3AY6A

Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
b'HHMYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKYPSFQFGRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose 1-dehydrogenase 4
molecule tags Oxidoreductase
source organism Bacillus megaterium
publication title Structure-guided mutagenesis for the improvement of substrate specificity of Bacillus megaterium glucose 1-dehydrogenase IV
pubmed doi rcsb
total genus 98
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ay6A00
4C4OA 2FPIA 4O1MA 1T2CA 4IIVA 2EGHA 4LRSB 4KDEA 1GY8A 2UUPA 5CEFA 1NQOA 4MINA 2X58A 1HDRA 3A4VA 3D5TA 5BSHA 1N9GA 3ZCXA 3AY6A 1MG0A 3H9JA 3LC7O 4R1SA 4U0KA 4XGIA 5THQA 4CLOA 1JLLA 3WTBA 1PR3A 1JAYA 2C7VA 4KWIA 4GBJA 1ULUA 3ABIA 1HYHA 1UH5A 2HMUA 4RVGA 4H3VA 2VWQA 1V35A 4IQ0A 3ZHZA 4ALMA 3HN7A 3KYDA 3GEGA 3TFOA 4CR6A 2WD8A 1HWYA 1N8KA 3HNPA 5B4UA 1BTOA 1O95A 4XRRA 3ON5A 4XQ9A 3FNEA 1NYTA 1GUYA 3T4XA 1ADGA 1X15A 1DC5A 3LYLA 4WCDA 5DZSA 1TT5B 2YZ7A 2X0JA 3RCBA 5JCJD 4LGVA 1GEGA 2X0IA 1EK5A 2ZJ1A 4B3IA 1VJ0A 4XZ3A 2I67A 1V9LA 4WPGA 3GGPA 1KS9A 3F47A 3QWFA 1VRWA 4XRGA 5T5QA 2A35A 1EZ4A 3TZCA 3COSA 4D41A 4E2YA 4CM5A 2PWZA 3ZU2A 1Q0LA 1PJLA 3IC5A 2IEBA 3ADPA 4ND2A 2DU8A 5JYEA 3PTZA 5EN4A 3C1TA 2PZLA 4CM8B 3WICA 2B5VA 3RC1A 2I99A 4L9RA 3TPCA 4YJDA 3PWZA 2VHWA 3BTSA 3PJEA 4KUEA 3SLKA 1WDLA 3I5MA 2WE8A 5COBA 4CM6A 1EUDA 5LDHA 3O38A 4OGWA 4B8ZA 4R1UA 1H6DA 5G0VA 1N9GB 4CMJA 4E13A 1T2AA 4RPKA 3E5MA 1EBFA 4LCEA 1W4ZA 3NAQA 2QZZA 3LQFA 1E6EA 1VJ1A 2P9GA 2GN4A 4RCVA 3ZWXA 4D42A 4YAGA 1FJHA 3IKTA 5CAEA 4OJNA 4I5FA 1ZIDA 1EMDA 1TB4A 4FC7A 1X0XA 1KEPA 5K9ZA 3OQ1A 3RAJA 4YDRA 4DLBA 4WCFC 3JQ9A 2VCYA 1CYDA 4WKGA 2ZQZA 1ZJZA 4YAEA 1K6JA 3ZV3A 4R4JA 2V7PA 1ID1A 4GLLA 5ITVA 3QWHA 3NX4A 2PR2A 1VL0A 1YOVB 1XR3A 4II3A 3O8QB 3PPIA 3RBZA 4J1QA 2DFVA 2Y68A 1IL0A 1Y8QA 5B4VA 1GCUA 3WGIA 4P4GA 1IE3A 2WM3A 4DIOA 4IIUA 1DLIA 2H6EA 4AJ1A 3TZQA 4BVAA 1E5QA 4R9SA 3KB6A 1EEHA 4CM1A 3ZNPA 1UZNA 5L51A 1LLUA 1LRJA 2HDHA 4IMPA 5T8KC 1GYRA 3S2GA 1ZNQO 4OAQA 1QV6A 4FR5A 3IJPA 5EPOA 2X8LA 5BT9A 2PH5A 4J2HA 3FI9A 5A05A 4D43A 4AJKA 1HDXA 2Y93A 3WOHA 2QW8A 3I1JA 3KEOA 4IY1A 5K6AC 4NU6A 3FPCA 1HDOA 5JC1A 2WYWA 4ZQHA 1J5PA 1I5RA 2ZQYA 1ORRA 1UZLA 2W2LD 3I9OA 4XR4A 2YV1A 5BNTA 1UP7A 3H9EO 4BNHA 2NVWA 3WGTA 1VL8A 2WD7B 2D2IA 2DQ4A 1PWXA 1PJ4A 1T24A 3RUDA 1U3UA 3GNTA 5GZ6A 1E1KA 1N1EA 4R69A 1R37A 4MVJM 4YA6A 2CMDA 4OKIA 3FTNA 3UVEA 2B4QA 5TC4A 5IZCC 1PZFA 2EEZA 4K9DA 1V6AA 5JAMA 4QT0A 3W4IA 3H5RA 3WR5A 5KVCA 2E48A 4WNCA 1X13A 3MJTA 3PWSA 3H6KA 3L4SO 4CV0A 4RQTA 1U3VA 3WG9A 2B4TO 3D3WB 1QYXA 1PU2A 4FW8A 1PJSA 5G0UA 2P4HX 1BVUA 3KLPX 4IS3A 1B26A 2AMFA 5A9RA 4BNFA 4PCVA 3JQBC 3GZNB 1RM4A 3ADOA 1DC6A 5JDIA 3LVFO 2XOXA 2PFGA 4CR8A 3CE6A 4NR0A 4YT5A 5A4DA 3I52A 1IPEA 1EVZA 2PLAA 3AI3A 3HG7A 3L4BC 1LC3A 1YL5A 1SOVA 2O4UX 1O9BA 4B4UA 3W6ZA 3W1VA 4RPGA 1GU7A 1JU9A 2E82A 1LJ8A 1RM3A 5G0SA 1R0KA 3ZWBA 6ADHA 3FTPA 1P0FA 3QIVA 4L4SA 2R00A 3SVTA 2P2SA 5T67A 1SB8A 4YT2A 5ER6A 1MUUA 2PY6A 4YRAA 4OSOA 3C8MA 2G1UA 1VKNA 2Y1EA 3VPGA 4AL4A 4AJJA 4BKRA 4BMNA 1MA0A 2VT2A 4XQEA 4CLXA 1P3DA 1CJCA 4UUMA 5EQFA 4JNKA 4IXTA 5CG1A 1DIGA 3ZV4A 2X6TA 2DAPA 4QX6A 1N1GA 2IODA 2Y99A 4RV9A 2Q2WA 3N58A 2BFOA 4FQ8A 3GEMA 3MOGA 4IBOA 4G2NA 3INRA 2B36A 3HDQA 4HFJA 4OM8A 1BG6A 1EUZA 3S2EA 4CM3A 3GN1A 4MP6A 2FHSA 2Y1OA 2YDYA 3TRIA 2XPCA 4E5YA 3BMNB 2GZ2A 2A9FA 1NFFA 1H5QA 1DAOA 1PGQA 1LLCA 1Z7BA 4YAIA 1NHGA 4PFJA 1EK6A 5L40A 5L7TA 5ENVA 5H82A 2OBNA 2D5AA 3S2FA 1BVRA 1U4SA 1XQ1A 4YJFB 4A10A 3OETA 4ZN6A 1LSUA 4I9HA 3AU8A 1DIRA 1RPNA 1LDGA 2CVZA 4ND5A 4TZKA 1TI7A 2EHDA 2P5YA 3IJRA 3PLRA 1I10A 1LNQA 5EERA 3IUSA 3DMTA 4JBIA 3HDJA 4RPJA 3TZKA 1H0KA 4GI2A 5A03A 1R12A 5B1YA 2D3TA 3HE3A 3KYCB 3ETDA 4AJ2A 4B8WA 4J4HA 1Q1NA 4B3JA 3UXYA 3Q11A 1G0OA 1UAGA 2I65A 1NQAO 3KEQA 4XYLA 5BSFA 3PDJA 3GA0A 5F1OA 2VYND 5C7IO 1H2BA 4M89A 3TZHA 1QORA 2QRKA 2NLOA 4CMAA 4P4NA 3JQAA 3WDSA 3KVOA 5BNIA 1ML3A 3U4CA 1E3JA 4ONEA 1YQDA 3AM5A 3PVZA 3ZHXA 4OIMA 4DQVA 3ULKA 4CM7A 5JSFA 1HE2A 2DM6A 3D4NA 3VPSA 4CQMA 2DTDA 3HQ4O 3VC7A 5G4KA 1HRDA 1NM5A 4H16A 4KUGA 1M67A 3KUXA 3WGOA 4YPOA 3KETA 2ZTLA 4LISA 1R16A 3D4PA 2X23A 2G0TA 3OH8A 2FN7A 2JAPA 4TSKA 1EDOA 1DIAA 3OEWA 4CLOB 3EVTA 3H7AA 1R4NB 5JAZA 4XA8A 2O2YA 3NGLA 4Q3AA 4CUJA 4DC1A 4HUJA 4ZVVA 4BO2A 3DAGA 1CEQA 2V6MA 3B70A 1YB4A 1WPQA 2CVQA 3BA1A 1LI4A 2EP7A 1X0VA 2JHGA 4D3SA 3D7LA 1OFGA 1YH3A 3BTVA 5JY6A 1GZ4A 1PJTA 3BMOB 3NJ8A 3JQ6A 3OF2A 3PIIA 1B3BA 5THKA 2J3JA 4CL3A 4HFMA 3OM9A 5A5EA 2X7HA 4RLSA 2EJVA 3RFXA 4F3YA 1F8GA 3GRPA 3F9IA 3CUKA 4RVHA 2YJZA 3NKLA 2G17A 1RM0A 3WIDA 1CERA 5F5NA 4A03A 3VZSA 2CFCA 3U0BA 1Q0HA 1P9LA 1EVIA 4LRTB 2ZYAA 3D3EA 2EP5A 3JQAD 5HWSA 1EFLA 2HJSA 4Y6SA 5DNAA 1LLDA 4CJXA 4XX0A 4FFPA 3JQDA 3EW7A 3ZH2A 3PDUA 1IPFA 5G2OA 5ITWA 3PQDA 1T26A 3RQSA 4Z9FA 3ZNOA 4UVGA 3KBOA 1BXKA 5KCZA 3R3JA 2NM0A 2B37A 4XB1A 1H9AA 1KVSA 3CMCO 4J1TA 1SC6A 1UXIA 3JYQA 2HU2A 4Y9DA 4YRDA 4O6VA 3DDNA 1JW9B 5CEEA 5CG2A 3BYZA 4AJEA 1I33A 3AK4A 3GDGA 3AJRA 1Y8QB 4BO5A 4R54A 1GDHA 1PS8A 3WYEA 4MVJA 2ZTVA 4RZHA 5CEJA 4YJGB 5FF9A 5DBFA 4CUKA 5KNLA 3PWKA 4Y98A 5TJ9A 2AEFA 5LC1A 4UEJA 1H94A 3HHPA 3ZWYA 5L45A 1DC3A 5IFLA 4JIGA 1PJ2A 1B8PA 2PK3A 3DXFA 2DPGA 4WLOA 4E6PA 4OQZA 4ALJA 3NUGA 3NTOA 3M2TA 2IXBA 4A5OA 3PYLA 3GMDA 1EVYA 3EYWA 2IZZA 4MP3A 2CDCA 1XDWA 3UUWA 2RHCA 3VZPA 1MFPA 3PYMA 4QEDA 3VH2A 4RGBA 3P2OA 3NDRA 4JBGA 4X54A 4U6QA 1E7YA 1GL3A 1YJ8A 1SOWA 3HSKA 1ZMTA 4B4VA 4PLFA 5GY7A 4Y6RA 4HP8A 3OJEA 2GGSA 4N7RA 2HUNA 4OOFA 1OAAA 3AFMA 3PGXA 3PHIA 3LLVA 2C82A 1E3SA 2CVOA 4PG4A 4NFYA 2RHRA 2EF1A 3CMMA 1J49A 2FRDA 2J5RA 4L75A 1BW9B 3HZZA 2CY0A 1YJQA 2NTNA 1PS0A 1CIVA 3JV7A 3E9QA 4JCOA 4F45A 1QKIA 4MVJD 3BMOA 3LF2A 4MVJI 1JDJA 1HXHA 4LSMA 3WSWA 5B12A 3EVNA 3WNQA 1P31A 3MCVA 3D4OA 3HWRA 4J2OA 3AM3A 4K1LA 1BXGB 3CZMA 3R6DA 1I30A 1WLYA 2WWRA 2ZKLA 3BHMA 5CP8A 2CDBA 5CFZA 3ASVA 4KP7A 1R4NA 2IXAA 4PG6A 1DLJA 3DBVO 1Y5MA 4A0SA 3DBRB 3OJOA 1KEUA 3RJ9A 3ETGA 1ISHA 3AFNA 5C7OO 3K31A 5FFFA 1SEPA 3WB9A 2Q50A 1RM5A 3NTQA 2XAAA 2NV6A 1GQ2A 1R4MA 4GVLA 3DO5A 4D0SA 1DIBA 1H2HA 3KOUA 3EK2A 3S55A 3TSCA 1G1AA 3PZRA 4BMVA 1YB1A 3KYDB 4XYMA 2VRCD 4YJHB 5IG2A 1O5IA 3U4HA 2O4CA 4PRKA 1HTBA 1EE9A 1NFRA 3K6JA 3EZLA 4EJ0A 1D1SA 1PWZA 1I36A 3EAGA 1DJNA 4WUVA 1KY5A 2G76A 3DR3A 4FJ0A 1YS4A 1XWFA 1L7DA 2OMEA 2A4KA 1H6BA 3GNSA 1ISIA 5TX7A 1GQYA 4WE3A 1VSVA 3UCXA 5AOVA 2W2LA 3JQ8A 3K9QO 3PFFA 1N92A 4DPKA 3E6AA 3KYCA 3I6IA 1IULA 4YYZA 5IAAA 1U3TA 1PX0A 3H9GA 2OO5A 3LT2A 4WLVA 3C7DB 4P38A 1DB3A 1A71A 1BW9A 1PGNA 5BQFA 1ZFNA 1M66A 1A4UA 2C07A 4JP2A 5F1KA 4DMLA 3BMQB 3D0OA 3GVPA 2DT5A 2YW9A 1ZK3A 1B0AA 3L77A 1I2BA 1YL6A 1Z7EA 4CM4A 4CQLB 4NQZA 3BMNA 4FOOA 4LMPA 4K26A 3MJEA 2RCYA 3AU9A 1P45A 3QVTA 4IZIA 4KTTE 2ZK7A 1QXSA 4WGGA 3SC6A 2ZTUA 4GX0A 1XU7A 3K30A 2BGKA 2VZ9A 3NGXA 4J9UE 1C1XA 4OQYA 1JWBB 1UP6A 1NPYA 3GMSA 4QO7A 4BQRA 3G1UA 2Q4EA 2D4AA 1KIFA 1E1MA 1KEWA 2IYOA 3CPSA 3OEYA 5DN9A 2J8ZA 4U6SA 4H15A 1UXGA 4MVJE 2BELA 2YHIA 2HMVA 3C1OA 3DOCA 2Y0EA 1BWSA 3V8BA 4OXKA 3HDHA 4CM9A 1Y9EA 5L95A 5BR7A 5EINA 3Q6IA 3NT5A 4BNXA 3OBBA 4D3FA 3NV9A 1UDCA 4Z3DA 2GYYA 3N74A 3HADA 5FWNA 2ZYGA 1Q2XA 4ZGWA 1QYWA 4P4LA 1UXKA 5TNXA 1BDBA 4WCFA 3AY7A 3H3JA 4Z0HO 2FR8A 4Q3NA 4BOYA 1E6WA 4JP3A 3ZWNA 3F5QA 3WNVA 1T2FA 2LDBA 3CINA 4BGVA 5BSGA 2A92A 4M86A 2PKQP 2NSDA 1I2CA 3JQ7A 5L4NA 2BLLA 4NBVA 1I24A 2B35A 1B8UA 1DXYA 2C0CA 2VOEA 3MWEB 4K6FA 4Z0PA 1E3EA 1NWCA 2GPTA 2OFPA 3DOOA 1ZJYA 3UF0A 5K0ZA 3WFIA 1LTHR 2ZCUA 4A73A 5IDQA 1D8AA 3VAZA 2ILTA 4PN3A 5I9NA 3UH1A 1WWKA 5AXDA 4DQUA 3NEPX 3GEDA 3LT4A 1F0YA 1U8FO 2I76A 1T4DA 2FR0A 3I9KA 3ROQA 1VL6A 3AUSA 1O6ZA 4INAA 4HNHA 3SBOA 2QG4A 2OORA 2PV7A 2ZB8A 5TQVA 3ENKA 3TL2A 2O3UA 3PXXA 5TT0A 1RYDA 1JVBA 4A7PA 2UVDA 1V8BA 2YV2A 3VDQA 1N7HA 4E2ZA 3OA2A 3GK3A 3IP3A 2EKPA 4IDAA 4PLGA 3MZ0A 4B7CA 5DF1A 5I7SA 4PVCA 1WDMA 2VUUA 3P2YA 4XJSA 1LDYA 2JL1A 5DP2A 2NQTA 3B6ZA 1LSSA 4OYRA 1R66A 4E30A 4BNTA 5HA5A 1ONNA 4J4BA 5I7FA 4F6LA 3RUAA 1FDUA 3DBHB 3G79A 4YCAA 4J0EA 3K5PA 3U4IA 1S6YA 4FSHA 5KIAA 3PJGA 5MGBA 3QWIA 4YTEA 4R16A 3KYBA 3U9LA 3PI7A 3JYPA 2RIRA 4R1TA 4NU5A 1GV1A 1LDMA 3GGGA 3WWZA 4LVUA 1P33A 2VRBA 4OKNA 4R3WA 3C85A 4XGKA 3DZBA 5DCYA 3I4FA 1QYDA 3KLMX 3MJSA 3ZHYA 1P1FA 1LLQA 3RC9A 4PG5A 2I66A 4N5NA 5EL0A 5G4KB 2DKNA 3TOZA 5JFOA 5I8ZA 3GN2A 5DP1A 5A3JA 4IZHA 5JNLA 4RPHA 4ALNA 3VTFA 1DOHA 4QXMA 1N5DA 2AXQA 1TXGA 4CMIB 4R3NA 1LC0A 4NDNE 3VVBA 4K28A 3LU1A 4DRYA 4EJMA 4GSLA 3U49A 2GZ3A 3UW3A 4TRJA 2CD9A 4HNGA 2PZKA 3NRCA 3NYWA 5G0WA 3Q2KA 3BZUA 4BL5A 2BKAA 1Z75A 5HBRA 5L7WA 4M49A 2O3RA 3GVIA 1FK8A 2O2SA 2PNFA 1PGJA 1PGPA 5FI5A 5TLSA 3QRWA 1JWAB 1E6UA 4ITUA 3P19A 4ZRNA 1O94A 5G0TA 1E7WA 3R3SA 4DXHA 3RBXA 2VNSA 1OI7A 2TMGA 4ND4A 1QRRA 4TVOA 4JJIA 4GX5A 2BHLA 3A1NA 3HJAA 4HBGA 1KY4A 1LDEA 1DFGA 3ICPA 1Y8RB 2PZMA 4MIOA 1S7CA 3PLNA 2ET6A 4IUYA 3QSGA 5C37A 4CMEC 9LDTA 2PTGA 4NBWA 5BSEA 4TMFA 4RORA 3WMXA 3LC1O 4CV1A 4N5MA 5I7VA 3RUEA 4BKQA 3JD2A 1NVTA 4XD2A 5ES3A 1I0ZA 3W4KA 1JKFA 3ZU5A 3E8XA 4MDHA 2YFHA 2F00A 3U5TA 2HRBA 3SJUA 1VKOA 2AEMA 3DAPA 3FHLA 1KOLA 1GZ3A 2GERA 3EY4A 5IXYA 1PL7A 4QFDA 1SZJG 4ALIA 1D4FA 5JDCA 3K92A 4AJLA 4DA9A 3FNGA 3WBBA 4KWHA 1T2EA 3JCZA 5GZ3A 4ZQGA 3TWOA 1YRLA 4GGOA 1E7SA 1I2ZA 1O0SA 2Y05A 3GVHA 4GAEA 4JROA 3A9WA 4RZIA 4EZBA 4EUFA 4CV2A 1BRMA 4W7IA 4KQXA 5C3MA 1NP3A 3Q1LA 4EITA 4BNMA 5IJZA 1E3LA 1XKQA 2IE0A 3WBFA 4FJ1A 4I5EA 1DDOA 3CIFA 1YBAA 5JO0A 2J3KA 1A9YA 4W9NC 1ONPA 3AI2A 2JFHA 4BMSA 1Z45A 4E5MA 1XU9A 3FR8A 4CLRA 5L4SA 3CZRA 1SBYA 2BGMA 1UXHA 4BO1A 1QV7A 2UV8A 3D5QA 3L07A 3TFQA 4IJVA 3DHEA 1PR9A 3SX2A 3GZNA 4D44A 2GR9A 4CLEA 1Q7CA 4MVJF 1CRWG 2DLDA 5JDCC 1LQTA 3I9JA 3RASA 1N2SA 1V3UA 4U0JA 4E3ZA 2H1SA 2PGLA 1K2WA 2YUTA 2NUAA 4BNZA 1P1HA 4HFNA 2QX7A 4WNIA 1XQ6A 3QJ5A 1CQIA 3TOXA 4J1NA 1GD1O 1BDMA 2NADA 1R0LA 1BXZA 1HETA 4XGNA 3NDIA 1ZK4A 2AW5A 4NFHA 4EI2A 9LDBA 3FPLA 3IDSA 1Z73A 2G82A 4DC0A 1HZJA 5KWEA 5L53A 2GRAA 4IJKA 4G65A 4YAKA 3DZJA 3RD5A 1GZ6A 3ZW9A 1OOEA 4E2XA 1TLTA 3O03A 2OL4A 2C20A 1K89A 4BGUA 1FXSA 4Q3BA 4ID9A 3AOEC 1FDVA 1ADCA 1E92A 3WQQA 4M87A 1WZIA 2AE2A 2JHFA 2H5LA 8LDHA 4ESOA 4Z9XA 3F46A 2ZB4A 4TZTA 4M54A 1GCOA 1LRLA 3EHEA 2X1HA 4J4TA 1AGNA 1P1JA 1UUFA 3QVOA 3MTJA 3OJFA 1I8TA 4JLWA 4KQWA 3GDFA 3WJ7A 1NNUA 3JQFA 3GRKA 3ZNNA 3GQVA 2C54A 3JD1A 4PVDA 3ICCA 2J3HA 1XCBA 3DZGA 4CMEA 2VWPA 4FFNA 3T4EA 4A27A 3KM0A 4EYEA 2OP0A 5AXCA 1U5CA 3DQPA 1K3TA 3LT1A 1NAIA 3SXPA 4AG3A 4RDIA 2GNAA 2P4QA 1XG5A 3IUPA 4OOEA 2O50A 4FGSA 4NJMB 2V6BA 5K6AA 1ZVMA 5BNFA 4PLZA 1E0DA 4C7JA 4BNYA 4EDFA 2BI8A 1HDGO 1ZXLA 3ONEA 1OMOA 3BMCA 3Q9NA 4J9VA 3FWZA 4J7UA 5H81A 1DIHA 1HDYA 1ZMOA 1MLDA 2HAEA 4WJZA 5JS6A 3CH6A 3DZIA 4RF3A 5FYDA 4B4WA 5EJ2A 4GWKA 5DT9A 4TROA 1TT7A 5B4TA 2D5CA 3JQ7B 3HB4X 3CTMA 3F3SA 4D79A 2SCUA 3E48A 3DC2A 4Y67A 3UAGA 4G81A 4CPDA 4J7XA 2AHRA 2O23A 1XHLA 5TSDA 1GPDG 1H6CA 1KETA 2D8AA 3GC6A 1E3IA 4PLTA 4BB6A 5IXSA 1MXFA 1D3AA 5KJCA 1C14A 2CSUA 3VHRA 1KC1A 2VWGA 3PJDA 4I08A 2HSDA 4I5GA 4IMRA 2W98A 2Z1MA 4CMGA 2TMDA 3L6OO 5AXAA 4ZA2A 2HCTA 1DPGA 2D59A 4GL4A 4WK6A 4MKRA 1AXGA 2WEKA 3F6YA 3LSYA 1U2GA 4HWKA 3Q2IA 1WMAA 4Q3EA 4ZICA 5TGDA 3ONFA 1C1XB 1OC4A 3WYBA 1IHYA 3GUYA 2GCGA 3MJ4A 1WP4A 1GV0A 5DBIA 1W6UA 1HL3A 4CLHA 2I9PA 3ONDA 4QQRA 4TVBA 1C0IA 2UAGA 3EDMA 3ZWPA 2HQ1A 3PJFA 1GAEO 4CQLA 2NU8A 5JYDA 2QQ5A 5C7LO 4FDAA 2Q99A 2J6IA 4NPCA 5CDGA 1VJTA 4AJ4A 1I32A 3I23A 4W82A 4WLFA 3ZNQA 4B7XA 1JQBA 1HZZA 4JQCA 4LMRA 1I3KA 1LA2A 1SO8A 4E0BA 2FPPA 2WE7A 1NPDA 1FDWA 3A28A 3WTCA 4J1SA 3RU7A 1NPTO 4S1VA 2W2KB 1E77A 3KV3O 2E4AA 2WYVA 3VH4A 3DZKA 4RF5A 4R01A 4NG5A 4OL9A 4NIMA 3WMWA 1NWHA 3WS7A 4BNGA 4D7AA 1Q0QA 3KZVA 3OFSA 4E4YA 2VT3A 1JKJA 3M1LA 5U9CA 5C5IA 1UR5A 2WSBA 4DQXA 2JD0A 4XWYA 5L9AA 4Z6KA 4CMCA 2POQX 3PP8A 2BFPA 3RU9A 2I5PO 5T64A 4BIIA 1ENZA 2NVUA 1AUPA 4XB2A 2VUSA 4HV4A 3CKYA 5KVSA 3RUHA 2PKRA 2Y1CA 5JBIA 3WGYA 2I6TA 4GPD1 4JBHA 2BRUA 1AHIA 1C0LA 2QZ9A 4MKZA 4ZU3A 4YR9A 4JJGA 3C7AA 2IRWA 2H9IA 4NBTA 2JD2A 4EW6A 1ZW1A 2AQIA 2OZPA 2ZATA 3L6DA 3E82A 4ZQBA 4BS9A 4JXKA 3GAFA 3DHYA 4HXYA 4E2WA 1E3WA 1OZAA 4QTZA 1HDCA 4BB5A 1QYCA 3K8ZA 4IPTA 4C7KA 2VTDA 5I7EA 1T1SA 4E12A 1UJMA 1ISMA 1MC4A 3K73O 3JD3A 4DVJA 5ADHA 4AJNA 2FZWA 4NJOA 3ZWWA 2VZ0A 3OQBA 3DAFA 1VI2A 2PD3A 4EUEA 1NR1A 1M76A 3KSDO 4XJTA 2V6GA 5ER9A 4BKUA 4HY3A 2GF2A 2CF6A 2VHXA 3U09A 3F4BA 4IDDA 3QLJA 3CEAA 3H5NA 1T2DA 1U8XX 4E5NA 2C7GA 2XF8A 1NR7A 3ANMA 2DPHA 1A5ZA 3I6QA 5DOVA 2P9CA 3DTTA 2B0JA 5TT1A 4DL9A 4YAJA 4FIZA 4EEXA 3M1AA 1K0UA 3DFZA 3RKUA 4L76A 1W73A 1A7AA 3WJAA 4EGFA 1SAYA 2X5KO 3BHIA 4WCFB 3HB5X 1NQ5A 3PK0A 4ZD6A 3TF5A 3VZRA 3DOJA 2VNAA 2QYTA 4YJGA 1IZ9A 3GR6A 5JLAA 2GD1O 2VUTA 4K6CA 2I3AA 4AJOA 1DFHA 1SNYA 1KC3A 1RWBA 2HRZA 2PD6A 1XLTA 2NNLD 1LUAA 1OBFO 2BI7A 2V6FA 4FN4A 1KERA 5L7YA 4CMKA 2P5UA 1HYGA 2FWMX 3C7CB 4OSPA 1M2WA 4UVHA 2CZCA 3RWBA 4J49A 3ZWAA 1DFIA 1XIVA 1ZZEA 1YBVA 1F06A 4YWJA 3H8VA 4Q3CA 5G4LA 2EERA 5A9SB 4HKTA 4RVFA 3EMKA 4ZQEA 3MWDB 2R00C 3PIDA 2V65A 1DO8A 2GN9A 4XIYA 1PS9A 2NACA 3I9MA 3L6EA 1X14A 2DBQA 2P68A 4RLHA 2EWMA 3QY9A 1HDZA 1ENPA 1KVTA 1AE1A 1YDWA 2FR1A 2Q1TA 1ZXBA 1R0SA 2Z5LA 4YVFA 5TIIA 1ARZA 4YACA 1ADFA 2IYPA 3PFWO 4GX2A 2XXJA 4UVIA 1P0CA 1K6IA 1CDOA 2Y66A 2AE1A 3ANNA 4LN1A 4AJPA 1ISFA 2R6JA 3V1TC 5HTOA 4GH5A 3JQ8B 3OMLA 4MP8A 4LCJA 3RUCA 4J7CA 1B3RA 3BTOA 2E37A 3RIHA 4I9UA 2VZ8A 3O9ZA 3OHSX 5IDWA 3PRJA 1U1IA 4PLYA 4KTVE 2DBVO 2GN8A 1F17A 1QMGA 4IDFA 4E32A 5EQDA 3QW2A 1DHRA 4AJIA 5IDYA 1AHHA 4WEOA 3GH3A 5DDIP 1D7OA 1PL8A 2BGLA 3V2GA 3ZDFA 3GNQA 4W4TA 4OHUA 3U4DA 3F4LA 1VPDA 5JMWA 3TJRA 1HYEA 2X5OA 4CODB 3P7MA 3NJ4A 4YJHA 5EESA 1YQXA 5T8KA 2YQ5A 1M6HA 1ZSNA 3M2PA 3IMFA 1Y6JA 2NVBA 3K2BA 4QFCA 3GHHA 1R4MB 5CPFA 4YQYA 5JCXA 1ISJA 1RYEA 2IZ1A 1GUFA 1KBZA 4J43A 3GVXA 5KVQA 3JYLA 1YWGO 3DFUA 1IOLA 7MDHA 2HK8A 3JQAB 2E49A 1SCUA 2AG5A 4OO3A 4A2CA 2AG8A 4RPLA 3PHHA 3JD0A 2EKLA 2D1YA 4R5MA 1C0KA 2O7SA 2Q2QA 1JVSA 4FJ2A 1LDNA 2Q1SA 1U7HA 4QUKA 2G5CA 4E5KA 3WWYA 4MVJP 3ZW8A 1EQUA 3A14A 3CSDA 5KJEA 2C29D 5DBGA 4PLPA 2EGGA 2FOIA 1U7TA 4FC6A 4YQZA 3ROKA 2D0IA 1NTOA 2X4GA 2B83A 2XXBA 1IHXA 3ZHBA 3UKOA 3V5NA 2Q45A 3Q0EA 4BO0A 2BD0A 4JGBA 1MGOA 3E9NA 4S3MA 3GOHA 4W6ZA 4UVEA 4FOSA 1TVEA 1LU9A 3IS3A 4U5QA 3F1KA 2X86A 4XDYA 2I3GA 3E18A 4W7HA 3A06A 3OSUA 5I9LA 2OXIA 4CL8A 5KOIA 4L74A 4MIYA 1XGKA 4CR7A 4YRBA 3JQGA 4I1IA 1KVUA 2NU9A 2Q3EA 2RBEA 4NNJA 3OP4A 4PG7A 1NVGA 2DFDA 1A7KA 3R1IA 2HKIA 4DPMA 3U3XA 4Q9NA 2ZB7A 5ILGA 1PIWA 2HLPA 3WIEA 4I5DA 3JTMA 1H93A 3JQ9C 4B4OA 1DRWA 3TDKA 2YY7A 1YONA 3C1AA 4NH4A 4CQMD 5CHEA 4GX1A 4CV3A 1HE4A 1WXDA 2DBRA 2YHUA 4H7PA 4IDEA 2IZ0A 1LSOA 1JAXA 2J3IA 5L3ZA 5U4QA 4FS3A 3PQEA 3IKVA 2JFGA 5AQ1A 4GWGA 1C1DB 3GUCA 1HKUA 4IXWA 4XQGA 4WLEA 1IZ0A 4BO8A 1EFKA 4O0LA 2VYNA 3B20A 3WGQA 3G1TA 3AUAA 3KHUA 3NT4A 3Q9UA 2DTEA 4XYGA 4ZRMA 1BMDA 3NDJA 2J5KA 1PL6A 4NBRA 4RJTA 3GAZA 3C3XA 1GTMA 4L4RA 3INGA 1SB9A 4MKXA 4E5PA 4IQGA 1MV8A 2A94A 1CQJA 3OIGA 1MC5A 1YB5A 4RVDA 3ZGYA 3BAZA 1B15A 1I3MA 1KYQA 2JAHA 3OJLA 2AEJA 4WOJA 5JCJA 4JJFA 3JQFC 2P91A 4DPLA 4PZCA 1X1EA 2FMUA 4JX8A 2WTBA 2AA3A 1VE9A 4YEDA 3UOGA 3GFBA 4PZEA 1GQQA 1MB4A 2Q4BA 3RKRA 3B1KA 4P8RA 4E21A 4IJWA 3C24A 1XA0A 3RUIA 1I3NA 1DRVA 3H4VA 4PG8A 1EUCA 2WJPA 1JN0A 3I4CA 3VPXA 4O59O 3DBHA 4QECA 5ENDA 1P1KA 5IDXA 3ZU4A 3JD4A 2Y0DA 3RBVA 3UCFA 1CWUA 4DYDA 3ANLA 1SEVA 2ZIZA 3INTA 5KVVA 1PZGA 6LDHA 3JQBA 1QYVA 2EV9A 1DC4A 4WLNA 4XEHA 3GG2A 2YYYA 1Z82A 1WNTA 1QLHA 3O4RA 4FFRA 2W4QA 5DOZA 3AM4A 4BNVA 1YO6A 2NTJA 1MFZA 2JCXA 2YQ4A 4A26A 2PZJA 1UXJA 3SJ7A 3SLGA 3W4JA 3F5SA 1ZK0A 1UP4A 5U1PA 2X0NA 4FB5A 4OMUA 1ZCJA 2Z95A 3G49A 4NFSA 4BO4A 1GYQA 3WXBA 3ZU3A 1MP0A 1GPJA 3G0OA 3QVWA 2VRCA 4M1QA 3JSAA 3KXDA 3ZN2A 4IQ8A 4GSKA 4FCCA 1JTVA 1W8DA 3V2UA 2C5EA 5IN5A 4BGEA 1P44A 4M55A 4U7WA 3W6UA 2X9VA 1GR0A 2O3SA 2VN8A 4E33A 1T25A 1WZEA 3QWBA 3DZFA 2Y67A 4J16A 3WSVA 2Q1WA 3LC2O 4DYVA 4ALLA 4RQUA 2X9NA 1H9BA 4DIBA 1LEHA 1YBMA 4NBUA 5I9MA 3WGZA 4BO7A 1O8CA 1NHWA 4CUZA 4RVSA 3QVSA 5A9TA 2C2YA 4DLAA 1ZK2A 4XR9A 2EW2A 4IJUA 1O89A 2HK7A 5B37A 3EZYA 3STHA 4AICA 2YFQA 4BHTA 1U3WA 2JFFA 1KEVA 1DBVO 4FPXA 3MJCA 3RROA 1U2DA 2YHIB 3D1LA 5CDTA 2CF5A 2NVUB 2UDPA 4TRRA 1ZSYA 4W99A 1JA9A 5A1TA 5GZ1A 4ND1A 2EKQA 5F3RA 2PD4A 1DSSG 1YGYA 2HO5A 4YJFA 4RF4A 3U62A 3ZWCA 2HMWA 2VHVA 4FFLA 5JAQA 2F1KA 1YQGA 3ZZNA 3X2FA 5IZ4A 4IS2A 3G17A 2E6UX 4ROSA 3AOGA 4G5HA 4BV8A 4CMHA 2O48X 1PJ3A 5CPBA 2FSVA 1PJCA 3I3OA 3ZWMA 1PZHA 3KTDA 5JY1A 5COQA 1Y5RA 5IZCA 2IDZA 5JAIA 3KO8A 1YL7A 3UHAA 1UZMA 3PQFA 2UYYA 4J6FA 4AFNA 2OP1A 3ORFA 1IYZA 5A06A 3FF4A 4O5OA 4BGIA 4MO2A 3JYNA 1PEDA 4TRNA 3MOIA 4CM8A 4XDZA 1PTJA 2BF7A 1X7DA 5LDGA 4DWVA 5CDYA 2C5AA 4KZPA 1J6UA 2NWQA 3QQPA 3CXRA 3E1KA 3DMYA 5F5LA 4DTIA 3V1UA 4MVJG 2Q2VA 3QP9A 2VOJA 3RVDA 1V3VA 2PH3A 1GEEA 2GDZA 2GO1A 2LDXA 5AXBA 3RFVA 5ILOA 3LF1A 2Y1DA 2Q1UA 3GY0A 1WDKA 3H9UA 3HDYA 3WX0A 2QYSA 1ADBA 3F1LA 3W8FA 2ZJ0A 2OUIA 3ITKA 1VSUA 4BKPA 5KKCA 4BNUA 3PGJA 3S1LA 3Q3CA 2PGDA 1X1TA 1DRUA 2Y1GA 3HUDA 4I9NA 5EMHA 4UULA 4CM9D 5HRUA 4ALKA 4BNKA 4AJHA 3JQCA 4XQCA 1N7GA 8ADHA 1GFSA 1H6AA 1VC2A 1Y81A 3HN2A 4II2A 1ENOA 4LVCA 4N54A 4IDCA 3IL2A 2EJWA 4GMGA 3PYXA 2WYUA 2Y0CA 2CNBA 2WDZA 2ZTMA 2X9GA 3B1FA 1R6DA 4BV9A 4BNIA 3BIOA 4KMSA 4IDGA 5KJ1A 2JKVA 1HF3A 1XYGA 3I9NA 3VDRA 3B1JA 1RKXA 3OQ6A 4R68A 3MJVA 3SEFA 4PLWA 1KVQA 3HFSA 1E7MA 2HMSA 3I83A 4PLHA 2J5QA 2CUKA 3ZI0A 3ST7A 1WMBA 1HE5A 4PLCA 3UICA 3VVCA 3PEFA 4XKJA 4KUHA 2BMAA 4IDBA 4RO0A 3ETEA 2VWHA 2FP4A 2YV3A 4GQAA 1JKIA 4L73A 4Z0TA 3QV1A 1WAMA 2JJYA 4IINA 5T6BA 2ZYDA 1G0NA 5CDSA 1J4AA 3V1YA 2OGUA 1PJQA 1YVEI 2JD1A 2AQKA 1V0JA 2JCVA 3O26A 4GLOA 2NQ8A 4U8GA 1J0XO 3BMCB 3JYOA 4GGPA 4Y8VA 1QSGA 4TKLA 2QRLA 3GVCA 1YE3A 5GMOA 2AQHA 3I9LA 4CLDA 3VPFA 4GVXA 4LSWA 5J23A 3ROMA 1PSDA 4PGFA 2C2XA 2X5JO 1HLDA 4NHEA 1DEHA 1Y9AA 2ZCVA 4BUCA 2O3TA 2O7QA 3UN1A 4TQGA 1E7QA 1Q7GA 3AW9A 1K6XA 1NASA 1XELA 2PA3A 2W90A 3VH1A 3KSUA 1MG5A 4CMIA 1ZO8A 1ZEJA 4DGSA 1QG6A 4J91A 1E7RA 5JE8A 2DC1A 1HLPA 3RJ5A 3VOSA 1NFQA 5IF3A 4OXNA 5A3VA 3RC7A 3R0IA 1F14A 3AUUA 1D1TA 3UFXA 2OHXA 3BXXA 3AUTA 2DVMA 3IQDB 2HMTA 4PLVA 3O8QA 1BSVA 4GKBA 4KOAA 3RUFA 1FF9A 5F1PA 3GHYA 3PHGA 3WLEA 5IN4A 4N18A 3ENNA 1UDAA 3W8EA 1SPXA 1BGVA 1G6KA 2VTEA 4L0QA 2QHXA 4BKOA 5KJ6A 3VTZA 5COAA 5CDUA 1ZK1A 5KTKA 4YT8A 5A9SA 1ZUD1 1M6WA 3N7UA 1A72A 5FEUA 1M75A 4FFOA 4DIFA 2HJRA 1NVMB 1QR6A 3LZ6A 4ZJUA 1NQTA 4LK3A 1E1NA 1NX6A 3W8DA 3VKVA 3FN4A 3LK7A 2WMDA 3ZV5A 1ZEMA 2UUOA 3FCOA 4RDHA 4UEKA 2RH4A 3FNHA 4WOKA 4XIJA 2EIHA 3QA9A 1C1DA 4JK3A 2R2GA 4Y6PA 4M8SA 1ULSA 3L4BA 3VH3A 4YT4A 1QLJA 1EE2A 4B3HA 3WFJA 3PZBA 1QP8A 2OOSA 1U28A 4DMMA 1LSJA 5JXWA 3EUWA 4Q39A 4TRMA 3DONA 3HFGA 1LBEA 5ICSA 3FD8A 1LXCA 1YKFA 5HM8A 4R9RA 4ILKA 3OIFA 3OICA 1B7GO 4YBZA 4RVUA 1F8FA 3FBTA 4CLRB 3JQGB 1B14A 3LT0A 4B7UA 5T57A 1Y7TA 3QWAA 3ZV6A 1P1RA 2GN6A 4LW8A 1TT5A 1CETA 4D3DA 5A5FA 2NU6A 1VLLA 1C0PA 2W8ZA 3T7EA 1YXMA 4EJ6A 4DUPA 4QSMA 2JCYA 5EIOA 1UAYA 2Q46A 2YDXA 3PHLA 4F46A 4YB8A 3LDHA 4MIEA 1FDTA 4R41A 3UCEA 2VHZA 3GDOA 5TS3A 1MXHA 1P1IA 1X7GA 3UGKA 2HK9A 1PJBA 1GUZA 1A27A 3GPDG 4URFA 3FNFA 4MVJH 3KRTA 4F6CA 1BXGA 1T4BA 2FZEA 4KDFA 5JO9A 1U4OA 5FI3A 3MTGA 4BNJA 4ZQFA 2AQ8A 4CM4B 1CF2O 3AI1A 2DTXA 2GUGA 1I01A 3LLSA 1Y1PA 2BFAA 4UUNA 4EUHA 2NU7A 4GKVA 3QE3A 1F12A 1T1RA 3BHJA 3D64A 1LX6A 4IGEA 3BMQA 4HADA 4O63O 5JDIC 4Q3DA 5I8WA 4J3FA 1TA4A 2GSDA 1U9JA 3RSHA 1Y8RA 4EBFA 3IOYA 1DJQA 2Y1FA 3WYCA 3RI3A 1K5HA 4AVYA 1OC2A 1XSEA 4OXYA 4WASA 2FY8A 1L1FA 1Z74A 5AYVA 4DBZA 1ENYA 2Z1NA 5MDHA 1FDSA 3GFGA 4J90A 4Z9YA 4BO6A 2VYVD 3DBLB 4YXFA 1Z6ZA 1ISGA 1XEAA 3L0DA 3WGHA 1U5AA 4XYEA 4OH1A 3ASUA 2DUUA 3GZ4A 2W2KA 4UAGA 5A02A 3MEQA 3DMTC 4DLLA 4XYBA 3S8MA 1VM6A 1PQUA 5KKAA 2QRJA 3FWNA 3E03A 3L9WA 1WW8A 3VZQA 1RJWA 2QIOA 3EC7A 1EQ2A 3FBGA 3DB2A 2FSSA 3VKUA 4DBVO 4DREA 4FBGA 3GPIA 2OBYA 3DHNA 4XCVA 3WQRA 5F21A 5A04A 3DWFA 2B69A 1B8VA 1B2LA 1KVRA 3DBRA 3TQHA 3FR7A 4BO9A 3OJ0A 1ZSVA 2GASA 1GYPA 1YDEA 1I3LA 2GLXA 2X0RA 3DL2A 5DCWA 1LRKA 3FSRA 4IGFA 1A4IA 1HSZA 1R15A 3WQSB 5KJFA 3H3FA 3OA0A 3G3EA 3NTRA 3PHJA 5DULA 4BO3A 1HT0A 3TNLA 4MPDA 1NXQA 1SMKA 3BTUA 5DCUA 4BNWA 3DTYA 2P9EA 4L4XA 4D45A 4ND3A 1MX3A 2NTVA 4P22A 5H83A 1Q7BA 3VPHA 4CMBA 3GF4A 3V2HA 3WLFA 3E9MA 1HSOA 4D46A 2DBZA 1E1LA 2EXXA 1HE3A 5JW6A 1P77A 3D3WA 3GG9A 4I8XA 4UEOA 1LQUA 7ADHA 2EW8A 2RAFA 1EBUA 4R51A 2EG9A 3GGOA 1EVJA 3K96A 4MJLA 5ICMA 4PIVA 1LDBA 4E31A 1IUKA 3JQEA 4HFRA 5L4LA 2IEDA 1NAHA 4WECA 1L7EA 3OECA 4HX5A 4R5HA 3ZWVA 2BH9A 5HS6A 1WVGA 2BFMA 2CDAA 1UDBA 2ZB3A 3KSZO 2FPGA 2VYVA 4NMHA 5TRTA 4WLUA 2O3QA 4UUPA 4BQPA 4TWRA 4PZDA 4ZHSA 4Z3KA 4QO8A 1B16A 3L9XA 2WD7A 1PZEA 3DZHA 4W9NA 1AXEA 1DHTA 4J0FA 5JC8A 5LCXA 3S2IA 1NBOA 2B4RO 3IAHA 3E5RA 2Q49A 4JN6B 3H2ZA 3QVXA 4FFMA 1ZBQA 3TL3A 4PRLA 1PQPA 1IB6A 1FMCA 4NJMA 2PKQO 1W0CA 1P74A 3M6IA 1BHSA 3AOEA 3ROPA 3H2SA 1ZKMA 3OIDA 3H5AA 4CQMB 3H65A 3ITDA 1X7HA 3IIEA 1C3VA 4IM7A 3H9QA 5JPIA 3AY3A 3RFTA 3T7CA 3SC4A 4RF2A 4WEQA 2B5WA 4NI5A 2C59A 4NZ9A 1E3WB 4TKMA 4UREA 2PGJA 3RC2A 2X22A 3EGOA 3ZWOA 2O3JA 1EDZA 1ZH8A 2H63A 2VHYA 5AVOA 3FRJA 4L8VA 5TF4A 4BNNA 1A9ZA 4FGWA 4NK5A 3AWDA 3K2EA 1AN9A 3GT0A 4EEZA 5JMPA 1ONOA 3DBLA 1TEHA 5TJHA 2RH8A 1GADO 4D0RA 4BNLA 3GLQA 1V3TA 1DAPA 1YOVA 4RL6A 1E5LA 1PQWA 4GMFA 3WGGA 5HS4A 4B79A 1IY8A 4MOWA 3TN7A 3TZ6A 1PGOA 3X2EA 1HEUA 3P5SA 3NT2A 2DUWA 3QHAA 4NK4A 3DEYX 2GZ1A 4UUOA 4UVDA 4R1NA 4N5LA 2VQ3A 3IP1A 4FD3A
chains in the Genus database with same CATH superfamily
2CCJA 4N7BA 3SVLA 4LVNA 3I2JA 1ZJWA 1IXZA 3TUIC 4P5PA 4GPIB 4IHJA 3Q8MA 5B7QA 1PR5A 5A5DA 4QVGA 4RABA 4C7XA 3CW9A 2O57A 1ZM2A 3DTVA 4LRSB 1Q1BA 1SQ5A 1TMYA 1DGQA 2X58A 5FOSA 4Q15A 5FP0A 2WU1A 4BMZA 4DBLE 1MG0A 1SC4A 4TXNA 4U0KA 4JA0A 3LWBA 4XGIA 4YRPA 1SIBE 4O4JF 3G6KA 1SOMA 3WTBA 4DUYB 4NBKA 3ML1A 5AVYA 1F2UA 1WMEA 1HK7A 4IQ0A 3V97A 2E55A 4MTLA 1DQSA 1CEYA 1LX7A 4HTFA 4KXLA 1EX9A 2VPQA 1KFKB 3GEGA 3KOZA 2WD8A 5DLPA 5B1DA 3V9AA 1G5PA 5E7IA 1SGWA 2NUBA 1XE3A 3HWSA 1Y82A 4U7FA 3GLFE 3QI2A 4D0LB 5J4YA 2FETA 2OXCA 4XQ9A 3FNEA 4I81A 2VSOA 1BGXT 4ZAGA 1JPUA 3CF4G 3D6NB 3ETNA 3CT6A 3LYLA 4WKNA 4YMIA 5JJLA 4WCDA 1NNSA 3B53X 1OFTA 4IKOA 5DZSA 5I6DA 3F97A 3J81A 1N9KA 2V74B 3IAS6 3SX0A 3UHOA 2BLNA 3FNRA 1C5KA 2J87A 3UW1A 3MERA 2G28A 3T9CA 4C08A 2FSFA 5JQGA 2ENUA 2I67A 2R6R1 3D54D 3OE7A 4WPGA 2EFGA 1KS9A 2AK2A 3Q87B 1WO8A 5FA6A 1VRWA 3RT7A 3DE1X 1JRLA 4PIMA 2OECA 3TZCA 1HT2E 2QN7A 1PR1A 4IGKA 2PWZA 4DJDC 3IC5A 4GRAA 1NVDA 5JYCA 2DWPA 2JCSA 2DR0A 4FGZA 2K2QB 1RRVA 2QTVA 5DX8A 4YHHB 4AKSA 4IIXA 4M98A 2AJ8A 4QYWA 3AXSA 3E3LA 3RIYA 1QQ5A 2ZI6A 3DUWA 2MHCA 3FPHA 1WDLA 4LI3X 4UDYX 3QQ5A 5BYBA 6Q21A 2WE8A 1YRAA 1Y6FA 5LDHA 1NVKA 4OGWA 2H1RA 2VDLB 3QUCA 5DJ5A 1N9GB 3N0XA 4E13A 3KVRA 3P9NA 4ER6A 4NICA 2WKSA 2WZCA 3RU2A 1W4ZA 1AQLA 2MSDB 1XCJA 1OFVA 4RJKA 2XYHA 1L7BA 5EXXA 2FX2A 1UDXA 2P9GA 2GH1A 1P9WA 1A2BA 2M6LA 3ZWXA 2L42A 4EF5A 2QMYA 3AG6A 5ALXA 4I5FA 5DNYB 4KQ6A 2ORED 3BD9A 2W0MA 2G5PA 2VLBA 4ZU6X 1JKXA 1A9TA 2I4OA 3USES 4LGYA 2ODWA 4PZYA 4ZEWA 3WAKA 1FMJA 3M3HA 2GXAA 3IB6A 3NHZA 1SA0A 2C04A 3U17A 4AUNA 3RAJA 4WXHA 3Q3HA 4YDRA 1XMPA 2R6DA 1CYDA 1XEXA 2VCYA 4R8SA 3FSGD 4F60A 3GJ6A 5FWYA 1IOWA 4MUBA 3SNHA 2V7PA 3ZK8A 3TL6A 4M8IA 1H4SA 3M6LA 1Z28A 3MWFA 1VL0A 3QEBZ 1L5WA 2V0CA 16PKA 3PPIA 2DFVA 1L5RA 3OCCA 4FYPA 5GAJA 4R40A 4KXUA 5HBGA 2ZRGA 1GCUA 4QGSA 2XF2A 1L4KA 1OU0A 4P4GA 1L5SA 2H6EA 3EZFA 4PSCA 5LLSA 8AT1A 2P7IA 3TZQA 1N6RA 1N2ZA 2OBMA 5CLLA 1TCBA 4R9SA 5A1JA 1U5BB 2QF7A 1WHSB 1FNNA 5EJ7A 2GK6A 2GJ4A 1E94E 2PBLA 3OLCX 3AHCA 3HXQA 5J5AA 5L51A 4HDRB 2HDHA 4ZAZA 4YCDA 5IJXA 4DMRA 1GYRA 2FSIA 3S2GA 4C6TA 3E3MA 5EE5B 4OAQA 4EMTA 3KQWA 5EHZA 4FQ5A 2PH5A 1JIIA 1RWKA 2HZBA 4LJ9A 4BE9A 3B5EA 3OZGA 4AJKA 1TQ2A 4ZZ3A 2BVNA 2QW8A 5K6AC 3HBJA 4IY1A 1J06A 3FPCA 2VTKA 4CF3A 1HTWA 4B81A 4Q5IA 1G59A 4OFWA 5CB4A 4ZQHA 2Z5FA 4Z4EA 2W2LD 5HDBB 1E96A 1YFKA 2JI4A 3ED1A 5BNTA 2GKGA 1PJ8A 2Q5FA 2RGAA 4BNHA 2Q9AA 1YFJA 1SM4A 2WJHA 4IZ6A 2Z2ZA 1WBJB 2FUG6 1PWEA 1R2QA 1VL8A 2AV6A 2YVKA 5BVGA 1SQ0A 1TVMA 4OHRA 4ZO6A 3B6EA 1TO1E 1U0TA 1PJ4A 2VH2A 4ZGGA 3GNTA 1XVAA 3E22B 4U7GA 1V5EA 3EG9B 4MDEA 4YA6A 5BVHB 3IUQA 4KQCA 1TYBE 3FTNA 1ESNA 2IU0A 4RWZA 2B4QA 3UVEA 4Z1MD 3LSTA 2QIPA 2HNAA 1EM8B 2FQ1A 5IZCC 1PZFA 4K9DA 4C2TA 5JAMA 2VBFA 3IQIX 3A4NA 4W5HA 3H5RA 2AHOA 2IYTA 5CH3A 2HM7A 1J0AA 2E48A 5CM9C 3WR5A 3ASZA 3E9EA 4WNCA 2HCBA 1UBKS 3EXEB 4EG6A 1EWQA 3QEAZ 4E3WA 3FB4A 1J23A 3PEUA 2V9CA 2VL7A 1QF7A 2QZSA 1U3VA 2PUWA 3HY3A 3N2ZB 3I1FA 4ZOCA 1QFZA 3EEQA 5EEGA 1G3UA 1ISRA 4FW8A 1PJSA 4K46A 2DH5A 1C9JA 2QN8A 3KKEA 3KLPX 3SHFA 4HVLA 1Q0PA 2AMFA 2JBAB 3RJMA 1KU0A 2CW5A 4MAFA 1SC3A 3O90A 4XD7A 4CT4B 4CBVA 5LP6B 2HEGA 5DCLA 3R3VA 3TTWA 3GZNB 1WQ4A 1RM4A 4GUAA 5JFGA 1P4RA 3LPMA 4GZLA 1DC6A 3LVFO 1T5SA 1N6LA 1CZLA 2AUNA 1H65A 3QVMA 2WIGA 5TB5A 4IVPA 1E4YA 3UTCA 2VXCA 3UEOA 2OKGA 4A1OA 4D4LA 4TLAA 1TPZA 3GAAA 3OLVA 4C78A 2QAIA 1XRJA 4D8UA 1F2TA 3AI3A 3HG7A 3OKAA 5H80A 4GRDA 1GXSA 2J31A 1IQ0A 3RTCA 2CEKA 1G16A 2FW8A 3W1VA 4B4UA 2FFRA 1KJNA 4C0HA 2IPMA 3GYGA 1CK4A 1JR3D 3RIMA 2WSSD 3G6WA 5LLTA 1RM3A 1POWA 2I6FA 2O7NA 3O94A 1QHXA 2PPLA 2C42A 2TMYA 4H3SA 4I50B 3ZIDA 4DLNA 5EG5A 3T5TA 2R6ZA 1CR2A 3FTPA 2HA7A 1RD4A 3ZH9B 3UJNA 4RD4A 1SB8A 3P71T 1J39A 5FPSA 3NHJA 5ER6A 3LBYA 2J1LA 3PPYA 1VKNA 1YZVA 3VPGA 4BRWA 1XLWA 2HYDA 4XQEA 4MKIA 3MT9A 1P3DA 3OLQA 4EYGA 5EQFA 3A11A 2X7XA 3KJEA 1O8BA 4ER0A 1DIGA 1MO2A 2PLNA 3TEFA 5DNUA 1R64A 2DAPA 2PZEA 4QX6A 3G02A 4PZ9A 4YCJA 4PBRA 2W70A 3X2SA 1MPTA 4RV9A 1OLUA 4IHQA 4NF2A 3TCKA 4TTPA 1UMDB 5KQMA 2XH8A 3EZXA 3N58A 3PDCA 1NN0A 3GEMA 3L1VA 3MOGA 4IBOA 4QREA 1KFJB 1Z25A 2H4WA 1CUWA 1W44A 3INRA 4HFJA 1EZZA 4OM8A 3RYHB 3S2EA 3UJPA 3UKJA 4B35A 4F93B 5FBRB 1HMPA 2D0OB 4N3AA 2FHSA 3AVQA 3AVXA 4O4LF 4Z49A 2XPCA 1NRIA 4MW0A 1PQYA 3QF4A 2BGRA 3MLEA 1O08A 1H5QA 1DAOA 1JHYA 4TMKA 1NSYA 3DE4X 3TRHA 4YAIA 3EXG1 5LZ8A 2BFCA 2OBNA 3L18A 4M76B 5H02A 4XLTA 4D57A 4D81A 5HE9A 4D74A 4X9XA 4CHGA 3QLVA 3RVNA 3WRVA 1JFFB 5KTTA 2NSHA 3AZOA 1IUPA 4YJFB 1A8IA 1H1LA 4O8ZA 3SQMA 2IHUA 4I9HA 4ND5A 3C6YA 5J47A 3ZHRA 3L6CA 4GD3Q 2EHDA 3ZE0B 2HWWA 2P5YA 2WM9B 3EGCA 3PLRA 4ZDJA 2HEIA 5YASA 3HO1A 4V0SA 4JBIA 4HUTA 3HDJA 1A1VA 4BLTA 2H06A 5A03A 1R12A 3KXIA 2XE8A 2D3TA 4B3JA 4J4HA 4A92A 5JWOA 2FR8C 4L6AA 1QAOA 1XFAA 3AEQA 4JEMA 4G1FA 3UXYA 4D8TA 4UBMA 2QW1A 1TF7A 3DEAA 1UAGA 5JSZA 1VPLA 2OC4A 3TD9A 2UVPB 4EG8A 4Y2VA 3GA0A 4AY4A 5H70A 2QJFA 1CS0B 4TKUA 2Z6UA 2QBYA 1WZCA 3TZHA 3UMMA 1S01A 4EHNA 2C4KA 4LBWA 3IV9A 3B60A 5CB0A 1DBIA 2QZJA 2NLOA 2QLFA 3P9IA 3UV7A 2O1XA 5BNIA 3BSSA 1E3JA 3K6SA 1KMNA 3RRJA 1YQDA 2PUGA 3HGQA 4WJKB 4OIMA 3RS5A 1A4RA 3G59A 3KQOA 1LBQA 3ULKA 3TTXA 5JSFA 2JGFA 2JGNA 1EEXB 3FMPB 3N2YA 4DNQA 4G07A 4I6JA 3PDWA 2DTDA 2QTMA 4L0MA 4ZFNA 1IVSA 1HNZB 1HRDA 3WNZA 3HKDB 3U6BA 3KETA 4BVBA 1R16A 4YJ2B 4ASUA 5IABA 3DP9A 4FT4A 2JLXA 2H4ZA 5D3ZA 2FPWA 521PA 2JAPA 2P6MA 4FHFA 2WU3A 4TSKA 1XRQA 4LK2A 2QD1A 3UV6A 3GLFB 3D6VA 1QIMA 5LMUB 4ISCA 1VHQA 4HATA 5JAZA 4XA8A 2O2YA 2YXBA 2X76A 2GAIA 1MAHA 3NGLA 2XJ4A 3A9SA 4PC7A 5EHXA 1XRNA 2DFKB 4ZVVA 3N2EA 3DAHA 5CVVA 3WQBA 3T54A 1LS1A 2PYZA 4C3OB 5JSKA 4QHSA 3R9WA 1THGA 1WPQA 2EP7A 4I3GA 5HCIA 4B74A 1X0VA 4L22A 2A3NA 3ZHOA 4I99A 3M83A 2O8FB 1OFGA 3UYLA 4I19A 5FTLA 3UH1A 1M2OB 3THYB 2JH3A 5B2FA 2X5NA 4W5OA 2O0KA 4RLSA 2EJVA 3KQQA 4HVTA 2OD2A 4GYJA 3RFUA 2PT5A 4KIWA 4RVHA 1JIVA 2YNMC 3V48A 3HJUA 1RM0A 5KYGA 4L8GA 1K5DA 1V95A 3K9CA 4RSRA 4Q82A 2OHFA 5F5NA 4TKVA 3R40A 1F5SA 4H60A 3LLUA 3VGPA 3VZSA 1UPTA 3N8GA 5BN1A 2C84A 2WJWA 4G56A 1LPAB 1JAIA 3D3EA 4X91A 3JQAD 5B2EA 3IVXA 5HWSA 4KREA 1RHQA 4C3ZA 1KJIA 5DNAA 1U0NA 1LLDA 3SIRA 6NULA 3ELWA 4HZUA 1HG1A 3H2KA 3N2GA 4G4SP 3MTDA 3QU5A 1QK5A 4XX0A 4BCCA 5K4GA 2QPOA 2WIAA 3P9CA 3PDUA 3PQDA 3GROA 3RQSA 4Z9FA 5BR4A 3O47A 4CKXA 2NM0A 1AB5A 3KPYA 1Q91A 1T3LA 1XDGA 2QUHA 3B1YA 3CMCO 4J1TA 4OFXA 4YRSA 1RAHA 4MA4A 4HF7A 1GR1A 2XQJA 2QJRA 1MRSA 3ESXA 1LCIA 2MOKA 4MLZA 3D8UA 3LUHA 4ZAYA 4YRDA 4DDUA 3NG1A 1JW9B 2AXNA 5CEEA 4A36A 1SXJC 3IOMA 2I7TA 3SNKA 3WZMA 1FTYA 2JDID 3T5PA 2W2NA 1Y8QB 4BO5A 1V16A 2ZE7A 3OOEA 4H31A 5FQNA 4OHYA 3PGMA 1OYYA 3NC4A 4CUKA 5CM8B 1ORDA 5J4LA 1IJFA 1K63A 3K3PA 3NVAA 3PWKA 3C5HA 5E95A 1TZBA 1S9DA 2B4AA 5JJBA 3PB3A 3LKZA 4EVSA 4MS1A 2ZZKA 2D1QA 2JGRA 1FUEA 3GQBB 4E6PA 7REQB 4G9GA 1CUBA 2IXBA 4A5OA 2D74A 2IZZA 4MP3A 3WWEA 4KXXA 1U1CA 5CW2A 5FTMA 3RHSA 3RVRA 3LGSA 5KTPA 1E20A 1OBHA 4IO0A 4U39A 2PUJA 3D43A 5ERXA 5LD2B 3QBDA 3NDRA 4KBGA 4D9IA 2X77A 3FF1A 3HPRA 1RI5A 4U6QA 3AETA 1EG2A 1E7YA 1GPUA 2VNKA 4KRGA 3IAEA 2O07A 4Q47A 1SOWA 3ZK9A 1XD2A 3MCTA 4EPTA 1G8PA 1CUHA 5GY7A 4GPTA 4HP8A 3OJEA 2GGSA 4WZ6A 2YRWA 2GILA 3TZLA 3AR8A 3SJAA 5G0SA 3PGXA 5IYZB 2QP3A 2EYQA 5CFPA 2BFBB 4S04A 4JFRA 1XX6A 3N3AC 2CUTA 2CVOA 3QMMA 2IYUA 2JBWA 1CJTC 1E0KA 1DU4A 1MIHA 3CG0A 3IAM6 4FLFA 4RSHA 4NFYA 2ZBEA 4TS4A 2HQOA 1JJFA 4FDUA 2H57A 1J2TA 1MEOA 1NRWA 3STTA 4MQUA 5CNJA 1S8NA 1BHJA 1H2YA 1CUIA 2CY0A 3DHVA 3EB9A 1PS0A 1CIVA 2QV7A 3PXAA 4IX9A 1ADJA 4JEHA 5AKHA 5TPWA 1TYZA 3JV7A 2FP3A 3EG5A 3EF1A 2X0EA 3CVVA 1P18A 4MVJD 3F7MA 3U7EB 1PW5A 2HB6A 4U00A 1JDJA 3CO5A 1HXHA 4LSMA 4W1QA 5DM0A 3RVPA 2QLTA 2HV9A 3K20A 3GJZA 1QHSA 2HT6A 4H7FA 1F0KA 1WRBA 4U8HA 3B8EA 3F9CA 2QM3A 2ZUBA 3ZI4A 4DWJA 3OE4A 1OV6A 1JZSA 3MGGA 1MT3A 1X8XA 3AM3A 1BXGB 2XCLA 3ZDRA 4DSNA 1WLYA 2NZUG 3PDIA 2CDBA 4KL8S 4YCSA 2ZDHA 3ASVA 1R5BA 3N59A 3Q1KA 1R4NA 4PG6A 4WL0A 3DBVO 1TJPB 1Y5MA 1WSWA 3PGA1 1UXOA 4X7PA 5CFMA 3ETHA 4ARCA 1ISHA 3UKDA 3ZHVA 3MTIA 5JRDS 2C0QA 2GEBA 4ENRA 2Q50A 1PBNA 2VRNA 1LV7A 3HKCA 4GI1A 4NBNA 1GQ2A 1AIPA 2GT1A 3K0AB 3LL4A 4O4HA 1D2CA 4NE9A 3RIGA 4D0SA 2WQZA 2J4FA 2GFQA 3K0AA 4XYMA 4EHDA 1K7XB 2B6NA 1IN4A 1G5RA 5E6RA 3U4HA 3F90A 1S2IA 1VRVA 4J29A 4MVWA 4BP3A 4B3XA 2O2CA 5BURA 4GO1A 3KK0A 4Z51A 2WSIA 5BN5B 4WUVA 4N82A 2JI7A 3A36A 1Z0ZA 2G76A 3FGNA 2IYFA 3DE3X 2B21A 3TIXB 2ZSJA 3DR3A 3MSXA 2D1RA 1XWFA 2CHEA 1L7DA 2CNKA 2OMEA 2WUGA 2ZWIA 1H6BA 3GNSA 2FQWA 3I92A 1YMUA 3H75A 3UCXA 3A6PC 2F3TA 2A59A 2FZ4A 3G2MA 3JQ8A 3NM5A 1KKMA 4KKXB 1N92A 4YUXA 4LAFA 4DPKA 3FFXA 1MNQA 2IP4A 3E6AA 3KYCA 4LWOA 1NJSA 1P3JA 1PFVA 1JDNA 3I6IA 2B20A 2EJBA 1OWNA 3OX2A 4M0UA 1PX0A 4NCKA 4KSBA 4RXUA 4QJ5A 3K32A 4YYZA 8GPBA 2PANA 1DQZA 2FZVA 2ZAOA 3KQPA 3V80A 4GDMA 4WJLA 4WLVA 3C7DB 3HFJA 1PZNA 2B9VA 4JQSA 4X61A 1P1BA 2R25B 4N8DA 5CRIA 3QKRB 1IQUA 1M66A 1TZJA 2MR6A 3CNLA 3QTBA 3HLKA 4G37A 4GR4A 3OUZA 5HF6A 2W58A 4A6EA 1DS6A 1GAWA 1E1QA 1H2ZA 1TQ6A 2ZWAA 3GBVA 1JMKC 2IA5A 2YW9A 3K0CC 3LWZA 4WK4B 1EXVA 3P26A 4E08A 4FBMA 1B0AA 1I2BA 7AT1A 1K97A 2CLOB 4JCCA 1YD7A 2ORIA 4J03A 3AC0A 4FOOA 3L0IB 1XLVA 2A8YA 2PRJA 2ID9A 4IDNA 1AKMA 3R7NA 2G5GX 1GFIA 3W5IA 5CK5A 3X3HA 5CYGA 3QPAA 3DJYA 3DT6A 4UFPA 2X15A 3QVTA 2YVAA 2ZK7A 2R4QA 3A9UA 1XN4A 4F4FA 2ZTUA 1IPHA 1SH7A 4EY3A 2F8MA 3K30A 4MI6A 4DM4A 2FGKA 4ND7A 4N47A 4J9UE 1YDGA 1C1XA 2HF9A 1JWBB 3H2GA 1D2RA 3HXLA 3NHWA 4P81A 2BGWA 5IWAB 1ISPA 4I2NA 2D4AA 2Q4EA 1KIFA 1E1MA 3N76A 4LTNA 3U3DA 4BCDA 1YULA 1V7CA 3GQBA 1BS9A 5EMNA 2BELA 3HYLA 2YRFA 3AZPA 4MRNA 3BXZA 2COEA 1BWSA 3V8BA 1L4MA 4NNOA 4OXKA 4EPXA 1JWLA 5D5PA 4LJ4A 1XVIA 1SU8A 1Y9EA 4EFMA 4I4LA 2Q8QA 5EINA 3NYQA 3QM1A 5CVDA 5GINE 1PK7A 1G60A 2D1TA 3B7GA 3EVDA 2Y92A 3EUAA 4D3FA 4ZDIA 2PQ2A 3NV9A 4EA6A 4RX1A 2GYYA 3LKDA 3N74A 4Z3DA 4EYSA 3SYNA 1Q2XA 4BATA 2P1ZA 4H6PA 3A31A 3GUVA 4B71A 5JYBA 4WCFA 3AY7A 4REMA 5DLDA 2HT1A 2AIRA 2HREA 3OQMA 1E6WA 2BTQB 3VO8A 1Y34E 2XNCA 4PYLA 1RWOA 1IMJA 1T2FA 3CINA 4EUSA 5BSGA 4LFAB 2OR3A 4ZI7F 1G3IA 2H0QA 2NSDA 2WZBA 3ABRB 3JQ7A 4XDGA 1QF9A 3O6VA 1BQEA 4NBVA 3HEMA 4EG3A 3Q41A 1B8UA 1TU0A 1TUEA 3ZDCA 2CWWA 1NWCA 5IEJA 2OFPA 4LRYA 3EGEA 1MC1A 1ZJYA 2PVCA 4CDMA 1US8B 3UUEA 1D8AA 4LIPD 5I9NA 3BXGA 1ZONA 4M37A 5HFAA 5FR1A 1AZWA 1F0YA 2X7JA 2ZUWA 3QBEA 5C4IA 3I9KA 3AUSA 2F3RA 4HNHA 2IC5A 4B6GA 4MJ7A 1UKVY 1JIXA 1HOXA 3TL2A 3PXXA 2KBFA 3U3MA 5AOCA 4HUQA 2OM2A 2XGJA 4NYMR 2G77B 3E4CA 1O0CA 3Q9SA 2YV2A 4QOSA 3VDQA 2E4XA 4W63A 3HZRA 5KYWB 4CEJA 1M1YB 1MB3A 2Z6QA 4IDAA 4JS0A 1RLIA 4EARA 4B7CA 1RIIA 2VTVA 3SG0A 1OXSC 4FYHA 2PQ0A 3I53A 5ELXA 5DWQA 1GZ7A 2JL1A 2IH5A 1UKEA 1BMQA 4M7WA 3V4LA 4BNTA 2WP8J 5HA5A 1ONNA 4RYDA 3UMGA 5A4MS 1UMCA 3RUAA 1A8HA 1AKEA 1FTGA 2FW1A 2G9VA 3NW9A 3WB1A 2BGIA 3G79A 4FB4A 1YZYA 1WUTA 4UTRA 5KIAA 1S6YA 1YAJA 1W87A 2Z8ZA 4YTEA 1FUIA 1U94A 2WA2A 4KHPB 2F90A 2RIRA 1ESCA 2CKMA 1VHJA 3DEHA 4JVSB 1JJVA 1GV1A 2RHHA 4M8KA 1Q74A 3GGGA 5EP4A 4XVCA 4OKNA 2EKDA 3OT4A 2IFTA 2I4NA 4XGKA 1TTTA 4EI9A 1QYDA 2JIDA 4RH0A 2IPAB 1K98A 1JL3A 2Q2NA 3C3YA 3GLTA 3H1EA 4FILA 4HN2A 1A8PA 4KN5A 2FLWA 1PAUA 4TZ0A 1R9GA 1LPBB 5DU2A 2NXEA 9ATCA 2ZYVX 3GXBA 1LPNA 3PICA 3Q4GA 1Z5PA 2ECFA 2GTHA 4IIJA 3OO0A 4OHBA 3OZEA 3VTKA 4AXXA 4CV1A 5GIPE 1JKJB 2GPWA 4PZZA 4QXMA 3ZBTA 3FVTA 4CMIB 2R2AA 2IW1A 5C9ZA 5EGSA 4NDNE 1UFOA 5LA6F 3LU1A 4DRYA 1T5TA 3NBQA 1KOJA 4GSLA 5BQPA 5GIOE 2H29A 2CD9A 4HNGA 2ATIA 2ZSFA 3NYWA 3RABA 1PG0A 2K6GA 2O3RA 3C15C 2DECA 1JVNA 1IM8A 1ZUHA 1RI2A 3EXG2 5G02A 4KVFA 2PNFA 3HEBA 3GGJA 1JNYA 4DR2B 1UC4B 2G07A 3UPTA 2F6RA 1E6UA 3IULA 4ITUA 1R8XA 3JSXA 2K7ZA 1O94A 3TQIA 2ZU0C 4C7MA 3W6PA 4TXHA 5EEHA 3BERA 1GZVA 1O6CA 2QX8A 2VNSA 4TXMA 1B6SA 4TVOA 3AKEA 5A7FA 3D6UA 4EGAA 1TJ3A 5C8VA 4AN0A 1AKYA 1J8MF 1JG1A 4QU9A 1JFFA 2EF0A 4AUKA 4CMEC 1U9YA 2AUTA 2PTGA 1KKLA 1PR6A 2J08A 2BW0A 4R7TA 5K0GA 1C0EA 4PONA 4MYTA 5DM4A 3NB0A 2YXNA 3K0FA 3C8HA 2AD5A 4N5MA 4BKQA 5I7VA 3VBCA 2QEQA 4L4UA 2ZRMA 1OW3B 2ICAA 5BUZA 3CH4B 4XD2A 1I0ZA 5ES3A 1JLHA 1NQXA 2ZSKA 1X9HA 2OYRA 5AW8A 2YFHA 3RYHA 2F00A 1FNMA 2RHJA 1ODSA 2HRBA 3DHWC 2N3ZA 4HC4A 4HDKA 4L9SA 4RIGA 1WCIA 3FOFC 4Z4IA 2I4LA 3CISA 3HI4A 2JFXA 4D9KA 1N2XA 1CR4A 3VDNB 3FNGA 4O2LA 3IALA 3WYNA 2R1VA 4KWHA 2F8TA 2MTBA 1XZDA 3O5AA 2F4VB 4WESB 2QA5A 3JCZA 1A9OA 1E9DA 1MJNA 1YRLA 1ZIXA 2VAMA 4GGOA 4OHWA 1E7SA 1YBFA 1O0SA 2GZRA 3AQ4A 4PYIA 3VU1A 4CN8A 5L3QB 1E4OA 3GRZA 3FCCA 4GVPA 1VZ3A 3GT4A 4BDSA 3H11B 4EUFA 4CV2A 2AMYA 4HT3B 2Q7XA 1HI9A 1DI0A 1NBWB 1G38A 5LB4A 3R9XA 5C3MA 3L2OB 1KZ6A 5LQSA 4I0WB 4EITA 5AVQA 1PKEA 1XKQA 2ETVA 3WBFA 4FJ1A 3R77A 4RS3A 1MO5A 1YBAA 1RYYA 2J3KA 5SY6A 1ONPA 3AI2A 4ZEVA 4KR7A 2JFHA 3SGLA 1ZNZA 1XU9A 4GEKA 4LWQA 4B6JA 4CLRA 2FZGA 3I73A 4MRMB 3C98A 5D6OA 2X3UA 3VJKA 1XZJA 1UXHA 2UV8A 3LK6A 1ND6A 1AKVA 3TFQA 3AIOA 2ADMA 2L69A 2DUMA 2CHUA 2P0AA 3GZNA 3QJGA 3VC3A 4MVJF 3IX7A 5FBLB 1RE1A 3KFVA 4R8MA 2K4MA 5J9FA 1LQTA 5JDCC 5BN4A 3QPCA 1VOTA 2CLIB 5IC5A 4E3ZA 2BFFA 2QVYX 3ENQA 3UB4A 2AF3C 2H1SA 1A2KC 3LCMA 4KB5A 2HWKA 4RTPA 1YJCA 1OV4A 1N2JA 2IHTA 4ZVLA 5IF9A 2ZS9A 2OGZA 3F6RA 3OTQA 3S1SA 1QOZA 2JGKA 2AR9A 3ADCA 1F9EA 1P5JA 4LHZA 4X20A 4QQNA 3TOXA 2N42A 4JFAA 4CTJA 1BDMA 1KMCA 1DKNA 2R68A 1V8FA 2OYSA 1GCAA 1BXZA 2EKZA 1XCOA 2JA2A 2PMKA 3GT3A 5KTMA 1KJYA 5BR8B 1UBNA 4X92A 5CMLA 5CFNA 1S96A 4F9GA 9LDBA 3IDSA 4RZ3A 4DC0A 5E4YA 4H7HA 4G2TA 4GOLD 5IS2A 4IJKA 4G65A 3D2AA 3RD5A 4MB2A 1CZOA 1FC0A 1GZ6A 1NF3A 5ALEA 4P98A 3UBMA 5K20A 1T3ZA 2G83A 3K0KA 4FSXA 3IUNA 1TLTA 1ZNYA 4WBSA 3YASA 4X63A 3HCAA 3D7SA 3LUBA 4U7JA 2B78A 2GFHA 3MGCA 3T0GA 1ACMA 3BRCA 3CY6A 1F38A 1FDVA 1DUVG 2Q6IA 1YKGA 2P3LA 1G8YA 2GEUA 2H2FA 2QDKA 1OA0A 3DFMA 5CB4B 4LHEA 2D7JA 1PT6A 5SYNA 2H5LA 4FHCA 1KDTA 8LDHA 2G72A 1F4PA 2XA2A 1P7VA 1VBNA 3EF0A 3FMVA 2C4VA 3PUZA 2O2EA 3WYFA 2K2WA 1PL0A 4M54A 4HH3C 1BMFA 1LRLA 4ME6A 4UD6A 1G21A 3SM9A 3IEXA 3QVOA 1QUEA 3OJFA 4NCBA 4Q4JB 1Y1QA 2FV8A 2PGNA 1UBMS 2B4KA 4LXQA 3ZNNA 1MH1A 2HLNA 2C54A 3JD1A 3QTTA 4PVDA 3ZCRA 2WB4A 3K8OE 1VI5A 1XCBA 3LVBA 2FPOA 4HSEA 3MXTA 2VWPA 4XVHA 4TMZA 3GUZA 3TEJA 1QIGA 2P75A 3WLLA 3ZR4B 5JVDF 5FBHA 1YUMA 3O2SB 3NBUA 3KQUA 4Z2YA 3B9RA 1A8UA 2FMTA 4LX8A 5KTRA 4QGGA 2WWWA 2CXSA 3AB8A 2FPUA 1UBTS 3PUHA 4J0HA 2GBCA 3T4UA 2ZM5A 2GNAA 2P4QA 1WA5A 3BSFA 3LKVA 3IQEA 2V7BA 1OVMA 4FGSA 3NVDA 5FOQA 1I4DD 1E0DA 3TTVA 3TLMA 1OJLA 1KKUA 1W85B 2BI8A 5EUMA 1HDGO 3MS4A 3PT9A 3WKCA 5KOJA 1OXMA 5KZMB 4EY6A 2UYCA 4M7PA 5H81A 3GJQA 1ZMOA 5DGTA 1XNRB 2AD1A 4DB4A 3CH6A 1L9XA 4RF3A 2HQSA 2P9JA 4GWKA 1KYWA 4L7QA 1B93A 1JAHA 5JXIA 3EBPA 4LZOA 4KK4A 3F3SA 4BNDA 2CL0X 3B7WA 3BSWA 1X1CA 2DHRA 4G81A 2JIRA 4J7XA 4W1PA 1PCXA 3HHEA 2N75A 1GPDG 2VBGA 4DCNA 3SDSA 2IX3A 4A0FA 1JFVA 5ALVA 1U0OC 3FROA 3BEOA 3A3KA 4KXNA 4BFLA 1KC1A 4JODA 4I08A 2PWBA 4WDRA 4FHEA 1X7ZA 3MWGA 2G4VA 2P8SA 1K6MA 4P31A 3ZTWA 2QM7A 2W98A 4KV9A 3KC2A 2OAGA 4LX0A 1XL0A 1Y4ZA 3N1UA 4RENA 1H05A 3QHQA 4M36A 5FWNA 3B78A 3N28A 1DPGA 2IS6A 3COYA 1QOPB 4Z3OA 1B74A 3F6YA 3LSYA 1U2GA 4M1ZA 4D9MA 2V0NA 3L1KA 2GCIA 3M49A 2FW7A 3QYAA 3W2EA 3VM6A 4KPFC 1R7RA 3HEAA 2WUDA 1BCRA 1HL3A 4CLHA 3W8RA 3IILA 1YNOA 2I9PA 1C30A 2QJTA 3ONDA 3KBBA 1ATZA 1QE3A 1UWKA 3QXXA 9GPBA 2XCTB 2YXLA 4OU5A 621PA 4P6VF 3AP3A 4ARIA 1AY0A 2PWAA 4N3NA 4BKMA 3WL7A 2QTGA 3ZZUA 3IBTA 3G8CA 3NIBA 5KMGB 1V5GA 2WJVA 4Z4GA 3PQ2A 3F73A 3JY6A 2PUAA 4BX8A 1V11A 2Q99A 3CRW1 4ZVOA 3RWOA 1C80A 2JGMA 4NPCA 4QJBA 1CZHA 4QPZA 2XUAA 4EO4A 5CDHA 2JGAA 5JPCA 2BR3A 4BQQA 1I32A 4W82A 4XWWA 1U7XA 2IOYA 3FTDA 4WLFA 2HADA 4HAUA 2Z4RA 1JQBA 1EFCA 4P32A 3ZYZA 1RLTA 1KI6A 4PZLA 3RC8A 4UZSA 1T3TA 4BLUA 2ID7A 1VE1A 3GLKA 5CLFA 2DYKA 2WE7A 1NPDA 1FDWA 4I4TA 1EWYA 1P61B 1T9GR 2ZSHA 1MQ8B 3R6WA 4GMDA 2D8MA 5ELMA 1TUBA 2FTKE 3REQA 3RU7A 4CGYA 4DA8A 4UOZA 3ADBA 3GEBA 2I9KA 1TC1A 4OI4A 2AKEA 3B12A 4DEYA 4CKBB 4XVQA 5DLEA 3UZUA 1QB7A 4JKIA 4URXR 3CS3A 2W2KB 3BGDA 3KV3O 4H59A 4KI0A 3BS4A 4MI3A 5FNVB 1NT4A 2PLRA 3C6QA 3L8YA 4NG5A 5EXPA 1SXHA 1S8FA 2CJWB 2K87A 2QTNA 2YMQA 3JATA 3KR2A 4NIMA 3KPUA 4LQCA 3E05A 4MW4A 3WMWA 4F2HA 1CVRA 1NU8A 1KK3A 1Q0QA 2IOFA 3LUJA 3OFSA 4G5SA 4IHJB 2UUAB 3M1LA 1J2YA 1YB6A 3JZAA 5EE1A 2NYAA 3BXFA 1Z88A 3V46A 3CTPA 5C5IA 1UBCA 4DQXA 1Z7WA 4XWYA 5L9AA 9ABPA 4UMEA 2HA3A 2POQX 3CPEA 2C98A 2BFPA 2YOGA 4XGRA 3QFHA 3WIOA 2CUZA 3RT9A 1NT2A 2JEYA 2NNWB 3FH0A 2EBUA 2NVUA 4LNAA 4XB2A 2VUSA 1VE3A 5KVSA 3CKYA 3R0QA 3LRTA 2YTZA 3BE6A 4UHHA 2OD7A 2IEGA 3SIWA 1EVKA 1BQ4A 1T9DA 1Y1TA 2YWJA 1ZCBA 4HJXA 4P2BA 2QG6A 5HCUA 2IP1A 2NU8B 1CJVC 4YR9A 2VR1A 4OHCA 1RAIA 4RACA 3J81k 1W59A 3EJ6A 4NULA 5KQSA 3UJ9A 4Y1RA 1WPGA 3PD1A 4YRZA 2XUKA 1G64A 3PRKE 5JATA 1GNQA 1P1CA 3K9LA 1OXTA 2AQIA 3NS7A 2OZPA 2G71A 3IXMA 2H2AA 1V1RA 3E82A 4BBZA 4BYGA 3GJ3A 4WOPA 2BP7A 2OSBA 3CNHA 2Q6TA 3BJMA 3DHYA 4S1OA 3SPXA 4FNAA 1UPBA 2XMCA 4G6ZA 1HDCA 1Z18A 5LZ5A 4BB5A 1I4LD 5J4VA 1SVSA 1Y8CA 3GEIA 4XOUA 5HRCA 4IPTA 5CTJA 3E3AA 5ECGC 1IN7A 4LTMA 4E12A 4ESEA 1PN3A 3IR7A 4GMKA 4DVJA 5ADHA 3UWSA 1BYUA 4OLHA 4AJNA 4NJOA 3PC8C 4EG5A 3OQBA 1LPMA 4R7ZA 3DAFA 1SKUA 4KPEC 3TR0A 3BF8A 1M76A 2ZAGA 3ANYB 2F48A 2HDNB 4K2AA 4KE9A 2XWSA 4HY3A 2GF2A 4RHEA 5BVGB 1Z68A 2VHXA 2VPTA 3I39X 2NU6B 4P58A 3QLJA 3CEAA 1L5GB 4E4RA 1QBGA 4HNVA 4ZMRA 1KO8A 3VR6H 3DM5A 1A9QA 3EPJA 1IH8A 1JJAA 2XF8A 4IIJF 3I6QA 5DOVA 5SZHB 3KU1A 2CN1A 2DWCA 5TT1A 2XNKA 3H19A 4CN9A 4HX2A 2Q6LA 4BYMA 1AU9A 5EI5A 4DM7A 4EEXA 1YRBA 1K0UA 2O52A 4IFTA 1FYWA 3WYDA 3NHLA 2JHAA 1RJDA 5EMJA 2B2NA 3QXJA 4W5NA 3G9XA 1SAYA 1D2EA 4EFNA 5B3AA 4OJMX 5IPFA 2VAPA 4JWKA 5GJVC 3L79A 1X92A 4JU8A 1UK7A 4GZ5A 4U6NA 2WAOA 1WXIA 2VNAA 3PEVA 5LB2A 3LYUA 4F91B 2RB5A 1SXJB 1WW2A 2GD1O 2WVAA 2ZE5A 4EQ6A 5AIBA 1ITZA 4HWSA 3X1DA 4GP9A 1Z38A 1KC3A 2LR0A 3BD7A 2CUNA 3H7IA 1SIUA 3ZDAA 3JQRA 1OBFO 3C45A 4YS6A 2P5UA 3MWKA 4K8OA 1M6VB 1MZVA 3GLHA 4CU2A 4RTLA 1A97A 2FEKA 4E15A 3N70A 2QLMA 3RWBA 5EP2A 1EU1A 2V54A 5AUNB 4R2IA 4TTJA 1ZZEA 1QB8A 5J2TA 1V1RB 1YBVA 1KDVA 1M2VB 3QLTA 1NXSA 4Q3CA 4RKRA 3C8ZA 1CTQA 1IC6A 5G4LA 2XYQA 3THOA 5A9SB 1TW2A 5CB6A 4GPAA 5E6SB 4GIBA 5A2QA 2ZREA 4X7MA 2A1IA 2R00C 4PQEA 3A0RB 1DO8A 1OTHA 4TGLA 2YOFA 4HEA6 4XIYA 3W06A 3L8CA 3I9MA 2VDRB 2HU5A 4LDNA 3ICWA 3L6EA 2O1SA 3VOBA 5EZ6B 4C0LA 4ICIA 1E9VA 5HZMA 3AJDA 4LF5B 3T1HB 2I3BA 1PWYE 1ENPA 2DQZA 3ORYA 1LPPA 1AE1A 1W5AA 4G1UC 3WGNA 3UBTA 3AVWA 1E0SA 2JJ1D 2PEYA 4Q4AB 2Z5LA 3N8DA 2DUJA 1G20B 3EWNA 3UQYS 1K4MA 1ADFA 4IH1A 2C7OA 4OQMA 2XXJA 2Z04A 2Q5EA 1K6IA 2AE1A 4LJKA 1S3IA 4PGHA 2JGEA 4F1WA 1EVEA 3TBFA 2BFEA 2KPOA 2JNWA 4YP5A 2I34A 4TN1A 3MLAA 3RUCA 3CB2A 4LCJA 1YC2A 4J7CA 4X71A 3X44A 2QRGA 2P3SA 1NE2A 3RG8A 4DILA 4I9UA 2VZ8A 3OHSX 5KNDH 1U1IA 2NVOA 1NI3A 3BWMA 4IDFA 1R6TA 4MDYA 5MHTA 5CX4A 1KMHA 3HBNA 2FUKA 2E21A 1S3SA 2G67A 3LX5A 2PAAA 4KSCA 4YECA 5DDIP 3V2GA 4DMFA 4A6PA 1KO4A 1W0JD 5LOVB 3G1WA 2BUBA 2BTOA 2R7NA 3ETLA 2CYBA 3REQB 3BBLA 2ZLBA 2O8EA 1W5TA 1YQXA 4PCUA 2QZ4A 2AI1A 5T8KA 5HUJA 3CZCA 3IO5A 3TMYA 1RPAA 3IMFA 2PRYA 2EFYA 2NVBA 1E60A 1E6MA 3K2BA 4QFCA 4ZDKA 4JB2A 4KKVA 2VNIA 1R4MB 2O05A 5CPFA 1ZM4A 1W36D 1QP7A 2BMVA 2AFIE 3WRWA 3E35A 2AX3A 2OXEA 3GVXA 5KVQA 1Q6ZA 1DMRA 3JYLA 1ODTC 1ZHFA 3U80A 1DKPA 3BH0A 3DFUA 3VNAA 3IE0A 2E49A 3BDIA 1I7DA 2W48A 1RRFA 4FFBB 4OO3A 5C8ZA 4IIGA 4G84A 4R81A 4RPLA 5I7UA 1T1IA 3JD0A 4MKFA 3E9CA 5CXUA 4XSGA 1C0KA 3IXQA 4Z8XA 3T38A 1K1EA 4LF8B 1HFWA 1ONSA 1LDNA