV7C 4WJ5A 1LEKA 1L7TH 4NZRL 1UACL 5KVDL 3MTRA 1XGRA 4GG6B 3SGEH 1GIGH 3LRSA 2YUWA 4XCEB 5IB1B 2O61A 2HMID 2W0FA 1R3LA 4XP4H 1EA9C 1CD0A 5HY9A 1YPZA 4N9GA 1OD9A 3QDGE 2AXFA 4K2UH 2YD3A 1FLRH 3ECBB 2E5EA 1QFHA 2YWZA 3CC5B 3PL6A 2HLFC 1N64H 4IEFB 3LIZL 2EDJA 3T0AA 2MPAL 2DM2A 4R2GB 1GGBH 3DYMA 3OAYH 1KIPB 5GRJH 1MFNA 5GIRA 2ZG2A 3N1GC 4XB8A 5I8CA 3X11A 3G6DL 5DQ9B 3HUJA 4KK9C 5C0CE 4ODWB 5BRZE 2ZUYA 4KKBD 2E9IA 3V52L 2GW5A 4DN4L 3PWLB 4NZTL 3KPSD 2QKIB 4MD5A 4LIQL 1FDLH 5I15L 2JIXB 1I3RA 1MCWM 4H5SA 5I1GH 2CMRH 5J57B 1YC8A 3GMMA 5T5NG 4O4YL 5L6YL 1CS6A 4UILL 4KQ4H 4Z95H 1WBYA 2BRRL 4N9OB