3AY4C

Crystal structure of nonfucosylated fc complexed with bis-glycosylated soluble form of fc gamma receptor iiia
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
170
structure length
160
Chain Sequence
LPKAVVFLEPQWYRVLEKDSVTLKCQQWFHNESLISSQASSYFIDAATVDDSGEYRCQTQLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVQITITQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for improved efficacy of therapeutic antibodies on defucosylation of their Fc glycans
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 32
structure length 160
sequence length 170
ec nomenclature
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ay4C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ay4C02
4NNPL 1IBGL 5FA3A 3LRGA 1YPZA 3I6GA 4WO4B 2C7UB 3KJ4C 1ETZA 3VJ6A 1GPOH 3GIVB 3LOWA 4XVSL 1X5LA 3ROOB 2BP3A 2LU7A 2VZOA 4O5LH 1TZHB 4X8JA 3SO3B 1D5BA 2E6QA 3AREC 2CSPA 3SBWC 1P4BL 4Z7UB 5DJXA 2D7MA 3O4LA 4HK0A 3PV6A 4Q6IB 4AYFA 3MNZA 2JELL 4U1KB 1VADB 4MCYA 3QJHB 4JFXA 2AK4A 2MWCA 3W9DA 3KDMB 1E4JA 3D1MC 3VXUD 4Z7WA 1KCSH 1JHLL 3SJVD 4JFDA 1I4FB 1VFUA 3EUUA 5MI0B 4APQB 1UCTA 5E6IC 3I3DA 3B5TA 4QHMB 1DBJL 3ZE2F 2YPLD 4HIJB 4XVUC 5EU6E 4HJJH 1P5UA 4G43A 4NM4H 3BDYL 5HJ3A 1OP9A 5C0NC 2X40A 2CK2A 1A6UL 2NY2D 4Y1AA 1QA9B 3MLUL 4LSQL 4JM2B 2DKSA 1HHKA 3ILPA 5DTFB 1PG7H 3D85B 4EN3A 3OJDB 5LCVH 1E4KC 3GMOA 4UV7H 1AXSA 2FL5B 3UBXI 4LSRL 5GS1C 4WIQA 5HSFA 4ODTL 2MOVA 1I7RB 4IRSC 5F8QC 4JG1L 1NCCL 1IGIL 1NGYA 3QJHA 4JFXB 4LEXL 3DECA 1N5AB 3MV9E 4O2CA 4P57B 5E2TH 3GNMH 4QXWA 3PQYE 5TJWK 4HG4J 5GS0H 5IQ7L 3HNTL 4NO5B 4MMZC 4HDIB 2Y6SC 1OSZB 3DTXA 4XH2B 2ZG2A 4RWHA 2X2YA 2CIKB 4JY4A 4HK0B 4U1SA 1IAIH 4RWYL 4ZODA 1MCLA 4QTIH 2FX9L 3OB0K 2CR3A 4LSDA 3RJQB 3W5NA 1KNOB 2VH5H 2VQTA 2AV1A 2BJMH 4N8CH 1RU9L 1DEEA 1HEZA 5F97E 5TGBA 4MXQC 2BC4A 2Z8SA 4KQ3H 1C12B 3HG1B 5FO9A 3TNNB 3BP4B 1WUNT 1KPVA 3U48A 2Z91A 5IB5A 2XKUA 4WO4D 4QHMA 5EZIL 3MUGB 1I85C 1YNKH 3OZ9L 1EHXA 1HIMH 2ZOKB 4ZUWA 1CGTA 1T83C 3TM6A 2AQ1A 4YDJA 4OZIE 2JCCE 2FNBA 5DYOB 5IJVB 5FV2A 4EVNA 3AGVA 2MKWA 1B2WH 1N64L 5TQ0H 1EDQA 4NQDA 2AAVA 4JPWL 3ARXA 1UXSB 2ZPKH 5GRUH 1X5IA 2VDPH 3MGTB 1U8MB 2V2WA 5EZLB 1HHGA 5F6HJ 1DN0B 1ZT4A 3QHTC 5DJCA 4NGHH 4QHUA 1PKQB 4JPKH 2XA3A 4M9PA 1NCNA 1FZMA 1KNOA 3G04A 4KK8D 1VFBB 4OLVH 4OBRA 4LDOB 1UVQA 3BPLB 4Z95L 3RWJB 2ZWLT 4G8EB 5GS1B 3UROR 1KLUB 5ANME 3QIWD 2NY1D 2Z91B 4NRYB 4PJHB 1XCQB 4I0PD 4QT5B 5F1OB 3N9GL 3RRQA 3MBEC 2GY5A 1QBLL 5I1DB 5CD5D 3FMGH 2NY3C 3Q2CA 1KC5H 3IDYB 3KPOA 4JEGB 3MA7B 3VRLE 4HF5L 2RBLA 1UT9A 1II4E 1M1SA 1HQ4B 1KCKA 2AJYH 4U1HA 3VFTA 1ZGLM 3DMMD 3OBAA 4K8RD 3H9SA 2Q7NA 5E7FA 1QKZH 4NKOB 43C9B 3PQYA 5C6PB 1R5WA 4PB9H 3MV9A 5DQDL 4Y4HD 2AGJH 4RIRB 2AKRA 3OJVC 4UDTA 4HMEA 3KPRA 5F21B 4M3JA 5I66A 1KT2A 2HRPH 2J5LB 2V17L 2IANE 3T0ED 3FOLB 4WI5A 5KS9A 4L8SC 1Q0YL 1DE4A 4Y19B 2NW2B 5EH1A 5SX4I 4B0MM 3WHXB 1M05A 5ECJE 3D0LA 2GIYA 1FNLA 3ARBD 3MZTA 3FQNA 5CILH 4TRPL 3ZTNL 4PJIB 1QFWH 3ZKND 4MCZA 3PWLA 1CFVL 4HUNB 2WUBH 2AP2A 4H1LB 4DKFL 2NX5B 4WTZA 2IGFH 2ESVB 1WBXA 1ZT7B 3RWFB 3TT3L 3ARBA 4HV8A 5DC9B 1QLFB 1FC2D 5GRWA 5B22A 4YEFA 2I60H 3TYGL 1HSBB 4YEEA 1JPST 2X4RB 2YA2A 1WEJL 2X5PA 1L0YA 1GOGA 2R1WA 4W6XB 1RZJC 4F9LC 1QFUL 5I75B 2HT2C 3QCUL 4ZFFB 4U1GB 4PJBB 4MJ6A 2FX9H 3R0NA 4LAJH 1NAMA 5I1LA 1S7QA 2D03H 4Y8DC 2DQTL 4HXBL 4OZHE 3PHQA 3RKDD 2QR0A 4JZNA 2LAGB 1DBAL 2OMBA 3B9KD 2E8YA 3MA9L 1FNHA 1WVZA 1U8HB 2VDKL 2HA1A 1KCUH 5D96C 5KS9B 1U8LB 3ALXA 2D7TH 3TBVA 1XGRB 3V6OC 5F71A 5INCB 2YWZA 3KXFD 1HXYB 5EU5B 1M05B 3DSNA 3T0DA 2EDBA 1MREL 3M07A 4DKEL 1UACL 1Q94B 1YEHH 1ZLSH 1N6QH 1V7MH 1U8NB 3QXWA 3UJJH 1YEIH 2HT4C 2DB8A 1QNZH 4ZPTB 4MA1B 2GUOA 1Y18A 4APQA 5E08L 2MCPH 3V5DA 5ID0B 1M71A 4OCNC 5KS9E 4MD5A 4DW2H 4JR9L 4JFZH 4ZS6D 5FHBL 1HOCB 1RY7B 1UH4A 4L1HA 1DQTA 2F58L 4FQPA 4KJPC 4LLVA 4X98A 4DGVL 4FA8A 4OQTH 1JRHI 5F8RC 2EICA 1OAKL 4DUWA 3U7AA 4KI5D 1IC7L 3ARGC 5FHAH 1ZVHA 2Y5EA 1U42A 3GSRA 3O2VH 2BDNH 5F9OL 1XMWA 1U95B 3LEVH 1T20B 5E99H 4UI2A 1T7ZA 3FB8A 5DJ0A 1JI1A 1MFBL 2QV2A 5BJTB 4M1DL 2DIJA 3O3DB 4U6VH 4MAYC 3RIFK 4NFBA 2IH1B 3FT3B 2X05A 2JLLA 2NY5H 5E4EC 2CO6B 2LQRA 1AGEB 2OP4L 3WO4C 1JI2A 5KSVB 2ESVE 3MRPB 4PREA 1FBIH 1FG9C 4X6CA 2DLTA 4IMKA 4LLQB 3GGWA 1NBVL 3MCLH 1AD9B 4ODVL 5LWYL 4NQSB 5ELIA 4OZHA 1IKFL 1D9KA 4Y8AA 1UQSB 4PJFF 2IG2H 3I6KB 4S1SL 3P9MA 4HLZH 3H3PH 3F5WB 4IMLA 4PJFE 1XR9A 1NMAH 1REIA 4NWUH 4JZJC 3O3UN 4IJ3C 3UTOA 5F89B 1X5ZA 3QDJA 1I9RL 5HHVL 4P3CH 5I8CA 1RURH 3T4AB 1T0NA 4PJGE 5IHZA 1J86A 1EFXB 2APFA 3KR3L 1NLBL 2MQ3A 5E03A 4LGPB 4Y4HB 3I6GB 3VGHA 1DLFL 3ULUD 3L3GA 5I6XB 1HN1A 3VXOA 3THMH 2BNRE 5DQJB 2XZQL 5DMGC 2QHLA 4O51B 1VEMA 3HMWH 5DDHA 2V2XA 1UYWH 4DK6A 1KG0A 5D71L 4S1RH 3IKCB 1LO0L 5C0GA 1I8LA 2QTEA 1ZMYA 5C0DB 2XTJC 4OCLC 4CU6A 4TSAH 1N59B 1S9YA 3HPLA 1AGBB 1CIUA 3U6RA 1T22A 4QRQA 5E8OB 1I9EA 3CAFA 3PWJB 2JTDA 4HAGA 3KYKH 1KIQA 1LMKA 1MIML 5GS3A 4DGIL 3WXVH 5C0FA 2GSGB 1AP2B 3FHQA 4U1HB 4U0RC 3S3PA 5KAQG 5DJ8B 2AQ3A 5J56B 3FO2A 3F5WA 4IMLB 1YEGH 5ENWB 3P40A 3ARFA 1OGAB 4KKLD 1ZA3A 2VDOH 1CE6B 4GXVH 4CVZA 3RVUD 3AM8A 4H1LG 1X3DA 4WW2A 1MUJB 2NXYD 3HAEG 4BZ1L 1P7QB 5TE6H 4IIQA 3VWKC 5JR1L 4FQQB 2WBJA 3QWRD 2HKHL 2HVJA 4ELKB 5EU7E 3MYZA 4MDJA 4CBPA 4B7LA 4LNRA 3RWDB 5GRJL 5I17A 4YHPB 3EJYC 4NHUA 4FXGB 1K9TA 2BMKB 1XGUB 4UIKL 2AJXH 5KSUA 3FO9A 2BNRA 2EYRB 3MJ8A 5IFJB 3MC0A 4XAWL 5GJTL 1S9WB 2CIIA 1MRFL 4DVBA 3VFUA 4JPVH 5ACZB 3EYOA 4GG6B 4HXAL 4G9DB 5BO1H 2K3TA 4WI3A 1XAUA 2J2ZA 3Q5YA 1D5ZB 5JUEH 5EC2A 1JUFA 3G5XA 2VZTA 3LKNB 5HYQA 1YJDH 1IEBA 3RZCD 2B0SH 4KTEL 2X7LB 4Z78A 3KPSD 3TYFA 3BKJL 5DUPH 2ZSWB 4A6YA 3O8XC 5IG7A 2Q8BL 2V2WB 5EZLA 1PSKL 4PJFB 4IRJD 2CO7B 4DGYL 2VIRB 3G5YA 3S98A 5EIQA 3CFKA 4LHUD 1EO8L 2PTTB 3UPRB 1UB5A 3QHFH 4FNLL 1UWGH 1UWEH 2R23B 2YK1L 1XR8A 5E8DL 1YNTA 4OI8A 3DIFB 1QSEB 3UBXG 5EIIB 3UZQA 1KFAH 2IWGA 3DVIA 1SY6L 5EO1A 1UJ3B 3SE4C 3ZHKA 3HRZB 1QSFD 4OT1L 3N1MC 5IEKA 1I1YB 5DHVB 4X9GA 1CXLA 2DKUA 1GIGL 3PP4L 3BDYH 4EKXA 3S9DB 1A7NH 3VD4A 2VWEE 1MCDA 4RFNB 4JRXB 2E9WA 3G9VA 2AXGA 1D6VL 1QR4A 4R26H 1KPRB 1FL3A 3WSQH 5GXBB 1XF5B 2DRUA 5DVLA 2VMFA 1XF2B 3L9RB 1J9CT 1NEUA 2XQBL 2PO6C 3O41A 2A6KB 2GTWB 3MRBB 4QRUA 2G60H 4F7MB 5GRVK 3DUUA 3U82B 2Y9RT 3ES6A 4XC1L 3M1BA 1JYXA 3BHBA 2W59A 5CSBA 4OLUL 5IEHB 2EH8H 5SWZD 1T5XB 4XNQB 2FB4H 1MJ7H 4O00A 4LBEA 1IAIL 4HJ0D 1ZGLP 2RIKA 2WLYA 3MV11 2NW2A 3IDJB 3RDTA 3FQXA 3SOBL 5DD0H 4O2EB 3MROB 4WFEE 5MERA 3SKUD 2Z31B 1BWMA 3C60A 4I0PC 3UTTB 4QHNB 1XF5A 1CDHA 4NNPH 5HVFB 2HFGH 4Y4FC 3TIDA 2I07B 2DM4A 2EE6A 1VEPA 1JF6A 3HB3D 4CN1A 5EFIB 3W0WB 4LKCA 5I8OH 1JRHH 4JRXA 4NUGH 2E6PA 1W72A 1DQLH 5L9DL 3O45B 2WLZA 3VRJB 4NJAH 2VXUH 1C5CL 2P43B 3AAZA 3OKKA 2RB8A 4P9MH 2L0DA 4TYUA 5E6ID 4GBXA 3QQ4A 4KC3B 1S7UB 4YHYC 3HNSL 4JY6B 1QO3A 5AD0B 5LQBH 5D1QB 3WFHA 3RL2A 4IRJB 4OTXH 3V6OA 1FIGH 1A6ZA 4P5TC 3TC9A 4M1CD 1T5XA 5C8JB 3QFDB 2NY4D 3DMMB 3RGVD 5DUBB 1BVLA 3B9EA 5C0BD 4EI5D 1FSKB 1G6RB 1GRWA 5GS2D 1T03H 1S7QB 1G0XA 3TBVB 2OTPA 1UEYA 1Z5LB 4PJIE 3RWEB 5LAXB 2X4PA 1IE5A 2R56H 4NQXA 1FL5A 5HYSB 3D18A 2EO1A 2NY1B 3D87B 4LVEA 4EQ3A 1ORQB 2QQNH 3RIAF 3MRFB 1S7WA 3HNVH 1PBYA 3HZYA 1J18A 1JZ6A 3IJHA 1WJ3A 4PRNB 1E27A 3D39D 1RZ8A 3QQ4B 1FVCA 4Z5RA 3G6JB 3E0GA 1ZHBB 3RIAK 2VLRA 1JMXA 3OXRA 1PG7X 4JKLA 5F93C 3MUJA 1RFDL 1RZIB 3QHFL 5SWQA 4PJEE 1FNGA 2VL4A 2I5YH 1A5FL 1MH5A 1CT8A 3VA2C 1O5DT 4U6XA 1C08A 4NP4H 5FOBA 1U2HA 1JF1B 3BJLA 3HCVA 3WUZA 3X3FL 4HJGB 1AGFA 5ITBH 3CSYB 1UXWA 2R2EB 4FTVE 5DD6B 2PXYC 3BP7B 4TUJB 3OXSA 3ECBB 5BZDB 3ARDC 3QCUH 4YXKL 5B8CC 1J05A 2EDWA 2ADFL 3UXFA 1F58H 5MHSD 35C8H 4HXBH 4M5YH 3DVNA 4HS3A 2CLRB 2DQHH 3NIGF 5D8JL 1H3GA 2WBKA 4PJHE 1I1FB 4M4PA 1BVLB 5ISZE 4GKNA 3SDAB 3K8LA 4P5MB 1Z3GH 1VCAA 5KSAB 4LQFL 5C08A 3BE1L 4WENB 3V4PH 3C60C 3MBXL 3DROA 1Q9KA 3DMMC 1V7ML 2JE8A 2Y5TA 3WBDA 4UIMB 4JVUA 4NCDA 3V0VA 2Q76B 4TNVF 1CFNA 1CLZL 4OZ4B 3DI2B 3KG5A 4JFZL 4ZFOL 1JGDB 1BREA 4KI5C 4JO1L 5HGHB 4MNGB 1BIIB 4LLAA 5HYJA 3IETB 3LN5A 4L3ED 5IHZB 4ZO9A 2GITA 3N1FC 4MWFB 2XKNB 2FECI 4I4WB 1K2DA 1C08B 1MQ8A 2C3WA 2PW2B 4GBXC 5ALBL 1YEDB 1FYTB 3O2DH 3C08L 4UT6H 3S36X 4K3HA 5T1MA 5LKNA 4DEPC 4EI6B 3AC0A 3QEHA 2FEDD 1DFBL 4UUJB 3BP7A 2J12B 5DHVH 4QCIB 4LVHB 2GJ6B 3ECBA 3MCKA 5BZDA 5TH2A 5D9SB 3HMXA 1QSEA 3TCLB 3VH8A 4S10A 5CP7B 1A1NA 4UQ3A 1A7QH 5E8EA 3T8XA 3IRPX 2WBWB 5C0AD 4YH6A 1QEWA 2Q20A 3FO1B 3EOAB 2W9EH 1KCSL 3KYMB 2VQ1A 2BC4B 4TUKL 3DUSA 2ERJB 2P45B 4JPIB 3EOTH 5EU6D 1QSED 1IKFH 3KLAB 4NQDB 3QEQD 4P5TA 4YX2L 3MYJB 5TFSH 1IILE 1LILA 4ODBD 5IV2A 2FJHB 4PGJA 1HCFX 2DICA 4JKMA 5C0CD 3PL6B 3BWUC 4NQEB 1EAJA 3HUJB 3Q5OA 2BOBB 4TRPH 3NFNB 1FVDB 5EU7C 5JPNB 4J3SA 1I9RH 2A83A 1J5OL 2PCPB 4FZEH 3CVHH 2XZAH 3U46B 1ZEAH 4EN3C 3NCCB 5IMOA 1VGEH 3ZE1E 3F58H 4LSVL 1RMFH 5IW6A 1EMTH 4GOSA 3L3IA 4YXHL 5IWLA 1KLGB 1CICC 1K4CA 4F15C 4Q9BA 4R7NB 3JTSA 1O7SA 3THML 2AK4E 2X42A 1CDUA 3LEXB 1G1CA 5B8CA 4XTRD 5IB3B 1MCEA 4LIQH 1CE1L 3V5DB 3BIKB 5DI8A 3WLBA 2BY3A 4FXGA 4DZBA 3MOAH 2D0HA 5IK3A 2AJUH 5CMAA 1G9EA 2FECL 5TPWL 4F33B 1H3XA 1IM3B 1TVHA 1UGNA 4N8CL 1SMOA 3OR7B 3LQAC 3O4OC 3QPXL 1H5BC 32C2A 1MHCA 2VKXA 2YD8A 3V4UL 3DETD 2EDNA 2C3VB 1ACYL 1KT2B 4HUVB 2EIDA 35C8L 2F54D 1DQDH 5C3TA 3O4LB 3PV6B 4LCUA 2B39A 4OD2A 5EU3B 2VIRA 4PP2A 4Y5XB 5CJ5A 4UNVA 5BMFL 3SDXA 4BFBD 4YQXH 1GGBH 5CJQL 4JO2H 5CIPA 1FRGH 4R2GD 5ERWA 2DDQH 4BZYA 3P4NA 4D9QE 1X5HA 3DX6B 3FQTA 5K59F 4D2NA 1NDMA 1SM3H 2PCPA 1OHQA 4PV8A 1QZ1A 1FQ9C 4ZOCA 3ARGD 4JM2C 2OK0H 2FR4A 4YR6B 3RX8A 4HBQA 1RIUH 4MD4A 2NPLX 3VXSB 2Z8VC 4G9FA 3WN5C 4MA8H 2MNUA 4OGXH 4DAGL 2EIEA 1MRCH 4RGOH 3AREA 3ARVA 3AM8C 4ONOA 4LP4A 5SX4H 5B39B 3C5ZA 1CQKA 2I27N 4G3YH 5BVJB 4Q9QL 2N4IA 4K3EL 2P5WA 4B41A 3UTSE 2B1HL 2PTVA 1QD0A 3T1FA 3ARBB 4HV8B 3GSOB 5FGCE 5CHNA 4XNZB 4OD1L 3O2DL 2XNAA 3NA9L 4XPGH 1X5KA 5GIRB 1U3ZA 2R1XA 3C2AL 3X17A 2OP4H 3F6IA 2V2TB 2FLBT 2HLFD 5H8DA 3BQUA 1CT8B 4MVBC 3P0YL 1HZHH 4AEEA 1Q8MA 4U1MB 4LRIC 3CZFA 3PXHA 5J13B 1B4JH 4KUCD 3C6LA 2OBGA 5DRWA 1IQDB 1MY7A 4L3EB 1Q9LB 1X5XA 2GCYB 2V2XB 4H20L 4NYLB 1P2CB 2GT9A 5KZCD 3K2UL 1EO5A 3WNLA 3EO9H 4GQ9L 4KJYA 2GUOB 2NY4B 1P69B 3LN4A 4CMHC 4Y5XC 5TFSL 3FQUB 4DVRL 3H2WA 4G8GD 5ICYA 3OAUL 1KELH 4CN6A 1FV1A 3REVB 3SDXF 4N5UA 1GIGH 1I1AA 4QOKA 1S9VA 3EGSA 4YWGH 1S9KC 3L3OA 3GI8H 1XGPB 2W91A 3EO1B 1WZKA 1FAIH 1VPOH 2DQJH 5D5MA 5TDPA 3NAAL 3MJ9H 4ZDHB 4P46A 1A14H 1OAXL 4Z18A 4CVXA 1UM4L 3N1PC 1MWAL 3PWVB 1CFQA 4YXHH 2C7UA 1WCBB 5K59E 1QLEH 3MBEB 4D9RE 4PJXB 1MELA 3OKKB 2WBJB 4P46D 5KVEH 4LK4A 4XI5C 3QRFM 3ARQA 1LO0H 3IDMB 2MHAB 1LE5B 1P84K 2OMNA 4G8EA 3DLQR 4QY8B 4NKIH 1OVZA 2W0FB 2NX5D 2BRQA 5CGMA 3MLSH 4CU7A 1T89A 3MRPA 2E7CA 5EPMB 1AKJB 4U05A 1FAKT 3BKCH 5C2BH 4UU9B 2HTLC 1W2KT 1D6VH 4Z7OE 5D6CB 1C5DA 1E4WL 1AFVL 1YQVL 2AJVH 3KAAA 5KVGL 5I1CL 3SKNB 2ICCA 2XQBH 1T7VA 1NFDA 1P4LA 4JB9H 5DJAA 4J4PC 4GAGH 1MRDL 1QLRA 3HKFA 4XWOD 3OGCB 4X6EA 4PJCB 1NC4A 3EFDL 4HC1L 4NQSA 4TOYH 5I73C 3S8WA 5J3HD 2XXCB 3QQ3A 1I8IA 4K3GA 3CFIC 1NFIB 1RJYB 1FL5B 2J6EL 3KLSA 3VFVB 2GJZB 1MREH 3H7LA 2J8UE 1KJ2B 4OI7A 5AZEH 3LKNA 2EH8L 2FEEI 1FP5A 5TE6L 4RRPG 1CXKA 2X44D 4L4JA 2FYYB 5DUMH 4WCYL 1IFHH 1Z0MA 3SE3C 2AEPH 1T04B 2DQUL 5SV4A 1JE6A 4LARL 5JIIA 2BSTA 4O51A 5GJTH 2DS4A 1IL1A 3IAPA 1IC7H 1TTUA 1TPXB 5FHAL 5E94A 4POYA 1RUKL 3P73A 1ITBB 2MMXA 3HS0A 3ARFD 1N4XH 3K4AA 5FUOH 4LU5L 3GBMH 5IEKB 4JM2F 4Q9QH 1VA9A 5FKPB 5JUEL 3FHAA 5E5UB 1JRHL 5F88B 1PQZB 1UKTA 2HH0H 5HDOA 2FSEB 1RIHL 5JMRA 1OWRM 5F9JB 3G08A 1G7HA 1NGWA 1L7IH 5AUMB 3CX5J 5CEZL 1IEHA 1N26A 1FE8L 1EV2E 1BF2A 1DBML 4R96B 4KTYA 1JNNH 4UAOB 1KCRH 1R24B 4Y2DC 5ENWA 4LKXB 4PJ7E 2AXFB 1W8OA 2GSGA 4N0CC 1SHMA 4Q74A 3VXUB 3OAZH 5JW4M 1IZKA 3QG6A 2BK8A 4GO6B 2NTFB 3CCHB 4JZNB 2D31A 5HHXL 1PEZA 4JDTH 2E9JA 2X4UB 2QADC 2GI7A 5KTEH 5E2UH 1WFNA 4PUBH 4WO4C 5EUOA 3F12A 3DURA 4P4KB 4FHBD 4KUZH 4HQQL 3JZ7A 5D7LE 5IFJA 5SV3A 4MS8C 4X9IA 1KLUA 5JHDE 1P9MA 1H3VA 5EA0L 1UVQB 3SE8H 4MX7A 3BYTA 3K74B 3MMEA 4G9DA 3E8UH 2H32B 3GDBA 3PQYD 4NQCE 5J9PB 1FGNH 2QHRH 2JB5L 5C92A 4Q6IC 4EN3D 1MOEA 4NRYA 4PJHA 5IB1B 4M02A 2EDJA 4WTWA 1AJ7H 4UNUA 1CICD 5C0CE 2YZ1A 3MACL 2M26A 4OGAD 2NXZC 1A7PH 4UDUB 2FX8L 4Y4KB 4IEFB 1LK3L 1A5FH 2IMNA 3SDYH 4CMMA 9CGTA 5EC1B 1QPPA 4WUUE 5J89A 1R24A 1OARL 4NFDA 1BQSA 2YRLA 4JLRA 3SGKA 3P77A 1CDGA 2R0ZL 1WBYA 1YN7A 4DN3H 4P2RA 4RIRA 4FQ2L 3MV7E 3WL9A 4NPYA 4ZOEA 2R69H 1N3NB 2AJSL 3CFDA 1D5IL 2YSSB 1F58L 4WEUD 4X4MA 2LVCA 4L4TE 1BGXH 1YEGL 5LGKA 2N7BA 3BQUB 1CBVL 3CH8A 1SJXA 2ZUYA 2IFFL 3MMEB 4KK5C 5C07A 2J7LA 3CFBB 5SWSE 2GTZB 4JGMA 3WIIL 1MCIA 2A9ML 4HWBL 4PLOB 5CD5C 2OM5A 5CGYC 1D3CA 5T1KB 2V7HB 4XHJC 2DYPB 2HJLA 4BZ1H 4ZFOA 5EOQL 4U3XA 1LO3H 3SDCC 1BECA 1QHPA 4KPHH 3PP3K 4YHNB 4V1DB 1A6AB 4NN6B 1K4CB 4WWKB 5FYLL 4HH9A 3FOMA 3QQ9D 1BFSA 1KV3A 1QLFA 5L88L 4ZNEA 3SY0B 2O5ZL 1UA6L 3SE9H 3ZKQD 1BZ9A 3V6OE 3GKZA 4ZNCD 3D69A 32C2B 5I9QC 2EH7L 5L2JB 1UH3A 2XY1A 1W72H 1UM6L 5F1KC 3EOTL 3GI9H 1FG2A 3AXLA 5ALBH 1MCPL 2GAZB 2P8PB 2F53B 3EHBC 4HG4K 4HUVA 1MQKL 2GSIA 5FOBB 3RBSA 4D0CA 3HA0A 5I0DA 1EA9C 4P2OC 3P77B 5DWUH 3BMVA 2PXYD 1MHCB 2YUZA 1A3QA 2IALB 4N5EC 4KVCH 1EK3A 1YEJL 1OTSD 3PGFL 3CVHB 4FFYH 1CK0L 2XN9A 5DMIL 3LKRA 4OCRH 2EIZB 5DA4A 4P23B 4OF3A 4FQCL 2H41A 3WNKA 4YE4H 1QG3A 4TUKH 1E28A 4G6KL 4UV4L 4F7EB 2NTSP 5K33A 5E9DB 4MA7H 5E7BA 3K0WA 4QEGA 1LO2H 4HUXB 4D8PB 3D69B 3DBXB 5EU4A 4YX2H 1H3PL 3MFGB 4XC3H 3HR5B 1CGUA 3V4VL 2F15A 4PJAE 5BVJA 3HPJB 2F53A 1F3JB 3QXVA 4ETQB 1DQQB 3FOMB 2UY7A 2OYPA 4NT6B 3B9DA 4PIRF 1KB5L 2NW3B 1JK8A 4FMFA 4FFWD 4D3CH 4KRLB 4D9LL 3L3JA 2EDFA 3Q6GL 1ZA6A 1UFUA 3CVHA 3WO3B 5FM5M 1FO0B 1R5VA 1JZ7A 2CDGB 3BWAA 3OKMB 4NBZB 3RZCA 2YHGA 4JFFB 1EMTL 1JWSA 3NH7H 3KPSA 3ULVD 4FFZL 3IFNH 5EBMB 5CKAA 4D0CB 1WBZA 4N0UA 2E7LA 2RCSL 1FGVH 1MJJA 3LDBB 2H2PD 5E2WH 3ULVE 4LQFH 1KB5B 4RGNE 4TUOA 1J1OH 5HGAB 4P9HC 1Q9LA 3ARRA 1TMCB 5D9SA 2JJUA 5IB2A 2VLME 2NXYB 2Y25A 1MJ7L 1QHOA 2VLJD 4YO0A 1EX0A 4MCYB 1U41A 2WZPD 3KYNA 3P11L 2X6MA 3IVKA 1KGCE 2B1AH 4OCXL 3H42L 5F89A 1T2QH 3HRPA 4P5KB 3S36H 1D9KB 2DD8H 3WD5H 5FYKU 4GRLB 5JXEA 3ZYIA 4RGOL 1FO0A 2D7QA 1BGXL 2Y7QA 2ZCLH 3HUJE 4O4YL 2YD9A 4PRDB 1K85A 3BGAA 4W4OC 2VDRH 4RGMC 3D25B 3KHQA 3VXOB 3HI5L 3OWEA 4JRYD 3WNMA 5TDPB 3Q6FA 1CFQB 4OFYA 4PJ7B 3LMJL 4ODHL 2DDQL 4KROB 2XT1B 3MXVH 3WFDH 5B38A 3VXMD 1KG0B 4JHWL 3FTGA 4KZDH 4U1SB 2R0KL 2ADGA 4HDIA 5FUZL 4RNRB 1PX3A 1ES0B 3QR2A 5D6DC 3CDGA 3EYQC 2MSPA 4WUKH 5KSAA 4HS8H 1HI6B 3BX7C 2YR3A 3E6HA 4PJ8A 5T3XL 4BK5A 4HFWB 3IU3A 4NKDA 1OAZL 3UJTL 1W72L 1AXTL 3C60D 4J8RB 4GQ9H 1QLRB 3WS3A 2WWKO 1TVBB 4P49A 1N0LA 5HVHB 4OD1H 5DRXB 3H6JA 3WJLA 3CJJA 5I30H 5HGDA 5TE4H 5HI4D 4MLSA 2YD7A 2ZOKA 5D70L 4ZUWB 2EE9A 2WINB 4X0KA 3L3HB 1LO4L 3L5XH 3R0MA 4LPCA 4JE4B 4FFYL 3MUGA 5L8LB 2NY6D 3RVWC 3S34L 3F58L 1OD7A 3GSUB 3MJ9L 4LSVH 5EZJB 2J8UB 4DQOL 1QBAA 4HPYL 4HD9A 3QG7L 1YEEL 4RAVA 2N7AA 2VLLA 1AY1H 2UUDH 1D9KC 3KWWA 7CGTA 4OM0H 4UUJA 5HHMB 2CR6A 4P2QE 1KIUA 2M8XA 4RFOL 4DVBB 1T1WB 2L7UA 3ZHLA 4BZ2L 1IGTA 3MOAL 4NP4L 1SEBB 3REWB 4P46C 4YR6A 4QHUB 5KW9H 3MV7D 3PXJA 6FABL 4M62H 1JZ2A 3O9WB 3LB6C 5B3JE 5C70A 1ED3A 3WXWL 1D5XB 1K3ZA 1QEWB 2WUCH 3RI5K 2NY2C 2HAZA 5MEQB 1AHWB 4MSWA 4J1UA 4I77H 1KJVA 2ICEB 1H0DA 1A14L 3P9LA 2Q7YA 4LSRH 3NCMA 3GMMA 4LHUA 2VJXA 4XMKH 1NCDH 1MHPL 1IEAA 2YPLA 5A3ID 5IVXB 3T0EC 2IBBA 4KV5E 5HHOD 1A22B 3KLDA 3GRWL 4MJ4A 3VMPA 5IFHH 4NIKB 4XP4L 5E6ZA 2QJDA 4A6YB 3HLAA 3QDJE 4QLRA 1SEQH 1S7TA 2PF6A 3WIHH 4P59L 1R5WB 3VDBA 1E6OH 3BJ91 4YLQT 4LPTA 4PJFA 4HJ0C 3V2AR 4LCCC 4KTDL 1D5XA 5DD5H 4P2CG 4LASL 1FVEB 1QFOA 4HX1B 3VXME 3WHE1 2IQAA 4LL9A 4KQ3L 1KJVB 2ICEA 2UV3A 2VSDA 3GHBH 1T1WA 2OQJA 1YEFH 3S35X 4PRHA 4WU7B 4X6CE 2ZCLL 1RUPH 1DFBH 3SGEI 2ESVA 4RMVA 1U36A 4NOFA 3GSVA 4HUXA 3T77B 2CRYA 3ARGA 3B5GA 3N85H 3QUMH 3QDME 1KJ2H 3WFDL 2EYSB 4X6DB 3O6FB 1ZHNA 2C1PB 4QXTB 3OX8A 1MHHB 3DI3B 3OR7A 2ESVD 4LCUB 5A2IH 3OHXB 4XT1C 4WW1B 4GKZB 3VCLA 4EZMA 4BUHA 4B50A 1HHJA 4Q6YA 5ESAA 2B20A 3UTSB 1DVFD 4C56B 5JDJA 1ZLWK 3GJFK 1TNMA 4PG9A 3JWDH 3GBML 1YYMH 2H45A 1NDMB 4MZ3A 1WBYB 3RY4A 1A6VH 3HMXL 1YYLH 2PKDA 2ZP0T 3DRTA 3MUY1 2V17H 4UINL 5CIPB 3JSSA 5HPMA 2BCKB 1EFQA 2CKBA 5DD3L 3TJHC 4GKSB 2VDLL 3OMZA 2AJYL 4LSQH 4JFHE 5IQ9B 1AO7E 4FZEL 1G0YR 2VLKE 1WSST 3FO0H 3ULUE 1ZEAL 1XF4A 1S7XB 1QFWL 1JCKA 1YDPA 4YFLF 1NCAH 5DHYB 1WITA 4LCCB 4X9FA 5AEAA 3K3QA 3LV3A 2YUWA 4RISH 1GL4B 3D2UB 1RIVH 5D7SL 2X9YA 5JW3L 4O02H 5EFIA 4GFTB 4HSQA 4K2UH 3RHWF 2CXKA 2IEPA 1CE1H 5CEXA 1CLYL 2VR9A 2I60L 3TVMC 3H9HA 4G7VL 4GQPH 4ONHA 4IS6B 3IAQA 2VXTH 3WIHA 3QI9B 4NQCD 3GIVA 5HYSG 5K9QG 1YEKL 3MLWL 3BD3A 2VO5A 4JQVC 5FYJD 3VXSD 4I2XB 3MV9D 2E27H 2W0PA 4JZOB 1E4WH 1MAKA 1RZJH 2R15A 3SDDD 3KPRD 5HD8D 3O0RH 3NA4A 3AROA 3B6SA 3ZL4H 2R2HA 1D9KD 3UC0H 4PJCF 4LLUB 2EKSB 3SGJC 3ROLA 1GGBL 4HKBB 1HH9B 4F7EA 1AD9A 4WGWB 2WK2A 4G43B 5F9JA 4XMLL 1F5WA 3ZLQC 3BKYL 3OR6B 1NMBH 3D85A 1U8OB 4IBLT 2R0ZH 1FVCB 4Z5RB 1KSRA 1MFCH 3OXRB 2O5YL 3QXAB 4QRSA 1RZIA 1A0QL 5DD6A 15C8H 1GAFL 1UCBL 5J12B 4WI6A 2X4SA 2ADJB 5J7CC 2YXMA 4RQQA 4Z0BL 1MFEL 5D2LA 5IJKA 3HAEB 1U93B 4GW1B 4JAMA 1RZKH 1SJVA 3RUGE 3LKPA 3WIIH 4HUWB 1H3TA 1NCTA 2QSCL 2H9GA 3O2VL 3OB8A 4M43H 3N9GH 4OI9A 5AG8A 1ND0B 5I1EL 4WUUA 3ROLB 1XCTB 1MNUH 1S5IL 4JZOA 3VDCA 3TN0C 3DTXB 4XH2A 2B2XH 4GG6E 1NCWL 2L4OA 1RK1A 3GJFB 3KYOA 1S9YB 3ZT6A 3B9KA 3LS4H 4F2MB 3QI9C 4ZFZA 4P5MA 4OF6A 5FHBH 3IVKB 4OFPA 4OLWH 4C4KT 5JHDB 1DBKL 4S1DC 1JGDA 4PG2C 4PGEA 5DT1H 3CU7A 2EH7H 1SVZA 3TBTA 5JA9A 5JNYB 4RCAA 2ADJA 4CMMB 1MI5D 4Z7QF 1Z9SA 3TZVB 5IT2L 1YN6A 3D6GA 4NO0D 5GZOD 1UWXH 5BXFA 3MJ6A 1A9EB 1JZ4A 2NY6C 2DJSA 2APWA 2VERN 3WFCH 3TF7C 5T1MB 4KVCL 2ORBL 1GXEA 3MLUH 4TSBL 4XP6H 3QULA 5MENA 4Z7VF 3VA6A 3UZEA 2CLVB 5I1JL 1JPGB 3QAZC 2UZXB 4OUOA 4IRSA 4PJ7A 5HHOE 3PNWA 4G6KH 2PW2A 5HDBE 1BBDL 1OP5H 4FFZH 5D72H 5EBWA 4X7TB 1MEXH 2EXYD 4XCFH 4XNZC 3C6LD 5D7JB 1HXMA 4YHML 3WJLC 3GMPB 4XTRC 4JHZA 3RY6C 5K9OB 4U3HA 4NWUL 3VGGA 1ZOXA 3MLPA 1G9ML 1FSKC 4FTVB 5CD3B 2X4NA 4WFED 4P3CL 4PJEA 4KAQL 1JL8A 3SGDH 3F7VA 3QIBB 1L9NA 1DLFH 5I66B 2CLVA 1A1OB 4ZSOA 2A9MH 2HTKD 1T80A 3RI5F 4FQXD 3BGFC 1AC0A 4TULL 5ETUA 2VZSA 4X7TA 4HK3J 1T1XA 4JFYB 5EIIA 2DQCL 1NGXB 2JIXD 2ICWI 3G9AB 1Q38A 1XR8B 3IDYC 1K8DA 3PIQB 4M61A 1U0QA 4J3TA 5IMKB 5DRNB 1IC4H 3NIDF 4L9LC 3WJJA 3A67L 1NMBL 1NEZG 3CK0L 3JTSB 4XNUH 5FA4A 5IK3B 5ICYB 2MCG1 4ZAKA 4WHTB 1YNTB 3QUZC 2O5YH 3QIBD 5B21A 4L29A 1A1MA 3VWKA 5B8CB 5J9PA 4M6ML 3F7VB 3PG2A 3B3IB 3OG4B 1U8IB 5GGSA 3VFOB 4EBQL 4OV5B 4ZXBA 1TCMA 1OAZH 3N1GC 3RAJH 3QIUB 4ETQA 2DLGA 4XVJH 1OTTD 3ES6B 4Q0XL 3UDWC 1OQXA 2VZ3A 4ODHH 4L1DA 3KS0J 1H0DB 1A3LH 3PGFH 1HSBA 3SCMC 4ZFFA 4Q2ZB 3OKDB 3O11B 4E42B 3CC5A 1PZ5B 2V5TA 3L7FA 5FUZH 5IIEB 1NCWH 5TQ2L 1MFNA 2P7TA 4PJAB 4FQ1L 5EPMA 3LKQA 3MRKA 4XBEH 4EEEA 2XWBB 4ZAKB 3GSNH 4LLMB 3ZTJG 4QOKE 3X12B 3O3EB 2WMPA 4JDTL 1R0AH 5FYLE 1FL6A 2PXYA 2DQIL 3VFRA 3DNKA 4BZ2H 3GSNA 5I30L 3BGFB 2A6JB 3K4ZA 4PJ9C 1P7QD 3NACL 1N0XH 2B5IC 4K3DH 2CDEB 3O6KL 4L3EE 5FYKH 3RA7H 1DLHB 3L5XL 5A3IC 1LE9A 4E9LA 1A6AA 2FLRT 4K9EC 3KXFA 3RKPA 3ULUH 4CNIB 2DOCA 1J1XH 5I2IB 2FATH 3QZWG 2C4FU 3WSQL 5IWLC 1T04A 4UBDD 1YNKL 4UT7H 5I74B 3VWJD 4Z7VA 3ARPA 3AS0A 1W72B 5T1DL 2AJ3A 2IQ9L 3HR6A 5EUOF 4I48A 5IVNA 1U3HD 4J6RL 4NOBA 5CBAB 1P2CA 4IOFD 4RWYH 4HUWA 3CD4A 3MO1B 4P23A 3TA3C 1TQBC 3W11D 1Z9MA 4ZTOH 4TVPE 4V1DE 4QOKD 2KQNA 3RVVC 2ARJB 5A16B 1RZ7H 5D1QA 4LRNH 4LSSL 4Y5VB 2A2QT 3V6FB 3PGCB 2X4OA 3CSGA 3O8XD 1KF9B 4AENB 1IT9L 4OZFB 1QVOA 4KJYB 3S96B 3DX9A 4G9FE 3ULSA 1F4XL 5KVDL 2PN5A 4XZUA 4NQVA 4OKVB 2G5BA 1I9IH 4MJIA 4XCYB 4KDWA 1YMMD 1OF2B 1RULL 4BFEA 3QDGA 3RDTC 3VG0L 1YEHL 3LVEA 1FDLH 3UJJL 3L3JB 4P4KC 3BFOA 1DQMH 2C3HA 3GKWL 3ARUA 4GKOA 2DQEH 3C09B 3VFMB 2DQCH 1DBBH 4I3SL 1E6OL 3NOIA 2W0FA 4P57A 3EO0B 3K7UA 3VD3A 2VXUL 1MCWM 2BNQB 5INDB 4OB5L 3NIFF 3QISA 1L0QA 2V9TA 5GPRA 1NAMH 3STZB 1ZLVK 3DVFA 4KZEL 1LK2A 2DLFL 3GSWA 1VKXB 5C0CB 4RX4A 2RQ8A 1CFTB 4ZYKA 4NNXB 1MRFH 2IH3A 3TIEB 2Y06L 3TZVD 2ATKB 2FO4A 1PG7W 1RJLA 3MRMB 4JO3H 3QUZD 3VWKD 3BP4A 1IAMA 5F3BA 3LEVL 3UBXA 4BYHA 2X1PA 4DK3A 1AGCA 3DYMA 4RX4D 4ODXB 4JFEA 1KBGL 5C08B 2VDML 3GMPA 1IKNA 1KPVB 1HYSD 2HJFB 3LSOA 4PGBB 1BQHA 1CXHA 1OCWH 2Z35B 3EYFB 5DUPL 4P9ML 2XFXA 1EZVX 1NQBA 3BEWB 3VGEA 3EO0A 2AGJL 1VFOA 3LY6A 1T3FA 1FFPA 3RVXC 2PTUA 4FQ1H 5CS7A 5E24E 1RK0A 4JFHD 5E00B 1Q9KB 5D7SH 1KPUA 2AK1H 1FIGL 1VFAB 4M9OA 5HDLA 1BD2D 2FJGB 3FKUS 3P73B 1D5MA 2QEJA 1YEDA 5ITFA 2IPUG 4QGTA 4TVPH 5GS1A 4G8FA 5DD1H 2VAJA 4LNRB 2ADIB 3VFNB 4KRMB 5GGQH 3RBGA 2WUCL 4JJ5B 1FVEA 3CU1A 1S3KL 2R56L 3QPQD 4M00A 3PWNB 5JZ7C 1PW3A 2HVJB 4ELKA 3VMOA 4HIXH 3KR3H 4WNQA 3HE6A 1TJGH 3CPLA 4RAUB 1X4YA 3SO3C 3CVIH 5CJBA 3CH1A 3I6LD 4XAKE 4F2MA 5E2VL 3BPOB 5E8PB 5F1IB 3WS3B 5I1DA 2J5LC 2Q6WB 4XVUD 5I15H 2EZ0D 4XC1H 3T4YA 2P24A 3OPZH 5ACZA 5T5NG 2MJWA 5E0QA 1E6JH 1K8IB 5E1AB 4BFIB 2MKLC 2F5AH 4H0GA 1V5JA 2EEDA 5IV2B 2LU3A 4QGYA 1MHHA 4M6OL 3H9SB 4OCXH 5D2NB 1X4XA 2XTJE 4ZUTA 2F58H 3G5VA 3Q1SL 2PW1B 4MHHG 3I2CH 3QPQC 1TZIA 5HYJE 25C8H 5H2BB 4WNQB 5GS2H 3FQNB 2VDQL 1YEFL 1AD0B 2D7TL 4L5FH 3K2MC 2I25N 1QTYT 1BQLH 3EDEA 4F37F 5EWIH 1AR2A 4IRSB 3SPVA 3DARA 1NLDL 1ERNA 1WFUA 4WFFE 1AQKH 2VUOA 3WFBH 3CFCL 3DIFA 4UOW1 4S2SA 3BKYH 4KMTH 1OAQH 5HGBA 2WBJC 3C5ZC 5E5RB 5JLZA 2FZ3A 4PJXF 5IFAH 1ODAA 5IW1A 2YBRA 2ZG1A 2L7JA 3WLBB 4DZBB 5GRJH 4DGVH 1CLZH 1HINH 1SYVB 1OAKH 4AIOA 5DZOA 1QSFA 2NW3A 5IB3A 4P2RB 2F8OA 2C3GA 2HVKB 4NSKA 3U7YL 1KTDB 3FONA 3QEGH 1M7XA 5JXED 5E8NB 3KPPB 4OD2B 4N0FA 3I85A 3H9ZA 4OF8A 1AC6A 5EU3A 5EBMA 3K4DA 4LBEB 2NNAA 4Z7VB 4XCEB 5LJYH 3O2WH 4GMTH 3PDOA 5D1XB 4RGND 4M48L 2ZKHH 5HYJD 2CRIA 4HIEB 1U8HA 2BVTA 4MNQA 4MQXD 3VFGL 1IM9A 5JLZB 4XNYH 2CH8A 1AE6L 3MO1A 1RZGA 1MPAH 3VG9C 5EORH 1X44A 3IGAA 4MS8D 3PDDA 1C1EL 1J1PH 1AY1L 1AO7B 3TIDB 5DT1L 1TETH 1HOCA 3OKLA 4XPFH 1BP3B 4BUGA 1CD9B 4HK3N 3SKMA 3W0WD 5IF0B 5T1KA 4PY8I 1NUDA 2YK1H 3NFPA 1RFDH 1NL0H 1M71B 2CDFB 2R29L 4OGAC 3GSOA 2BZDA 3RTQA 4PJBE 3WO4B 1JNHB 3LQAL 5FCSH 5DSCA 2R9HC 4NNYA 1YMMB 2AJUL 1K5NA 4LLDA 1WFOA 2QQKH 3C5ZB 1ZLUK 1FORL 4ONGH 3V5HA 4F57H 4YPGA 4PY7A 2HWZL 3ME0A 4H8WH 4JN1H 5D7KE 4MNQB 4FQHB 1NCDL 3VCLB 4XRCB 3IGAB 3OB0H 5ACLA 4F9LA 1CD8A 4XCEA 5H37G 4AK1A 4HIIA 3NTCH 3C6LB 1IAKA 5CLWA 1HI6A 3E6HB 4LIQE 5EBGA 5K93A 3GJFA 3J7HA 4UILH 3MJ7B 3B2VL 5IHUH 5TPWH 1D6EB 4JDZA 2YD5A 4N90D 3RTQB 1ZWIA 1MJUH 4YUEL 1FNEA 2IANA 2YPVH 4ENEC 3HZVA 1JHTB 5D1XC 5C07E 3U7WH 5IR1B 5IJKC 3N0PB 1RIUL 1K5NB 4LLDB 1BHGA 3OKYA 3PWPD 3SKJH 1RZKC 4K71C 4Y1AB 5FKAA 3GMRA 1EFXA 5CAYB 4JHAH 4F8QA 4CVXB 1B4RA 1IVLA 3OJDA 4QXUL 4H88H 3UTPE 1QYGL 2R8SH 1JGLH 1JF1A 2FWOB 2HN7B 3MOBH 1AGFB 1MSPA 1F2QA 1QA9A 1N6VA 4O2CB 5I1IL 2R2BA 4Y4KC 3M17B 4P2QD 4C59B 3MLRH 5IB2B 5I18H 3MLYL 1TLKA 2VXVH 3JV4B 1EJOL 5TQ2H 3OKOB 1V7NH 4K94C 4EOWL 4XX1G 5D6CA 1WBZB 2GQHA 1JTOA 1WTGT 2E7HA 2MQCA 3X3GH 1AO7D 2NLJA 2QL1A 4Y5VA 4FABL 4NDMA 3VGDA 4G7YH 3B6SB 3T2NL 3QCVH 2JJTA 1AIFA 5C0DA 1CG9B 3IJYA 4YBLB 3TH4T 1AGBA 4XVJL 1BFVL 4Q0XH 2DM3A 5ADPH 1JYVA 4JCLA 2GEEA 4ZS6C 3NA9H 4J3XA 2YD1A 3DGGA 5HPOA 1N0XL 1ZVSB 1AGDA 4JKKA 4NZJA 2X4SB 4R26L 3PHOA 2AXJA 3IF1A 3VFMA 4W6WB 4DGYH 3RTQC 2NY0B 3QQ3B 1H8NA 3WIFB 3CZJA 1MPAL 1WAAA 3BKML 1SJHA 4RDQG 3VJ6B 1OSPH 3L5WA 3CFJB 5FF6A 3ZMRA 4H20H 3NZ8A 1LO5B 1QFHA 1UM5L 3IS0X 5T1DH 2NZ9C 3RWJA 3G04B 2LU4A 1CF8H 4G7VH 2YEZB 3IDXH 4OGYH 1CD1A 1PX4A 3WMSA 5KVEL 3GHEH 4F9PC 4PJ5A 5DJCB 1ADQA 1YEKH 4HWNA 3IJSB 4LLWB 1JV5B 3RNKA 1D5ZA 1F13A 3C9NA 4BSVA 4NKDB 4YXKH 3LPGA 5JZ7D 3BW9A 1HE7A 1J8HB 3K1KC 3KJ6L 4DFHA 3LRHA 1IEBB 5F3BB 1S8DB 2DL2A 2HJFA 3NCEB 2AJVL 1YN6B 4PP1D 5FKPA 1PAMA 3PQYB 1IT9H 3D9AL 1NGQH 3IFPA 3TBTB 4WW1A 4TULH 2IQ9H 1L7TL 4QTHA 1OTUD 2H3NB 3KPOB 1FFQA 4MNGE 4DEPB 5FF6B 4J6RH 4KGLA 3VFTB 2J6EH 4NM8L 1FDLL 1DQLL 3EDJA 5L9DH 2I9LB 4XPBH 4Z78B 5EU6A 3IDGB 5KSBE 5F7FA 3WCYA 3O6MH 4NRZB 3LPWA 4PRIE 4LMQI 4G5ZL 3BSZL 4G6AD 3BKCL 4JQXA 5C2BL 5DK0A 3RY6A 1A0QH 2JJSA 1WFTA 3EOYG 2DI7A 4OCSH 2YPVL 4JJ5A 3RNKB 3MGAA 4HC1A 1IC1A 2OCFD 1AI1H 1UJ3A 2NY0C 4JN2A 4ORGA 1U3JA 5ILTH 2D2OA 3T65B 1S7XA 2D3VA 3TCXA 4E0RB 3EOBB 2NX5A 4FRWA 3O3BB 3AU1B 3K46A 3UPCA 3LQZA 3B8YA 5I6XC 4OQ1A 2A6JA 5ISZD 5I1EH 5K9KB 1IGJA 4PJ5E 2Q6WA 1TTGA 1R3HA 1T6VN 5MEOA 4NZRL 5HVWA 4IOSD 4LSTL 1A02N 2P44B 4BA8A 1KBGH 1LGVA 1OP3H 3UTQA 4NQTA 5CZKA 1KULA 3LS5H 2AABL 4LHUB 4PJEB 2YA0A 1RVFL 2WQRA 3FT4B 4Y1AD 3RWCB 4WFFD 2HTKC 5GRVL 1G0DA 3WL9B 5BW7C 3HLAB 3GSQA 1R3IH 1XH3B 4PS4L 4YFDB 2EXWD 5DMJB 4JKPL 3BHBB 3TBWB 2BRRL 4KXZH 3W82A 2HFEB 1R0AL 3KNBA 1UZ8B 1U8LA 3D2UD 4QHNA 5CLTA 1WQVT 3AU1A 4PTTA 4Z0XA 5F9DC 3ULVC 5I76B 3B9VA 5JQHC 2QLVB 2VDMH 1EEZB 5GGRY 4YHNA 4O2FB 1NANI 1A1MB 3VWKB 4WU7A 4X4YA 1ZS8B 4WU5A 4X4XA 5LCVL 4OJFL 4XHQA 4OFVA 1LDPH 5ALCL 3NBNA 3TA3D 3DUHA 4G8IA 4F7TB 2VB5A 3MLVL 5CHNB 4XCFL 4YHMH 2XZCH 4X4ZA 1EERB 4POZC 3MACH 1NGPH 4M6NL 3WE6B 1LQSR 4YDKL 3VXTA 3EDDA 4YBHA 3MRIB 5CEYB 5FGSA 2P7TB 2NY1C 5AYUL 5DJXB 4HQQH 3C5JA 2PETA 4LRNL 1SVCP 3HC0B 1BOYA 4U1LA 2CKBB 1UC6A 2CUHA 4DWHA 5GRYA 2BJML 1KCVL 2X9WA 3U79A 2P8PA 4Y2DD 3V4UH 5T5NF 3S37H 5IMMB 1UEMA 5I1KL 4X6CB 1T0MA 3KXFE 4AQOA 1QUNA 4F7PB 3UTTE 1I9IL 1Z5LA 3HZYB 1KIPA 3C08H 4UT6L 5IESL 3P30L 4F58L 5B4MC 4X6FB 3SBWA 4Y5YA 5BCAA 2EO9A 1L7TH 1T0PB 3P3YA 4WW2C 3MJGX 1LE9B 4YIQA 3WFBL 5B38G 4IIQC 1N7MH 4CDGC 5KG9B 2A6DA 2OR9L 4WJ5B 1BM3L 3QUYD 3LN4B 5EOQH 1OM3L 5ESVB 3FB6B 3DOSA 4XPTL 2R39A 4S0SD 4K8RH 3S35L 3O9WC 2OTUB 2Q8AH 4ESKA 3QDJB 3QAZB 5KZCB 5FK9B 1MRCL 3SQOL 3PUCA 5AWNL 4AT6A 1HHKB 3MV7B 4OCSL 3ZKXB 3ULVL 5MENB 4FQJL 4YAQA 4MMXC 3RAJL 5JOEA 1A6TA 1MCSA 2PO6B 5DC4B 5DVNA 4Y4HA 4APQC 1Z9OA 1L0XA 1UG9A 3MRHA 3MLZL 4CDHA 3GJEA 5HHNA 3T09A 4GLRH 1ZTXH 4PRHD 2WSKA 1YECL 4WW2F 5BRZD 4UZGA 1LO3L 3Q3GA 4OFKA 4FFVD 4PLNC 2NX5E 2APTA 4Z7QE 4XRCA 1CD1B 1P4BH 4S11A 3VFGH 4JO4L 4E41E 2F74B 4K9EL 4YC2C 2C1OA 1WC7B 1C5DB 3ZDZF 3ZYZA 1U8PA 1HNFA 3QUXB 1S7VA 3FRPG 3WNNA 5MEPA 3SKOA 5TGBB 4NN7B 1DSFH 5DYOA 3O6FD 2Z31C 5HYJB 2IF7A 3BOVA 4X6DF 4I0PB 3HAEA 3K8KA 4K55A 3FB6A 4XPHH 5DD1L 4R97B 5L0QB 3GMNA 4NRXA 4PRDA 3Q0HA 4HS6A 3V4VH 2H9GB 4PUBL 1KELL 1KJ2A 4WO4A 3V0VB 3LB6D 3EKCA 1R3KB 3LQAH 4ZPVB 5C0RH 2Z0BA 1CI5A 2PW1A 1Q72H 1ULVA 3VXRD 2MPAH 2VC2L 1IZJA 3FQRA 5F3HA 5K9QI 4B53A 3BD4A 4D0DA 5IM7A 2R0LH 3E8UL 5CSZB 1HHGB 5ESQB 3STBA 1OLLA 3VRLF 2XOTA 1F11B 3I75A 5ICXA 5D5MF 4GAFB 1IGCL 2X4QB 3UBXB 7FABH 5JHLH 4U49A 4TN9A 1Q0XH 3C2SA 4LIQL 5L2KB 2Z4QA 3OF6A 4WTXA 4FQQA 1LEKA 4HWEH 1PQZA 5GSRB 1ZV5A 1A9BB 1Y6NR 4RNRA 3ARTA 1NGWB 3LZFL 5L2KE 3PE9A 2VUYA 4LLQA 5FECB 1A9EA 4LCWE 5HHOB 5J1SC 1KYOK 2WINA 3G5XB 3U4EA 1CGSH 1FZJA 5J6GA 2GK2A 3P11H 1EPFA 1NJ9A 1MJUL 4LPVA 2HVKA 4HFWA 4ZPVA 1EH9A 1MJ8L 1KJ3H 4X5WB 5EC2B 2AJSH 3U7WL 1BQHG 1RAMA 3UYRH 3VXQA 3U9UA 5FGBC 4HKXB 2WBJD 2IFFH 1Y0LA 1MRDH 3IF1B 1CD0A 3S37L 3HC3L 1KCUL 3GK8L 1NGYB 1XEDA 3IFOB 1WZLA 1Q1JL 5DVMA 4XB7A 3VG0H 3GEWB 2FIRT 2BY2A 1F6AA 4NQED 5EIVA 3VGBA 3REWA 4GS7C 1JPGA 2HMIC 1MCKA 3NPSB 3ZDZE 5F7YC 1H15A 3TGXA 3VWJC 3KWWB 5MP6L 3BT2H 3HRZA 2P8LA 4P23D 2VXVL 3D85D 2DBLL 3WHXA 5DVKA 4N8VG 4Y4FD 4G8GB 3IDNA 1HHHB 2WWMC 2XIDA 2XY2A 3C9NB 1TZGL 3QNYB 5AWNH 3V6ZB 5DS8B 5F1NA 2BOCB 1UM6H 2GK0A 4YXLH 4HKXA 5J06A 2R8SL 5E56A 3P9WB 4LLWA 4HHAB 5EOCL 3ULUC 2C5DC 2DAVA 1R5IA 3ESUF 3HE7C 3SDAC 1XF2A 2W9DL 3PJSB 1J0KA 4L3AA 5DWUL 3TA3B 3C2AH 3HI5H 4OIBA 2R1YA 5HVGB 4M8VA 4BKLB 3TV3H 3SJVB 1IEAB 5IVXA 2HH0L 3NVQA 1P7HL 4GW4A 1DUYB 2DTSA 1S8DA 1KTLA 3BRDA 4HF5H 1A6UH 3A6CH 1U91B 3CFDB 3FO2B 1EIBA 5DMIH 4KKBC 4H26B 5D2LE 5BS0D 1MCBA 5GRZA 3U36A 4OM1L 2EYTA 1NGXA 3PWUB 1OT2A 2H2SC 2YN3A 5HI3C 5INCA 3T2NH 3TVMA 1OSPL 5HHQA 5L8JB 2HJLB 3I6LE 3UJTH 3BP6A 1JVKA 4NKIL 3DX6A 1J87A 3OAUH 2LVEA 1D6EA 4LSUH 2ZUWA 1ZWIB 3HE7D 1WAAF 4PJ7F 3BXNA 1GC1L 2QQKL 4M1CC 5FYJH 1HQRB 2UWEE 1DUYA 5DLML 5A2JH 1I3RB 5KSAD 1TJGL 4JFDE 2G75B 1EEQA 4U1GC 4D0BB 1J0HA 1YMHB 4WFGE 4MQ7A 4HBCH 4NKMB 1CTOA 3VWJB 2AQ2A 2X89D 5TF0A 5C0EA 2Z92B 3GNML 2HRLA 5TE7H 5MI0C 3QIUA 4NKQB 3C87A 3W0WA 5E1HB 2ZOLB 4OM0L 3D9AH 4KDTA 2YD6A 5J57B 3HHRB 3UO1H 1KCLA 1XZ0A 5C9KA 3TYGH 1FG2B 3AXLB 3O2DA 4LAQL 3W9EB 1U91A 5IBLD 4ZD3L 1G9NH 3DRQA 4JFDB 1WZ1L 3M45A 1FNSL 3OF6D 2UWEB 1XGYL 5KW9L 4QTIL 3JVGA 1WEJH 1KENL 4CADB 1M6OB 4XPBL 4DN3L 5D93B 4WEBL 2IJ0C 3H42H 4GUPB 5GGTL 4EUPG 4V1DD 4YNYA 4DGIH 1RUAL 1UQSA 5CP3A 4G6JL 4I5BA 4Z77B 5B3NA 4UQ2B 3VXSE 2W1NA 1AI1L 4H0IA 2EDTA 1VFMA 5T5FL 2VKWA 1X5AA 2QKIA 1I1AB 1QFWM 2ZUSA 4L4TB 1CICB 2MQ0A 4KKAC 5MEPB 3L3OB 4MXWL 2M1KA 1E4XH 5DUML 1WWCA 3G6JA 3MGOB 1KPUB 5IFHL 1BAFH 3BZFA 5D2LF 1Q9OA 3GMOB 4FG6D 3HPJA 4NZRH 1L7IL 3QWQB 1YDPB 5DHYA 2ILLA 2FIKB 1DQQA 3UAJC 1DUZB 4PG2A 4G42A 4YFLI 4ISVB 2ZG3A 5E9DD 4L4VA 4MDIB 5C09A 2AK4D 3SE9L 4ZSOE 2JJTC 5DK2A 2V5YA 3CFJA 4Z95H 5CBAA 1FIEA 5I73B 4GG8A 2FBJL 4G7YL 2XWJB 1S7RA 3QCVL 2FJFB 4YHZL 4I5BB 4PYHA 4PRBB 3B9KC 5F9OH 1QBML 1JNJA 4QY8A 1EEYB 1TJIL 3HC0A 2O5XL 2XWTA 4YO0B 5C09D 1UXWB 2R2EA 3GM0A 2XRAL 3BUYB 1B90A 4GT7A 3D3VE 4Q9RL 2OX5A 1DJSA 2BVOB 3JXAA 4RZCB 4D9RD 3QEUA 4MJ5B 3C5SB 4PRHE 4WI2A 1U6AL 4A2LA 4JFOA 3SE8L 5JA8B 5J3HC 1G7JB 1I3VA 4OCYH 4OZFA 1U8JA 1FNEB 2IANB 1KGCD 2PYED 4AEHL 4IOIA 5DQDH 1OF2A 3U9PH 3FL7A 3BPLC 4C56D 4XWGL 4N0YL 1OGAA 1VSCA 3GFUA 1LDPL 2G5BB 5ALCH 1XIWA 5IBUB 1YNLL 1H8OA 5IJVA 3MNWA 3QP3A 4LHJB 1T89C 4XP9H 5IVOA 4R0LA 5JW3H 5E8DH 4UBDC 2CKBL 4X8JB 1CXIA 1RUQH 2YMXL 3QNZA 4L8CB 4LVNB 4M1GH 1SY6H 1N6UA 1Y6KR 4POZD 4Z7UA 4I18B 2A1WH 2W0LA 4PTUA 3PWPB 2APBA 3M17A 3VXNB 5JPMA 2YPLE 4NHUB 4MXVF 5EA0H 2NY5C 1RK1B 2ARWA 1DVFA 1XF3A 2JB5H 1SJEA 4PRPA 3QH3A 3UTZB 3OGOE 1DQJA 1VERA 2FO4B 3MLTB 2J8HA 2OSLB 5GGTA 3QHZH 4QRPD 3C8HA 1LNUA 3MODL 4EDXA 1UWXK 4NDMB 1F90H 4OD3H 5JNYA 2BVOA 3EYSL 3FO1A 5DJYA 3G08B 4U3CA 1PKQE 1UB6B 5CZXD 3VH8B 3X14A 2JIXB 4PRPD 4JQIL 3L3HA 5D71H 5GHWL 3RNQA 3LIZH 1AXSB 4FXLA 2APXA 2WP3O 4TSAL 4XB8A 4CMHB 4HWZA 2OZ4H 3RX5A 2R1YB 3ZHDA 3RTQD 3LAFA 1ZVSA 5FM8A 5L88H 3SGEH 3GIZH 1VFAA 3BDBA 4Z7WF 5I8CB 5EUOB 5F7LB 3U4BL 5BV7B 4BQ8A 3QRGH 1RZJL 5IGXH 1FNGB 4Y5YC 1UB5B 3U46A 5CCKL 4NO5A 1IGYB 4JHAL 3GI9L 2HFEA 2D31B 4RAVB 4X80H 4PR5A 2Y07H 4GMSL 3SCMA 4HPOH 4HFUH 1J10A 3S7GA 3WUWG 5IW6B 2V5RA 4HUUA 5CGTA 2BX5A 2BOBA 3F12B 5LGJA 2MCPL 1N7ML 1YJDC 4M8QB 1RUMH 4RA3A 2AJZA 1X5JA 1IGFH 4X83A 4NHCL 4C55A 3TPUA 2VABA 3MLYH 4ALAL 1TQBB 2Q7YB 3CSPA 1FL3B 3MLTA 4QRPE 3FFCB 3GO1H 4TQEH 5DSCB 2GTWA 1NBVH 4YDJB 3VE0B 4NZTH 2IAND 4CAGA 5DZNA 1FH5L 3PWPE 1MCPH 2NY3D 5FAAA 4PJGA 3S97C 5MENE 4HXAH 4N9GB 1IGYA 1JWUB 2K9UA 3H3BC 4YHLH 2CRMA 4WFHD 2A74A 2CGRH 4FQHA 1DP0A 2AW2A 4PLKD 4DOHE 1KN2H 5IT2H 1MFBH 1IM3A 4WY7L 4OCWH 3ALWA 5TE4L 3DXAD 4XXDA 1T03L 4G6MH 4M7KH 5BRZB 1F42A 5D70H 3VXQB 4FFWC 3DGCR 3HI1B 5C3LD 4HX1A 1BJ1H 3Q6GH 5C0ND 1MCQA 1X7QA 5FB8B 5DEZA 5BVPL 3A6BL 4YBQD 4OJFH 4RBPK 5E2TL 3C6SB 2FR4B 2DQDH 5DMYA 3WYRA 2ZCKL 1JNLL 4S1SH 1Q94A 1H3PH 3VE0A 4Y5YB 4LCIH 4NJ9L 3P4NB 4LKCB 2W65A 1CF8L 3NPZB 1EHNA 1CXEA 1M7DB 2BHYA 3MV8A 3U30C 2PYFB 3RU8L 4FS0A 1DL7H 1EHLL 5DFTA 2D4FA 4XXCA 2JJVA 1Q72L 4GRWB 1JPTH 4FQIL 3B2UD 3WXVL 3LPFA 4Q7DA 1MVUA 1L6ZA 5FB8A 3MR9A 2P48B 4KJWD 1A6WH 2GSIB 2XN9B 3TA3A 1A6ZB 3M8OH 2PR4H 3RWCA 4YDVB 3V5KB 5D7KD 2BVQB 2ICWA 1P7KB 4K94H 4L3EA 3WS6A 5JO5A 1B2WL 2AEQL 1QP1A 5AAWA 2HT4D 3IFLL 1G7IB 3QDMA 3X12A 1F8TL 5EO1B 4JHWH 2VE6B 4JQIH 1QRNA 4TNWF 2FB4L 1ONQB 1HILA 3TBYA 1VEOA 1E0OB 2JK5B 4UT9H 3L3IB 3SE3A 4E5XA 4UOJA 2BSRB 3QWRA 2ATPB 4LASH 4U6TA 3NCYP 3CK0H 4XNUL 2AXGB 3IT8D 2VXQH 2C4FT 5EOCJ 5KVMC 4KQ4H 5B3JF 3ZYJA 3I3BA 3VFSB 3MRFA 4FQJH 4KK8C 4LPWA 1XGPA 2WWMD 2CMRH 4KUCF 5D1QC 2XN9E 3MRDA 2PYFA 1E27B 3R1GL 2R2CA 1Q1JH 2Q87A 4JVWA 2NXYC 3BH8A 1KXTB 1S9VB 4URTB 1S5HB 4I48B 3KYAA 4MQ7B 3RVUC 4DCQB 3QUYA 3B83A 1MVUB 1VENA 3U30B 5IMLB 3MRQB 4G6FB 2X1WL 4OLZH 2UYLB 3RGHA 3RZCB 1PVHA 3QI9A 5D2NC 1FC1A 2AJ3B 1I1FA 4FQXC 3PWPA 1IAKB 1KIPB 4MYWB 2EDXA 4JPVL 4KI5F 2HLAA 4D9QD 4ZOBA 2HRPL 2VLKA 5C0AE 3KPQB 4PJAF 2RJMA 4UQ2A 4KI5E 4Q97A 3EJYD 5EOCH 4R4BB 5FKAB 4M7JH 3T0AA 1W0VA 3SDDA 4H5SB 4NZUL 1KN2L 3KYNB 1YJDL 5CILL 2ATPA 5T33H 4Z7NF 3INUL 4NQEE 3MQIA 4ETYA 1BWWA 2FGWH 3V7AG 4KK6C 4DUXA 1BIIA 2ZUUA 2HT3C 1B0RA 1NPUA 5C08D 3UP1A 5DLMH 1MUJA 1ORSB 5IMLA 3ARDB 4XZUB 3FB7A 4TTDC 4XGZA 1GH7A 2VL5B 2C26A 4PJDA 3IDGA 3A6BH 2GITB 4OM1H 1MIEH 3GJEB 4H0HB 4OZIF 2GKIA 3E1F1 4KFZC 3GSNL 1NKRA 4RMQA 5HVHC 2NLJB 4M6AA 4B7IA 4NQUA 4M6NH 5I9QB 1AGEA 5FYKE 5KSVA 1MCNA 2FJFA 4OLUH 1KIRB 5HGGS 3DVGB 3HC4L 3OKOA 4PREB 4KJQC 5D1ZB 4P2OB 4XCCH 3BGMB 4KRPB 1BFTA 4PD4K 1S9WA 1HHHA 4OZHF 5F88A 2HMID 4KVNL 3D18B 2VAAB 5HYIA 3RVXD 2F74A 3DX8A 2VL5A 1BOGB 3LHPH 3AS3A 3VI3F 1I7RA 1J8HD 4YDIL 1QR1A 4YGAB 2HKFH 1CU4L 5KANI 3DUSB 1UJ3C 5EUOE 4CJ0A 1RK0B 4XMLH 3E2HB 1XH3A 2XN9D 1G9NL 1D5MB 3MBXH 3RGVA 4KJPD 3QULB 4LVHC 1NKOA 1I7UA 3EAKA 3WIFA 4CN4A 3D3VD 1KB9K 3KPTA 2VN7A 1TNNA 3U36B 3RVTD 1F4WL 3OJMB 2IAMA 2V7NB 2P5EA 1I1YA 5DHVA 3SQOH 1QRND 1H9VA 3KS0H 2R23A 5HI3D 5DF0A 1KLGA 2NTFA 2XA8L 4P4KA 3L3DB 4FZ8L 1RHHB 3QWOB 4K23L 1TFHA 4S0TD 5EO9B 4JGUA 4V2BA 3BH9B 2HYMA 4W81A 2V9QA 4K3EH 1N59A 2Y06H 2QSCH 3RHWK 1N8ZB 1OLZA 3R1GH 4MXWH 3BGMA 1KIQB 5C7XL 4P4KD 5CD3A 2WNGA 5D1QD 1H3WM 4Y0GA 4YHOH 2P24B 5J1TC 1C5CH 2C4XA 1Z6JT 1FHGA 3CDYA 5I8EA 2DTMH 3TH3T 4O5LL 3RUGA 4W4NA 3JUZA 4PJEF 3CMOH 5BQ7B 3HNVL 1NCAL 4JCMA 4KRPC 4QTHB 1QSZA 1MCCA 1LHZA 2OLDA 2EECA 4FXKA 5C0JB 5F44A 5LBSH 2HTLD 3RNQB 4AMKH 3IXTA 4ZUSB 1VFBA 3QXDB 4QF1B 4HKZB 2DLEA 3HMXH 4Y1AE 3PF2A 4F7CA 3RGVB 4XAKD 3CX2A 4MWFA 4GXUN 3GB7B 8FABB 2R0WL 1CVSC 1PDKA 5IMKA 4CW1A 2ZUQB 1M6OA 5C07B 4PRHB 4FP8L 4PJHF 5GISL 1P7KA 3O6FC 4K3DL 1IMHC 3RWIA 1FZMB 2BHZA 4G9FB 3FO0L 1NBZA 3MCKB 3MLXL 4NM4L 4YPJA 5DJDB 1AD0A 4JFQB 5DJZA 5C1MB 1NUFA 2GYSA 2X70B 4K3JH 2YC1B 2ADFH 3ZE1F 2ICES 4OGZA 3MRLA 2FATL 3EYUL 5L6YH 7FABL 4X99A 1B6UA 5KANG 4UT7L 5SWZB 1OPGL 1CR9L 1MCWW 3QO1A 4GKZA 1ACZA 1U8NA 3N06B 2VABB 1GGCH 4JFFE 4AIXA 5KJRH 4LPYA 1QLEL 3GSQB 4R3SB 5GS0L 4ODUB 1U8IA 4NFCA 3CNKA 4PJXE 1PLGL 2C1PA 4QXTA 3RL2B 1EBAA 1SBSH 2B8OT 1U95A 3TFKD 1PY9A 4NKOA 4LGRB 4M03A 4X6BB 3U0TB 4L4VB 1CGSL 2OI9C 4YC2B 4HIHA 4XCCL 2EYTB 1E4XI 4U2ZA 5GRXG 2IADB 2WAHA 5DEGB 3W0WE 2DLHA 1JFQL 4G6JH 4PFEA 3LD8C 3CVIL 1SQ2N 1I8KB 2EDQA 4JHBA 3NCFB 4JANB 2BCKA 4JREB 4CU8A 1EGJA 4TOYL 5D7JD 2FCBA 4R97C 1OL0A 4LCCA 1WC7A 5CUSL 3RWIB 1E4XL 5L0QC 4Z76A 5JR1H 4KK9C 5FEBA 1BAFL 5HDBF 1B0WA 1OTTC 2PXYB 4KDTC 2CDFA 3WE6A 4KRNA 4OSUL 5GRUL 3FQUA 4P46B 5EOTB 2XI9A 3ARFC 3GGWB 3T3MF 1RZ8B 5GGVY 5IP4A 4Z7VE 4XAWH 1UZ6F 3EGSB 2P46B 3D39B 3DV4B 4PV9B 2DLFH 4ZQKA 3ET9F 3AY4A 4I2XA 3WEXA 2K7PA 3PHQB 1FFOB 4L4VE 4OLVL 4R3SA 4L8DA 4O58L 1NAKH 1CWVA 5CSZA 3AB0B 4GMSH 2B1HH 4P2RE 3H9HB 4R90H 4JANA 2R1WB 3RPKA 1DR9A 4IS6A 1V3JA 2AI0L 5DDHB 4PJ9B 12E8H 1A7OL 3FMGL 2DYPD 3HZKB 3CLFL 3BKJH 3STLB 2OL3B 1XGQB 3DVNB 1OCWL 1OP5K 3KPSB 1PSKH 2AERT 5KG9A 4P3DA 3CVHL 1DBKH 2F54E 1JP5A 5BVPH 4TNVK 5LGHL 4LFHD 5F7DA 4GG6F 5BOZG 5HHOA 4X6EB 3HFML 4X7SL 5HD8C 1NJ9B 2DYPA 2FH8A 3WLWD 1WGOA 2A6DB 2VLRD 3OR6A 3X13B 2VE6A 1QRNB 2CKBH 4AMKL 2X9XA 1B6DA 2CGRL 4GRLA 5D2LB 2P5WB 4LCWD 1HH6A 1JGVH 4KHTL 1EHAA 1CICA 2ORBH 3BRFA 2BERA 5HTSA 4HWZB 4QYOB 4QRSB 4XP6L 1K2DB 1Q0YH 4QWWD 5D2NE 4WI4A 3MRCB 4M48H 2YXFA 4K7FA 4WUUB 3QPXH 3HZKA 4TNWK 1DDHA 4KK6D 3G5ZA 2XWJA 4HBCL 1WTLA 2PYEA 1A6TB 3D48R 3PHSA 4KKCD 3EJZD 4K3JL 4YAQB 3IAGC 1FLRH 2FWOA 2WUBL 1W0WA 3VFPA 1XCTA 3ROOA 4ZFZB 1TETL 4DCQA 4NWTL 1MWAH 3KPMB 2EYRA 2WWKT 1S7RB 4MXQD 1CFTA 4ZYKB 1AGCB 5DURD 4RGNC 4XXCC 3SHSA 6CGTA 4LAQH 1BJMA 4XP5L 1F6LL 2YS4A 4GG6A 3SDYL 5F1NB 3AB0C 2ADGB 1G9MH 3TPUB 5I71C 4MA3A 4MDJB 3MNVB 4N9OB 1EGJL 2AK4B 5D7LB 3VRIA 3KLAA 5JTWA 1G7JA 3KLHD 5ANMB 4NCC1 2BMKA 1I4FA 4UT9L 3MTRA 4HS6B 1JUFB 4FQ2H 3GBLA 2UVEA 2ED7A 3QUXA 4I3RL 2EKJA 1I3GH 4F57L 5FUCC 1T0NB 3BQUD 3NN8A 1DZBA 5I1CH 1C7TA 1TTFA 3R4DA 5KSBB 1ORSA 3PV7A 3RVTC 2IPTH 4L5FL 2BY0A 2NQCA 4YZFE 2Y07L 3LKSA 2A0LD 5M95B 5HGDB 2VLLB 4XPAL 3TO4C 5JXAH 4J4PA 2E8ZA 3JV6A 1JGLL 5AAMA 5JPNA 1NSNH 3KPRB 1UACH 4LCWB 1EVTC 5ITFB 1YEIL 4PJ8D 3WFEH 4ALAH 1A4JA 5C0GB 2H26A 1F11A 1PYWB 3I75B 1X5YA 1MVFA 2IC2A 1S7SA 4XBGB 5FO7B 2OSLA 5C0AA 4NO2A 2Z4QB 1B4JL 3MJ9A 1LNUB 2IPKB 4HUKB 4TUOB 5IB1A 4OTXL 3EYVB 4J1UB 2KQMA 2X4NB 3JWOH 1MFAL 2AV1B 4GJTB 5TF1H 2J88H 1A9BA 2Y5TB 4E41A 2FDBP 4Y89A 4KRPD 3ZE0F 1TJIH 2O5XH 4O58H 2NXZD 5CSGA 3SGDI 43CAB 1FYTE 2CD0A 4PJIF 2AS5M 4P99A 3NACH 3PL6D 4R90L 5D2NA 4UDUA 2QADB 1QQDA 1KPRA 4RSVA 1J12A 3QO0B 3QUZB 2WM0A 4OCYL 1EJOH 3O41B 3ZDYF 1JNNL 1I3UA 1J1XL 1R6VA 1YY9D 3NGBB 4POUB 3D25A 1FBIL 4U4BA 1F6AB 1G84A 4NPYB 2VDNL 3BISA 3L5HA 1M4KA 2DF3A 4YNYB 1T1YB 3PGDB 3FB5B 1BLNA 2V7HA 1NL0L 4OLEA 1IAIM 3RL1B 3QUKA 5HI5C 3T0EA 1RHHA 3QWOA 4R7DB 1ZT4B 5C0IB 5I19H 4E41B 1WWAX 5BZWA 3GRWA 3H3PL 3P4LA 3TO4B 2YUVA 1NMAL 3S5LB 4PPTA 5T33L 3GHEL 5B39G 3GSVB 2VQ1B 3BYYA 4OBSA 4GW4B 4KKCC 5GS0D 3U0WL 2KUTA 3ALPA 2EYSA 3V6ZA 3T0VA 3O3BA 3O3AB 4IDJH 4JG1H 3KJ6H 4JB9L 5IG7B 1MIEL 3B9AA 2EXWC 3QHZL 4I2XE 1DUZA 4N1HB 3MODH 5HYFA 4OD3L 3OTTA 3QIWC 3TVMD 3QUXC 1U92A 3GZKA 5EZOL 5AZ2L 4C56A 3PDGA 5E2WL 5L2KD 3IFLH 4NN7C 1A7PL 4L8SA 1E6JL 2Q1EA 4PY8J 3VGAB 5GHWH 3ILQD 1UYWL 3OKDA 5KN5A 1D5BB 3KPPA 3MLSL 1N64H 3QO0A 5TQ0L 4XNMA 3TZVC 5EDXA 3RUGF 4JPWH 4GXUM 3G6JE 4H26A 2IFGA 4U1IA 1OOAA 2DQFB 5IVZB 3OKNA 3GIZL 1A3RH 1QSVA 5FXCH 3DJ9A 4RFEA 5HDQL 4RZCA 1CQYA 3ARED 2CDEA 1D5IH 2SEBB 2W65B 2CMRL 1LP9B 5IQ9A 5DI8B 3RQ3A 2OS7A 3KXFB 2E6JA 3PWLB 1RJZB 4HPOL 3NCJH 2OR8A 3K81A 2JKXA 2VDOL 4PJBF 3JWNC 1DQML 4AIZB 4OZHB 3QDMD 3L5IA 2I9TA 1T4KA 1L4IA 2FEDC 3ILPB 3TO4D 1GGUA 1XGTA 2AEPL 2DQUH 5IFAL 4PJXA 4X8XA 1NAML 4HZLA 4M7ZC 2DTML 4JFFA 1NC2A 4JRWA 1OTUC 1XZ0B 5CGYD 3V5HB 2AABH 3ORJA 4X6DE 4FABH 2GFBA 3L95A 4UU9A 1GOHA 1OAUH 1R5VB 5F7HA 5SWZE 4LU5H 3QDMB 3UEZA 4ONHB 2X4OB 1Q9WA 4X6BA 1T1ZB 1RV6X 1FJ1B 4LDEB 5BO1L 2ICWB 1MJJB 4K7PH 5ACMA 5DMKB 3X11B 3GMQB 4F7PA 2NCMA 2VOTA 2X10A 5T1LA 3F7QA 4RFEB 4TSCH 2EE2A 4UB0L 3AREB 5GISH 2ZKHL 1LP9E 5I75C 4HIXL 5BV7C 2B0SL 1VGEL 4MA3B 1MF2L 1IGMH 3CMOL 4HUMB 4Y16B 1LP9F 4WJ5A 1BMGA 5J4MA 2EIBA 3OAYH 3VXMB 4P2RD 4PB9L 1CL7I 1FGNL 2QHRL 4X4ME 1NCCH 2V9RA 2VLJA 1NFIA 4JGJA 2ITDA 4QWWC 3FAWA 2KPNA 2GFBB 3L95B 3LDBC 5TDOA 4C57C 3VXPB 1INDL 5KTEL 3MGTA 2CPCA 4ISVA 1FPTL 4HZLB 3CZFB 4M6OH 4CVZB 4PV9A 4C83B 2IAMB 3QDJD 4GG8B 3BUYA 2R2BB 4MNGA 1A7RL 3JV6B 4UAOC 1IQDA 4PGZA 4XI5D 5MHSE 4M93C 3Q1SH 4XVTL 2YRPA 1EUTA 3MREB 5EBLA 1H3UA 1G6RH 1CFVH 2DQTH 3MNZB 3VGFA 4QRPB 4ZXBD 3MRHB 2LABA 3EYUH 5L6YL 1LEIA 4K71B 2B4CL 3LSOB 1P6FA 1HKLH 2OR7A 3FB8B 5DJ0B 3VXMA 1ES0A 2OJEB 3IFNL 5JHDA 5I1KH 3OPZL 2RCSH 1CU4H 5CEZD 2FX8H 3FT3A 5F9WC 1NBQA 1ZAGA 4FFVC 5AYQA 3CFEA 2J4WL 1C16A 1PLGH 5JW5A 3TT1L 2ZNWA 4PRIB 1CYGA 2FRGP 3MSPA 1G7QB 1F3JA 5CJXC 2BSSA 2X09A 4U33A 4KKLC 1JK8B 4J3OC 2X4UA 2JJSC 1XIWB 3HUJA 1IJ9A 1HSAB 3RIFF 3GM8A 1ZT1B 4OZIB 4QRRB 4G3YL 2ZUXA 3EFFB 3ARDD 4N1CA 5EBLB 5CBEA 3SOBH 1G9MC 1I7TA 4YDLC 2VDKH 1G9NC 4HWBH 3GSUA 4QRPA 5BXFB 5E4IA 2NXZB 3ZDYE 2ZZUT 5HYEA 2BDNL 2HFGL 4AQ1B 5GJSH 3P30H 4F58H 3BPCB 3HG1E 3R8BB 2PTTA 3L5JA 3O2WL 3VFNA 5JQ6L 1ZVYA 4M5ZH 4M7LT 4PRPB 3UTZA 4H25B 3CPLB 3HE6B 4RAUA 3BAEH 1YEJH 1JN6A 1LEKB 3D3VA 3LQMA 3T3PF 3RL1A 5F7NC 1YY8A 4LEOB 5IMOB 4KZDL 5F1IA 1QKZL 2Y36H 2P5ED 2XQYG 3DX8B 1V7NL 4EOWH 3U7YH 4LMQE 3V95A 5JMOC 3PWJA 2VAAA 2QQLL 5SX5H 4UV4H 4PJ5D 2YPLB 4Y5VC 3PABA 4X5LA 3HFMH 4X7SH 1CDIA 5C09E 5D6DA 3P9LB 1UB6A 1I7ZB 4WRLA 2IG2L 4PRIA 2R0WH 1DSFL 2HG5A 2EC9T 4APQD 4EUPH 5KSBA 4DVRH 5DEFA 2EE3A 4R4ND 5ADPL 3SDCB 4NZUH 2BSSB 1I1AC 5LXGL 3BO8B 3AMKA 4K7PL 4OIIL 2BXZA 1PKQA 2Y4SA 1CK0H 3FN3A 4D3CL 4BQCA 4PBWD 4RMSA 3EJZC 3FFDB 1P5VA 1OAXH 1RURL 3BP5B 1FCGA 2NY2B 3O6LH 4UV7L 5EU6B 4NZDA 5LG1A 2QADD 1J1PL 2VLRE 3D5OF 4UOW0 5E8EB 3VXSA 3WUWB 2XTJD 3QG7H 4PP2B 5C0AB 1XIWC 5ISZB 1LO2L 1CR9H 4PGDB 1DTUA 4PB0L 5KBNC 3U2SB 4HWBA 5JHLL 1A4JB 2BNUB 5DURB 3HMWL 2EEBA 2N56A 3CXHJ 5JDSB 4UTAL 5I16B 2LV4A 4NO2B 4Z7UE 1KB5H 4HGKC 3MRDB 1IGJB 1EGJH 1A21A 3N1QC 4Z9KB 4NO3B 3P0VH 3PJSA 3WHE0 3MLWH 2AXHA 5KSBF 3OHXA 3CC5B 3E3QE 1A7RH 2WIIB 2CKNA 1FNFA 1T21A 2AV7A 1I7ZA 3O6FA 43CAA 2H2SD 3QUZA 3UYRL 4M5YL 1JTTA 4O4YH 2WQ8A 4U2YA 2HKFL 5IESH 3C6SA 3IXTB 5D1XA 4DKEH 4PTTB 3W5MA 4Z7WB 3L6FB 1T2XA 4XNXH 4UILL 4ZTPL 1E28B 2IH1A 1QRNE 2VLKB 3KNBB 1CLOL 2J4WH 5FGBA 4J7RA 1MFDL 2VDPL 4ZG1A 2X1QA 4D8PA 2HKHH 1RPQA 3BP6B 4U7MA 4WI9A 4HKJB 4ZO8A 4WUUD 1XF4B 3BXNB 5DMKA 1HWHB 1KACB 2Q8AL 4NO3A 3WNPA 4GLRI 5JOPE 4V2CB 1T6WA 3KPSE 2X4PB 4MCZB 5F9AC 4LLYA 3MPCA 4HCRH 2DMCA 2QSTA 3ULVH 1T21B 5EUKA 2VISA 1RSFA 4GXVL 4ZO7A 4MNQE 2ZOLA 5E5MA 4DUVA 5I1IH 3MFFB 4FQLH 5TDNA 4PBXA 4M43L 1P1ZB 1JNHA 3RP1A 3MXVL 4L3CA 4MJ6B 1YMHA 1FE8H 1KB5A 3MRRB 3V79C 1JZ8A 4YPGB 1JWSB 3ESVF 3H9YA 4YDVA 4P9HH 2G2RB 1FZKB 4WHYH 1A7QL 4HIHB 3X3GL 4WUKL 3W39B 4JDZB 4MHHI 5IROA 3OKNB 1MFAH 5GGVH 1JJUA 2E5EA 2EC8A 2W9EL 5F7EL 1KXQE 3BI9X 5D7IA 3OAYK 4WTZG 1TJHH 3JWDL 1VB9A 3MNVA 5D7LA 3VRIB 4BJLA 2DQFA 1MCJA 5HI4C 2EKSA 3MJ7A 4BH8A 2H8PA 5E8OA 1YPZB 1R3JA 1NDGA 5GS0C 3FQWA 3P2TA 4HW6A