3AY6A

Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
b'HHMYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKYPSFQFGRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose 1-dehydrogenase 4
publication title Structure-guided mutagenesis for the improvement of substrate specificity of Bacillus megaterium glucose 1-dehydrogenase IV
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
total genus 98
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ay6A00
2VHXA 1ZUD1 3C8MA 3OEYA 2RIRA 4L76A 3ZWPA 1W73A 4C7JA 5A02A 4D79A 5ADHA 4HXYA 2QZ9A 2FY8A 3T7CA 2IXAA 1NQTA 2TMGA 4E33A 2NU6A 4IJUA 1DIRA 3I9MA 3ZI0A 1MLDA 2BLLA 3H5AA 4EEXA 4CM4B 3ITKA 4JJGA 3GGPA 5L53A 2F00A 1DPGA 2ZTVA 1NBOA 1NYTA 1ZSVA 3DZGA 3OQ6A 4AJEA 1XU9A 4N5LA 3OP4A 1GFSA 1U2DA 1HE3A 5JAIA 5C37A 1SZJG 4XZ3A 2AE2A 3CZMA 5DP1A 2HU2A 3KVOA 1TEHA 4DPKA 4OIMA 1X1TA 1HDCA 3GFBA 1JQBA 4E5PA 3G3EA 3ZZNA 5DULA 1MFZA 3INTA 5TS3A 3UFXA 4XA8A 2E6UX 2GUGA 4TVOA 4TKLA 2SCUA 3TWOA 1IYZA 2G17A 5DP2A 3LT1A 3DR3A 4HADA 1E3JA 2DBVO 3JQGA 1HETA 1X7HA 3PHJA 1LTHR 3FR7A 3OIFA 2OMEA 4WLFA 9LDTA 4BVAA 4AJJA 4BGEA 3HDQA 3MWDB 2FSSA 3DONA 3DTYA 2DTDA 4D3SA 2QRJA 4II2A 2JAHA 1PS8A 4XQCA 4AJKA 1B3BA 1BDMA 2GZ2A 2C2XA 1KEPA 4RF5A 4ZICA 1E5QA 4ESOA 1V9LA 4IS2A 5JDIC 4FPXA 2QW8A 4RQUA 1U2GA 4E32A 3DZFA 3GA0A 7ADHA 2WYUA 1LDNA 3BA1A 4IJKA 4J90A 4LCEA 3S8MA 4QEDA 2NADA 3H2SA 1E3LA 2R00C 4R1UA 3TZ6A 3CE6A 3W8FA 2B36A 2GN4A 3F46A 4CM4A 5BR7A 4Q3CA 4FGWA 4AJNA 3TFOA 3PYLA 3MJ4A 4GPD1 4MVJH 2ET6A 3GRPA 3KHUA 4JJIA 5DN9A 4S1VA 5GZ3A 4BNUA 4IDDA 3BHMA 1MG5A 1D7OA 3HQ4O 1EDZA 5EL0A 3V5NA 3ZW9A 1MG0A 1JN0A 4J1SA 4Q9NA 4BO8A 3SBOA 2BGMA 3RAJA 3DL2A 1B8PA 3GVPA 1HLDA 3S1LA 2PKQP 2FWMX 3PJFA 5I9MA 4ZVVA 2X0RA 4DLBA 4XQEA 2C7VA 3EVTA 4W82A 5ICMA 1GCOA 2WTBA 1Z7EA 2X0NA 3GGGA 4RGBA 5A05A 1PJ3A 3BTOA 2J5QA 4OHUA 1JLLA 2Y93A 1EBFA 3PXXA 1ORRA 5JXWA 1PZGA 2Q1UA 2NTJA 5KVVA 3FNHA 1MXHA 3CUKA 1ISMA 2NU9A 3H65A 5G0UA 5KKAA 1OC2A 3WYEA 5EPOA 5A9TA 4CQMB 3L0DA 3PGXA 4JK3A 3DAPA 1CQIA 1ZNQO 4OSOA 2DTXA 2C20A 4R68A 2J3HA 2G0TA 4GAEA 2DFDA 4MINA 2BKAA 1BWSA 3GH3A 4RVFA 4L73A 4NH4A 4JJFA 5COBA 4FFLA 1R0KA 4W4TA 4BNJA 1PJBA 1BHSA 2HMSA 1DO8A 4R9SA 5B4VA 1LLDA 1O89A 3P5SA 4J9VA 4A0SA 2YV3A 3GMSA 3GNSA 1J4AA 3MJCA 4I9HA 2GYYA 2PKRA 2QRKA 3H5NA 4E5NA 4XEHA 2FPGA 4OJNA 2I65A 3FN4A 1T2FA 2CVOA 2PH5A 4NG5A 2AHRA 5I7EA 5JAMA 1NPDA 1SBYA 1GEGA 1OFGA 4N18A 5F5LA 4WLVA 1PX0A 1DJQA 1Y7TA 4J6FA 4BO3A 1YH3A 3FRJA 4NU5A 3RC7A 4WCFB 2VUSA 1PGPA 1I01A 1KC3A 1SMKA 4GVXA 1S7CA 2WE7A 5COAA 4IMPA 4S3MA 4BNWA 2O2SA 4PRKA 4CPDA 1HSZA 2ZTUA 3M1LA 2UVDA 4HFJA 3FNFA 3C7AA 1Q0HA 3RUAA 1P9LA 4K26A 4XJSA 2FOIA 3JYLA 1ZSNA 1YB5A 2IE0A 2RHCA 5KWEA 4XQGA 4IS3A 2WM3A 2EKQA 4CQMA 3B1KA 1UXIA 1C0IA 3JQDA 2YQ5A 3WLEA 4BNTA 3W6ZA 2OZPA 3BTVA 3V1TC 2CVQA 1CEQA 3PGJA 4TSKA 5F3RA 1PJ2A 4AJHA 1X0VA 4FCCA 1M67A 2JHGA 4YT8A 3JCZA 2VUUA 3KEQA 4W7HA 3WQRA 3L77A 4BNIA 1PZHA 3BMNB 4MKXA 4BNMA 2CSUA 3AOEA 3HUDA 3D3EA 3IIEA 4OOFA 1DC6A 1YO6A 2HJRA 4LVUA 4W6ZA 4QFCA 4YACA 1T1SA 3PJEA 3RIHA 4DA9A 4E3ZA 1DOHA 3ZHXA 4DYVA 2Z95A 3Q9NA 2JFHA 1OOEA 3FI9A 1HL3A 3E8XA 3JYOA 3WMXA 2X5OA 2BF7A 3AFMA 3AK4A 5HBRA 3AUTA 3OBBA 3Q3CA 3VZQA 5IJZA 5TLSA 4BIIA 1H5QA 1UAYA 3IJRA 1UP4A 2QHXA 3WGGA 1UR5A 1ZIDA 4MVJG 4W9NC 1C1XB 4MKZA 3GEMA 5EQDA 4FOOA 4CLEA 1SCUA 3WBFA 3NV9A 5IZCC 1XSEA 1YWGO 5G0SA 3RUCA 1UJMA 2Y0DA 3E9NA 4WCFA 3CMMA 3SLGA 1GY8A 2NTVA 2PGLA 4L74A 4CQMD 2OFPA 3JV7A 3DQPA 4J2OA 2BELA 4DBVO 4Z9YA 2NNLD 4WEQA 1EE2A 1XU7A 1NAIA 1WZIA 3A4VA 4LN1A 2Y1CA 4B4WA 5L7TA 4MP3A 3U4DA 5JC1A 3PWZA 2H1SA 3D1LA 3JYQA 2GSDA 5BSGA 1AN9A 2GD1O 4TRMA 4FFNA 2JHFA 4QUKA 3ZV3A 1ZJZA 5CG2A 5ENVA 1BGVA 5DBGA 3WFJA 1O94A 1DEHA 4ND1A 5K6AA 3WMWA 1WMBA 4UEOA 3B1FA 3RVDA 3UF0A 4PN3A 4R4JA 4B79A 2UDPA 3DAFA 3EGOA 4DRYA 2YDYA 3GVXA 1FMCA 3K2BA 4PLTA 3BMNA 3QJ5A 3ZU2A 4XGKA 3H4VA 4JP3A 3E18A 4EEZA 1P1JA 3F5QA 2OUIA 4RVDA 2X7HA 5A04A 2EEZA 3IDSA 5ITWA 1GQ2A 3WNVA 2EF1A 4QX6A 5KVCA 4FR5A 3GVCA 2A9FA 3ZHBA 1HLPA 4CMEC 3C1AA 1PWXA 3G49A 3FWNA 2Q1WA 2GN9A 2PTGA 1C1XA 4ILKA 3DBHB 3VC7A 3VZRA 3NEPX 4IIVA 1PZFA 1FJHA 4FJ0A 3ZCXA 4BNHA 1GR0A 1DB3A 3GY0A 4PRLA 3VH1A 1LDEA 1M76A 1F06A 3WQQA 4R16A 5IZ4A 1LLUA 1Q7BA 4YDRA 8ADHA 3S2IA 2QX7A 2DUUA 1IL0A 5DCWA 4I9UA 2GZ3A 1YGYA 5TJ9A 3KSUA 1JVBA 1V3VA 3WSVA 4YQZA 1QYDA 1RJWA 1N5DA 4X54A 2I67A 5CEJA 3INRA 4ALMA 5HM8A 2EP5A 5T57A 4CM5A 3TPCA 4TQGA 1Y9EA 3A14A 3AU9A 3D4NA 1LLCA 3L9XA 4NJOA 1Y8QB 1H93A 4XYGA 4XR9A 4K1LA 2O48X 4EUEA 1P77A 3ICCA 4XB2A 3WBBA 2QRLA 3GZNB 4L4XA 4M1QA 5DBFA 3ICPA 3VPGA 2HO5A 3FBGA 1EVYA 4DPMA 1ULUA 3JD3A 2BGLA 2EKLA 2Y1DA 4B7CA 1EVIA 2VWGA 3OJFA 1VLLA 1I36A 5H81A 1E3EA 2X5KO 3GLQA 2PH3A 2AQ8A 3WGQA 4ONEA 4BL5A 1X7GA 4AJ4A 4NK4A 1Z75A 1W8DA 4PG5A 2NUAA 2ZTLA 2A4KA 3VAZA 5JLAA 2EW8A 3TZQA 4M89A 4BQRA 2PZLA 3TRIA 1EZ4A 4TRNA 2YFHA 5I7VA 1Q1NA 1ISFA 4B8WA 3B70A 1E1NA 5EMHA 3D4OA 1NPTO 4RDHA 4F46A 3GUCA 3ORFA 2NU7A 3DBHA 2YHUA 3ZDFA 5K6AC 4B4VA 4IZHA 1YDWA 2NQTA 1VI2A 3RC1A 4CR7A 3I23A 3OM9A 5K9ZA 1T2EA 1Y5RA 5JAZA 2VWQA 1NWCA 3OQBA 1M66A 1RWBA 1U8XX 1PJTA 5EQFA 2D5CA 4YRAA 4ND2A 3ANNA 4A73A 3L6DA 3S2EA 1QLHA 3QWIA 3P7MA 3WOHA 1PGJA 4RVGA 3OJ0A 1BVRA 3VVCA 3DZIA 3GFGA 2YUTA 3KM0A 3M2PA 4IBOA 2D2IA 3PHIA 2LDXA 5JAQA 2W2KB 4NFSA 4TWRA 4YBZA 3ABIA 2O7SA 5KJCA 4FFOA 1Y8QA 2HQ1A 5HS6A 3STHA 2JFGA 1KOLA 4G2NA 4MP6A 4J16A 5KOIA 3GZNA 4L4RA 5G4LA 1YXMA 1A9YA 1GV0A 2GNAA 4WOKA 4IJVA 2X4GA 3HDJA 2HJSA 4ZQFA 3T4EA 3FF4A 2VOJA 4GX5A 3I9NA 4ZD6A 1NQOA 1FDTA 3KRTA 4PLYA 3D5QA 2ZYGA 3RU9A 1GEEA 2CDCA 3NTOA 1QSGA 1KVTA 3AOGA 5G0VA 1I24A 1F8GA 2VHWA 3PHHA 2DPHA 4R69A 2IYOA 3WR5A 2UAGA 3HSKA 1DBVO 1FF9A 4KDEA 5JFOA 4IJWA 4E12A 3RSHA 3LT0A 3GPDG 1AUPA 3U0BA 3W4JA 3OJEA 2VT2A 4ZN6A 4TRRA 3UH1A 5AQ1A 1R15A 3E6AA 5BT9A 2C5EA 3BTUA 3W4KA 4NZ9A 3LT4A 3KYBA 3BMOB 3V2UA 2GGSA 4RVSA 4UEKA 5I8ZA 5I8WA 2C29D 3P2OA 3PQEA 2NWQA 5F1OA 5EIOA 5CPBA 4LMRA 3OQ1A 1DAOA 2X86A 1LDYA 1CQJA 4LK3A 1J49A 2PGJA 2GASA 4QECA 3TZCA 1B16A 1UXGA 2E37A 3DWFA 2HCTA 4ZQEA 3GDOA 3DDNA 4J9UE 1IPFA 4RPKA 3LYLA 1LXCA 1NQ5A 3PRJA 4FN4A 2POQX 3F1LA 1HDGO 1HXHA 1EQ2A 1TB4A 1QP8A 1PL6A 5A06A 4XYLA 4DBZA 2WE8A 2X6TA 4I8XA 3A06A 2W2KA 3HDHA 1QLJA 4KUHA 4WGGA 3ROKA 3I1JA 4JP2A 1E1LA 4YQYA 4GKVA 4BGVA 4BS9A 4MVJA 3TZHA 5DOZA 2UUPA 2O23A 2X0IA 5ILOA 1E3IA 4YJGB 3X2FA 5ICSA 1T26A 5AYVA 1GYPA 1LDMA 1XLTA 2GRAA 2EGHA 3C1OA 3QVTA 1Y81A 3HADA 1Q2XA 1G0NA 4MP8A 1DIAA 4J4TA 2XPCA 1D8AA 1ML3A 1XEAA 1H2BA 1NFRA 1D1TA 4ID9A 1ID1A 4WASA 2LDBA 1HYEA 5A5FA 1GTMA 4BKRA 4PG8A 2DU8A 2XOXA 2ZCUA 5IG2A 4QO7A 1IPEA 1DRVA 2AA3A 2OBNA 4PLCA 4RLSA 5JYEA 2G82A 4E5YA 3M1AA 3LF1A 3IUSA 3ZNPA 4BNVA 9LDBA 1T2AA 3H9QA 3BMOA 5F5NA 7MDHA 2W98A 4GLLA 2VHYA 1PTJA 4NIMA 2B4RO 1LA2A 1HT0A 5EINA 4Y8VA 1QV7A 4INAA 1P1KA 3ETEA 3GAFA 3ONFA 1LRLA 3R3SA 3PYMA 1LEHA 2OP1A 4GGOA 2C2YA 4MVJD 1SC6A 4R01A 1X15A 4AJPA 2EP7A 4JGBA 3DZJA 4EYEA 1YKFA 1CWUA 4BO5A 3NT5A 1I8TA 4U6QA 3UOGA 2I76A 2YYYA 5T8KA 3VKUA 1GYRA 3ZWCA 4PLZA 4CR8A 3F1KA 2X8LA 2Q50A 3GC6A 2YW9A 4M55A 4Q3NA 3JQBA 5MGBA 1ONPA 5L3ZA 2H6EA 4PLGA 2I66A 1XHLA 1AE1A 1P0FA 2PZKA 4RPJA 3CXRA 4YJGA 1DLIA 2YV2A 1TVEA 4R1SA 2VZ8A 5KCZA 3AU8A 3D4PA 1GPJA 1JDJA 3IQDB 4XIJA 4NBVA 3DHEA 3HJAA 1M6HA 1N9GB 2NLOA 4QO8A 1C1DB 4NBWA 3VTFA 1JWAB 4G5HA 1I0ZA 1Y5MA 3TOZA 4AG3A 5DDIP 4CM1A 4OXNA 3Q2IA 4XRRA 1PJLA 3IP3A 1U3UA 3L4SO 4DQVA 3OH8A 5BQFA 2FZEA 3AY3A 1B15A 1I2BA 3AFNA 3HN2A 4RPLA 3SJUA 1JAXA 3LC7O 4HFNA 3N7UA 5L9AA 5KIAA 2HMUA 5FF9A 1WDMA 2ZB4A 2CZCA 4CMHA 2J3IA 4GL4A 4KQWA 3DOOA 1RM5A 4CV3A 2O3UA 2VTDA 2BI8A 2AEFA 2Y1GA 3VZPA 5DZSA 4OGWA 3W1VA 4JIGA 4MDHA 4N5NA 2QZZA 1O5IA 4DXHA 5FI3A 4A7PA 1I2CA 5AXAA 2B4TO 2EERA 1OC4A 5BNFA 4ZGWA 1Y1PA 3RC9A 3ZV6A 4B3HA 4NK5A 4ALNA 3TZKA 4R3WA 5L4LA 4GX1A 3R6DA 4MO2A 3MCVA 2XF8A 2D1YA 1AHHA 1HE5A 1PS0A 4P38A 1H6AA 4CM3A 4CM6A 1NPYA 1B26A 3NGLA 4R1NA 4P4NA 1N7HA 4UUPA 3AY7A 2E82A 1EUCA 4M86A 4DC0A 2DPGA 2JL1A 1NNUA 2FRDA 4K28A 4YRBA 1N9GA 3NDJA 4DQXA 2CDAA 4MVJM 3ONDA 5BNIA 3RC2A 3WB9A 2BH9A 3VH3A 3ANMA 3S55A 3PQFA 2EW2A 8LDHA 1B3RA 1R37A 3EC7A 2RAFA 3GOHA 3PWSA 4ALKA 1E7YA 3K9QO 4U6SA 1IY8A 1PZEA 4IQGA 4RORA 5JY1A 1LSUA 1H9AA 4YCAA 2XAAA 5KJEA 3DBVO 5BSEA 2Q49A 3F4BA 3QY9A 1QKIA 4IXTA 2NQ8A 3FD8A 4WJZA 3D64A 5IDXA 3BAZA 4B4UA 4CUZA 2Q45A 4E4YA 4AL4A 2ZJ1A 3A9WA 4IDAA 3GNQA 1E1KA 5T6BA 4AVYA 3U3XA 4BGIA 1T25A 2VT3A 3HB4X 2P9CA 1HDXA 1GUFA 1SEVA 1RM0A 2FSVA 3FCOA 3JQ9C 4NR0A 4URFA 5K0ZA 4NFYA 3KSZO 1H6BA 1DFHA 4BKUA 1ARZA 3SXPA 1OAAA 2Q1TA 4YTEA 1PJSA 2Y67A 1VE9A 3WNQA 1N92A 2OGUA 4CM8B 3K96A 4NI5A 2VN8A 4HBGA 6ADHA 2DBZA 3ROQA 3Q11A 4RDIA 1LC0A 2WEKA 4Z6KA 3Q2KA 4C4OA 3QE3A 1LDBA 4UUOA 2EKPA 3PI7A 1NHGA 1PGOA 4HX5A 4RPGA 3K8ZA 5U1PA 2OP0A 3WTBA 2OBYA 1J0XO 2E48A 5JNLA 4J91A 4WNIA 2VOEA 1UZNA 1K6XA 4K9DA 1T2DA 5C7OO 5KJFA 3NDRA 2ZB8A 1GZ6A 3I9JA 3NRCA 1OBFO 3LZ6A 4J49A 2B4QA 5F21A 3DBLB 3E5MA 2GDZA 1IOLA 3MZ0A 2QYTA 2W4QA 3K73O 3WXBA 4GH5A 3E1KA 5JC8A 1NR1A 1X13A 5I7SA 1M6WA 1P3DA 2Z1NA 2O3QA 3QP9A 2Y68A 3B6ZA 1YONA 2NM0A 2RH4A 4ZRMA 1M75A 2Y1FA 2HK7A 3DOCA 4BNZA 1N7GA 1XDWA 3GHYA 1DC4A 2D0IA 4R9RA 3DMTA 1PR3A 5KNLA 2IYPA 5H82A 3BHIA 1U3WA 3VOSA 3FNGA 3GN2A 2HKIA 2YFQA 3HG7A 3QHAA 3VPHA 3PZRA 4J4HA 4CM8A 3OA2A 1HDYA 4Y6PA 1E5LA 1L7EA 2WD7B 3QWAA 1RKXA 1R6DA 3R3JA 4Y6RA 3TNLA 4DIFA 4U8GA 2VHZA 1HDZA 1GUZA 4LVCA 5ER6A 1AGNA 4R5MA 4XWYA 5EJ2A 1L1FA 3OSUA 3ROPA 5FWNA 5JCJA 4BO6A 3D3WB 1BSVA 1E7QA 1HRDA 1UDAA 5DF1A 3EAGA 5U9CA 4A5OA 4KTTE 1CF2O 3PDUA 5JBIA 5CEEA 3P2YA 1V3TA 1QG6A 1NQAO 2PLAA 3DBLA 1VPDA 3LQFA 4KUEA 2AE1A 4KP7A 3ZGYA 2IZZA 3GK3A 2FZWA 5IAAA 2PD4A 2JKVA 2I5PO 5EN4A 2RBEA 1BG6A 2X0JA 1S6YA 5TC4A 3WFIA 1U5CA 3A28A 3GVIA 4GVLA 3OJLA 4IQ0A 1GCUA 2DC1A 3WIEA 4XD2A 5IXSA 4LRSB 4DREA 3EUWA 1LLQA 4XYEA 2YDXA 5TF4A 1RYEA 2Q4BA 1SO8A 1P1IA 4O6VA 1IULA 4IPTA 1YDEA 4HV4A 4BNYA 5L7YA 4PLHA 1XQ6A 4H7PA 4HFRA 2Y1EA 1NVGA 2ILTA 4PVDA 3RBXA 1TA4A 1V0JA 1D3AA 3PK0A 1O9BA 4GSKA 2QYSA 4AJ2A 4H3VA 4BO7A 4IGFA 4YAGA 5JCJD 4PFJA 4AJ1A 4CV2A 1F8FA 2WD7A 1U8FO 3V2HA 4BHTA 1BXGB 4IXWA 3UAGA 1TT5B 1FDSA 1MFPA 2PK3A 3HWRA 3WGOA 3WS7A 3ZNOA 3PIIA 4UULA 1CYDA 3I6IA 5LDGA 4NPCA 1UDBA 1ENOA 4PZEA 2VNSA 4YAJA 3PFFA 1JWBB 3GUYA 1U4SA 2I6TA 4J0FA 4FDAA 3W8DA 3AUAA 1E6EA 4EUHA 3D3WA 3QWBA 4B8ZA 4YT2A 1PU2A 4N54A 3WGIA 1U5AA 4GI2A 4M8SA 3BZUA 1SEPA 1FXSA 1K3TA 1XIVA 2CD9A 3GVHA 3JQ7B 2NVWA 4EITA 1MC5A 5A3VA 1B8VA 2HMWA 4XDYA 4HWKA 2GERA 3G17A 4HP8A 1KEUA 2V6GA 2VRBA 1ZK4A 4R51A 4HUJA 2NVBA 1DHRA 3HE3A 4O59O 3KYDB 4Z3KA 3EHEA 3C3XA 4YB8A 1N2SA 3F3SA 2JD2A 3RD5A 3UCFA 3ZWOA 5IXYA 4UVDA 1Z73A 4E2XA 3JD4A 3RWBA 3WICA 4RL6A 1M2WA 1LI4A 1DRUA 4KWHA 1HKUA 4PZDA 1U3TA 2HK9A 1ONNA 1T24A 2AMFA 3I9OA 4YEDA 4BUCA 1EDOA 2JCXA 3JD0A 1XQ1A 4BB6A 4BB5A 1TT5A 4GSLA 1ZEMA 4JBHA 4EJMA 2G5CA 3ZU4A 4FJ2A 3SVTA 2DTEA 3M2TA 4FC6A 1YRLA 3DHNA 4LRTB 4KOAA 2HSDA 2IZ1A 1F17A 3KB6A 4QSMA 1GQQA 3DBRB 5JY6A 1UXHA 3I9KA 1YB4A 3AUUA 4J4BA 3MJTA 3ROMA 3JQ7A 1P31A 1KETA 4LW8A 4Y67A 4ZQBA 1KVSA 4W99A 5IN4A 2C5AA 3DMYA 4XR4A 2D4AA 3ZU3A 4IDFA 3N74A 4DIBA 3SLKA 5TQVA 2GN8A 2P2SA 4GWGA 5A5EA 3AOEC 1E1MA 2CUKA 4Y6SA 1G0OA 3RU7A 2BD0A 4FS3A 4JN6B 2Q3EA 2DFVA 4M54A 4MKRA 2HUNA 3KYDA 3BMQB 4EI2A 2Y0CA 4XYMA 5C3MA 4K6FA 2ZK7A 4ZA2A 3RUIA 3JQAD 5HTOA 2QQ5A 2FHSA 1ADGA 1SB9A 4WLEA 5L7WA 1HDRA 3B20A 1F0YA 3PWKA 1FDWA 4IDCA 3TL3A 2AEMA 1E92A 1P0CA 3GG9A 4QT0A 3ENKA 2WWRA 2G1UA 2ZKLA 4OOEA 4YT4A 2EJWA 4WK6A 4B4OA 3GEDA 4IIUA 5AXCA 3CH6A 3RFVA 3H3FA 2VQ3A 2WDZA 4FFMA 4WCFC 4NBTA 3AM5A 2RH8A 5BNTA 4LISA 2ZATA 1GQYA 1MC4A 3JQFA 1R0LA 2IZ0A 1LU9A 4RPHA 3IKVA 1QYWA 1W4ZA 4J7CA 3GG2A 3FR8A 4UUMA 3GDGA 1WMAA 1YE3A 2X9NA 1LBEA 1EQUA 4R5HA 3EK2A 3HNPA 1YBAA 5JO9A 5THKA 4TZKA 1IZ9A 5JSFA 1A27A 3DBRA 4E31A 1QYVA 2IRWA 3DB2A 2HK8A 3IUPA 3X2EA 4DQUA 4KQXA 5FI5A 5CG1A 1MX3A 1JKJA 2VYVA 4RZIA 1Q7GA 3IS3A 5L4SA 3D5TA 3LC2O 4LMPA 2J5KA 2GCGA 4P4LA 1A4UA 3O4RA 1DFIA 3LDHA 1DSSG 5JE8A 1ZW1A 2OXIA 3NTRA 4CM7A 1H0KA 1PJ4A 3BMQA 1KVRA 3TDKA 3GF4A 3OETA 2CDBA 1XR3A 3JQEA 1ENZA 1YBVA 5I7FA 1I10A 1SPXA 3H9EO 1E0DA 3KOUA 1NR7A 4FSHA 4BGUA 4BNXA 5CAEA 1LQTA 3RROA 4OYRA 3RUFA 1VKNA 4PLPA 4R41A 3ZWXA 3OHSX 4JCOA 5JW6A 4JQCA 4D42A 4BNKA 4IDGA 1Z7BA 3VPSA 4NFHA 1W0CA 2GPTA 2ZQYA 3UHAA 1KIFA 2GN6A 3T4XA 2X22A 3WJAA 2PNFA 3IMFA 4B3IA 4FIZA 2V65A 1DC3A 4UVGA 3VDQA 2D3TA 3K6JA 2AQKA 4PVCA 1PQUA 3T7EA 4Q3AA 3UCEA 4BOYA 4QFDA 4HFMA 1UXJA 3MWEB 2GR9A 3FTPA 3ENNA 3ONEA 2VYVD 2PWZA 1GZ3A 1DIBA 3CSDA 2Q1SA 4OM8A 2O4UX 1A9ZA 4M49A 2PKQO 4CLHA 1ZK0A 3QVXA 2C07A 2B83A 3ZWVA 3IC5A 3ZV4A 3NYWA 2EHDA 4E2WA 2PZMA 1P1RA 4CMJA 3L4BA 3OEWA 4XRGA 1PR9A 3MJSA 5F1PA 3BXXA 4XCVA 1A5ZA 4CR6A 3L6OO 4EGFA 5A1TA 4Z9XA 5CHEA 2G76A 3H8VA 4YYZA 2O2YA 4YAKA 3Q6IA 4KZPA 1VC2A 3C85A 2IEBA 4WEOA 5TT0A 1U7HA 4RF3A 3JQFC 4DMMA 5ITVA 2C0CA 4CMCA 2P91A 3BHJA 4CUJA 4L75A 1U7TA 2RCYA 4BO2A 3VH4A 4CLOB 4GGPA 4E0BA 5IF3A 1GUYA 3UN1A 3VHRA 4RVUA 2AXQA 2EJVA 1GL3A 1O6ZA 3PP8A 1R66A 1C0LA 3GN1A 3O8QB 3V1YA 4BNLA 3FBTA 3AI1A 3ZWYA 2FPPA 2P68A 3FNEA 3PLNA 4DVJA 3EW7A 3ST7A 4I1IA 4J7XA 4OL9A 1U1IA 4BNNA 3KUXA 5JCXA 2XXJA 1VJ0A 1X14A 4GBJA 2CY0A 2CF6A 5L45A 2EWMA 2JD1A 2Q2WA 1ZVMA 4I5DA 1QMGA 4RLHA 3D0OA 4CLXA 5KJ1A 1DC5A 1I3KA 3QW2A 4ZJUA 1U28A 3DOJA 1EK6A 1QR6A 5GY7A 3AI2A 3UW3A 3ZWNA 4XX0A 1ZXBA 2FP4A 4J43A 1WNTA 3KLMX 3R1IA 3D7LA 4YRDA 1W6UA 5H83A 3JTMA 2JAPA 2Q46A 1DAPA 1LRKA 3E82A 3NGXA 4JBGA 1DIGA 3G0OA 4Q39A 2I99A 1P1HA 3RUDA 4I5GA 2Q2QA 1CDOA 2A94A 5KJ6A 2BMAA 4OSPA 1EBUA 2NTNA 2B5WA 1NFFA 5EESA 1LRJA 5CPFA 3V8BA 1B8UA 1WAMA 5JMPA 3NKLA 4NJMB 4O1MA 3PLRA 4ROSA 2X23A 4EDFA 2UYYA 2D5AA 4IDEA 4OQZA 4CUKA 2YQ4A 4NNJA 1E6UA 1HZZA 1E77A 1WXDA 4CLOA 2Z1MA 3RI3A 3KLPX 4OH1A 1ISHA 3ASUA 1HE4A 2P4QA 4AJOA 3L4BC 1VSUA 3V1UA 3O8QA 3NDIA 1PEDA 1BRMA 1C14A 3FHLA 4DMLA 3TJRA 2AG8A 1N1GA 3NTQA 5LC1A 3ANLA 2IODA 1D4FA 1RYDA 2VYNA 4OXKA 4YJDA 1X0XA 2H9IA 3WG9A 3DAGA 1K2WA 3WGZA 3P19A 1YQDA 1KEWA 4WCDA 3ETDA 3SC4A 1R4MB 2Q2VA 4OKIA 3CIFA 3EVNA 5JPIA 4A26A 1C3VA 2PZJA 1X7DA 4PG4A 3WGHA 1DFGA 4DPLA 1MV8A 1ENPA 1V3UA 2FN7A 1YVEI 4ITUA 4FW8A 4RZHA 3VVBA 2OORA 4LSWA 3HZZA 2IXBA 4Q3EA 4BO9A 1K89A 4MPDA 3LU1A 5A9SB 1NTOA 3RFTA 1FK8A 1OMOA 1ISJA 4DC1A 1ADCA 1QYCA 3COSA 3NX4A 3QSGA 2XXBA 1Z45A 5JYDA 2X1HA 1N1EA 1ZO8A 3RBVA 2NU8A 1YJQA 4UREA 4LSMA 5I9NA 3F4LA 2DT5A 4YR9A 5JDIA 2WMDA 4NMHA 1MP0A 4NJMA 3QWHA 5CDYA 3UUWA 4CLDA 4ND3A 1PQPA 1NX6A 3CKYA 2O3RA 3UVEA 2O4CA 1LX6A 3N58A 2VYND 5GMOA 3VPXA 4JLWA 3NT4A 3AWDA 3GZ4A 4PLFA 1HTBA 1XYGA 1ZJYA 2R00A 4M87A 4XJTA 3U62A 1H6DA 3NUGA 3H6KA 2C82A 3AM4A 3F5SA 1H9BA 2VZ9A 4ZQHA 1E7MA 3PHLA 2J8ZA 4O0LA 1MXFA 5L51A 2IEDA 1E7WA 3OIDA 4W7IA 5T64A 1P45A 1MGOA 2W2LA 1UP7A 1C1DA 2HMTA 2E4AA 2VCYA 1AXGA 3WGYA 3UGKA 1Z74A 2UUOA 2DKNA 1R4MA 4HNGA 5TX7A 2NVUB 4UVEA 5T8KC 3KXDA 3OICA 4J2HA 4JBIA 3DO5A 4DIOA 5DCUA 3JQBC 1K6JA 3RKRA 3CZRA 4EJ6A 4XQ9A 1VKOA 4NU6A 3H9UA 5A9SA 1EVZA 1WDKA 1JU9A 1Y9AA 1RM3A 2A35A 3ULKA 3W8EA 3PZBA 4U7WA 4FB5A 2CF5A 5L95A 2PD6A 2VWHA 2AQHA 4AICA 3F6YA 4J7UA 2I3GA 1JTVA 3ADOA 4NBUA 4DUPA 4OAQA 4WECA 5HA5A 3CPSA 2J3JA 1B7GO 1IHXA 4LGVA 3WLFA 4E2ZA 2O3TA 4GWKA 3DXFA 1P33A 3Q9UA 4UVHA 3ZH2A 4WOJA 3HHPA 3Q1LA 3CMCO 3QQPA 4OO3A 1NP3A 2Y99A 4L4SA 1LQUA 2D8AA 2W2LD 4IUYA 2Z5LA 2DBQA 3FSRA 1UUFA 4BO1A 3K30A 4G81A 4QTZA 4PIVA 3PJDA 1BTOA 2OHXA 2ZJ0A 3F9IA 5AXDA 2OOSA 1QORA 1NHWA 1NWHA 2VTEA 1GPDG 2FPIA 2PR2A 1LDGA 4R54A 1FDUA 5MDHA 4AJLA 1Q7CA 4GX0A 1TT7A 3ZWWA 4CLRB 1Z82A 1NXQA 2RHRA 3I4FA 2GZ1A 5IN5A 3ZWAA 4CJXA 4CQLB 2DLDA 4ZRNA 3RJ9A 4BO0A 1NFQA 3M6IA 3U4HA 5CEFA 3TN7A 2QIOA 4CMGA 4BO4A 4MVJE 5G0TA 2NVUA 3ASVA 3FWZA 5DT9A 2BI7A 3O26A 1TLTA 4B7XA 1YJ8A 1R0SA 3EZLA 3AM3A 3VPFA 2C59A 1PJQA 1ZZEA 2EV9A 1YL5A 3WDSA 1GU7A 1LC3A 3LT2A 4L0QA 3V2GA 1H2HA 3JQCA 3ZWMA 2BFOA 3I6QA 4Z0PA 1H6CA 3PTZA 1AXEA 4Z3DA 3MJVA 4KUGA 4QXMA 4XB1A 2W8ZA 4ZU3A 3WYCA 1PGQA 3CTMA 1I30A 3C7DB 3LLSA 4TZTA 1V8BA 3WJ7A 1T2CA 2J3KA 1JKIA 1U4OA 4KDFA 1GYQA 4MJLA 4WPGA 2WD8A 4UAGA 4E2YA 2GF2A 3ITDA 2V7PA 1YQGA 3INGA 1LJ8A 1LSSA 2E49A 3HFGA 3HN7A 3JD1A 3VKVA 2CVZA 4WLOA 3TF5A 2HMVA 1LSOA 3WQSB 4E5KA 3UKOA 3E48A 4P8RA 2ZB7A 1WWKA 2P5YA 2R6JA 3IP1A 4Z0HO 1HSOA 5FEUA 1VM6A 4CODB 5L40A 4PG6A 5TSDA 3GR6A 4NQZA 4W9NA 5TJHA 5CFZA 1IB6A 2CNBA 1NM5A 1BMDA 1I33A 1B14A 3I5MA 2P9EA 4U5QA 4CLRA 5IZCA 4YXFA 3JQ8B 4P4GA 4NBRA 4YVFA 4Z9FA 1ZCJA 5G0WA 4CQLA 3GRKA 5COQA 2X9VA 3GDFA 1NAHA 1G6KA 3KV3O 4YAEA 4D43A 4TROA 2FR0A 4TRJA 3A1NA 3DZKA 1PGNA 1R12A 2CMDA 3DFUA 1R16A 1KS9A 3PJGA 4D3DA 4DL9A 5U4QA 3K2EA 1B0AA 2AG5A 1MA0A 1YB1A 4EBFA 1HWYA 4BMNA 4PGFA 5JDCA 1E7SA 2O3SA 3IKTA 2O50A 3ZHYA 2OO5A 4UVIA 3QVWA 3ZNNA 3ZU5A 3DFZA 1EMDA 1O0SA 1ZMOA 1GADO 5C5IA 2ZCVA 3DTTA 1YS4A 4YT5A 1MUUA 4CMKA 4J1TA 4F45A 3U49A 5IDYA 5AXBA 1DJNA 5CDTA 4E30A 1K5HA 3WWYA 3ZWBA 5F1KA 2DQ4A 1AHIA 2JD0A 1I2ZA 3LF2A 1FDVA 3GNTA 3OECA 4GLOA 4BKQA 3MJEA 4NDNE 5ER9A 5EERA 1XWFA 4YJHB 1QXSA 1ZK2A 1U3VA 1YOVB 4AJIA 4CM9A 2DAPA 3JQAB 4XGNA 5ENDA 1EEHA 1ZH8A 1A4IA 3W4IA 1KEVA 3C1TA 2VWPA 3SJ7A 3BTSA 3KO8A 1KC1A 1P74A 4O5OA 4CMEA 3U5TA 1T1RA 3GMDA 1ZKMA 4FGSA 2H63A 1UXKA 2YY7A 2ZTMA 1KBZA 2I3AA 4D7AA 3GAZA 4KMSA 3I3OA 4PLVA 3JQ8A 3DMTC 2AW5A 3GGOA 3I52A 4FJ1A 4F6CA 1XG5A 2YJZA 4H15A 4XYBA 3O9ZA 3PDJA 3VTZA 1LUAA 2J5RA 3S2FA 3TFQA 5KVSA 1ZMTA 1HDOA 2V6FA 4FOSA 1HF3A 4ALLA 1WDLA 4TVBA 1T4DA 3BIOA 1U9JA 1EUDA 3PPIA 3SC6A 4BKPA 1ZK3A 3ETGA 2YHIB 3WWZA 3QVOA 3AW9A 2FMUA 4R1TA 1IE3A 5B37A 4KWIA 2EG9A 2IDZA 5C7LO 4EW6A 1EFKA 5HRUA 4CM9D 1P1FA 1XGKA 5B4UA 3EYWA 3AUSA 1A71A 5DNAA 1HZJA 2HDHA 1DHTA 2BFPA 2I9PA 4MVJF 5J23A 1R4NB 2AEJA 4Z0TA 1PSDA 2Y66A 4ZQGA 1KVQA 1QYXA 3E9MA 3W6UA 3UCXA 1PL7A 1WVGA 1K6IA 4YJHA 1YL6A 2VNAA 1TI7A 1YOVA 4PCVA 3F47A 5T5QA 1KY5A 3JQAA 4MIYA 2O7QA 1BVUA 5C7IO 4Q3BA 3TQHA 5JDCC 1K0UA 4GX2A 6LDHA 1KVUA 1YL7A 3PVZA 4XIYA 1BXGA 3KZVA 3ON5A 4CL3A 2HAEA 2EXXA 5AVOA 1NASA 5CDSA 4KTVE 3DZHA 4N5MA 3QVSA 3L07A 4EUFA 5GZ1A 5IFLA 4Q3DA 1JVSA 5TRTA 4F6LA 1E3WB 2P4HX 2QG4A 5AOVA 1HE2A 2DVMA 4D41A 3G1UA 4XGIA 1PWZA 3KSDO 3MOIA 4DLLA 1NVTA 3PQDA 1WLYA 1SOVA 1CETA 1V6AA 4II3A 3KTDA 3OFSA 3U4IA 5TIIA 3WX0A 4IDBA 3QA9A 3AJRA 2YHIA 4E13A 4L8VA 3UICA 4GMFA 3HFSA 1BW9B 4PG7A 4UEJA 3Q0EA 2VHVA 3DHYA 4BQPA 2V6MA 1DRWA 3MTJA 4WUVA 5A3JA 4RF4A 2Y0EA 4JX8A 5TT1A 1R4NA 4DTIA 1ONOA 1ZK1A 1C0PA 4D3FA 1RPNA 3IL2A 2BFAA 2R2GA 2YZ7A 4FFPA 1Z6ZA 4OKNA 1ULSA 2ZYAA 5KVQA 3B1JA 1UP6A 4CL8A 1WZEA 5CDUA 1ADBA 3KETA 1WP4A 4E5MA 3GEGA 3H7AA 3OA0A 4JXKA 5ES3A 4MVJI 1UAGA 2B0JA 1VJTA 2D59A 3FPLA 3ZV5A 1ZXLA 1Y8RB 4B7UA 1E3WA 3RFXA 1VSVA 1DIHA 4I5FA 1RM4A 4WNCA 3H5RA 2YV1A 4MIEA 3EZYA 5THQA 1PL8A 4U0KA 1X1EA 2W90A 3L6EA 1JAYA 3PEFA 1NVMB 1A7AA 4GMGA 3PHGA 3L9WA 3TL2A 4BMSA 1L7DA 1PIWA 4RVHA 5KKCA 3U4CA 1A72A 2HLPA 3LVFO 4R3NA 1I32A 4RO0A 3UXYA 2P9GA 1BXZA 2PGDA 4Y9DA 4ALIA 5JS6A 1BW9A 1PQWA 1DLJA 1GDHA 2HRZA 5BSFA 3BMCB 2EGGA 3C24A 1Y6JA 1ISGA 4K6CA 2GO1A 1H94A 4BNFA 1ISIA 4WE3A 4LCJA 1KERA 3H2ZA 3PIDA 2B37A 2JFFA 2DBRA 1KY4A 4IQ8A 2NACA 4ZHSA 1QRRA 3H9GA 1E6WA 1E7RA 1JA9A 4I9NA 3S2GA 2AQIA 2HRBA 3EDMA 1BXKA 2PFGA 4UUNA 1GV1A 5B1YA 4MIOA 3KBOA 2O3JA 1VL6A 3ZHZA 5LCXA 3IAHA 1SAYA 1QV6A 4ND5A 3RASA 1ENYA 1GAEO 1F12A 2BHLA 5TNXA 3FTNA 4IM7A 4BNGA 2B5VA 1ZEJA 4YA6A 1MB4A 3ADPA 4B3JA 2JJYA 1EE9A 3AI3A 3R0IA 5G4KB 3ZNQA 1VL0A 3SEFA 4E21A 1OI7A 2C7GA 3OIGA 1VJ1A 1Y8RA 4RF2A 3EY4A 2DUWA 3K5PA 1F14A 1I5RA 2ZQZA 4RQTA 1WW8A 4CV0A 2WSBA 5DBIA 3PFWO 5JO0A 2ZYDA 1XCBA 2VRCA 2EIHA 4JROA 3RQSA 3QWFA 1ZFNA 5IDWA 2JCYA 4A2CA 2B35A 4J3FA 4D44A 1C0KA 3O03A 3WIDA 5B4TA 2A92A 2X58A 4IMRA 5CDGA 4G65A 3NJ4A 1V35A 2WYVA 4AFNA 2BRUA 4EJ0A 2WJPA 3BMCA 4YJFB 4IINA 1OZAA 3QIVA 3VH2A 4L9RA 1VRWA 1Q0LA 5DOVA 3QV1A 2PD3A 2VZ0A 4HY3A 5GZ6A 3RKUA 5L4NA 3LK7A 2X5JO 1UZLA 1I3NA 2PA3A 3JYPA 2UV8A 3TSCA 3JYNA 3RUHA 2FR8A 3G79A 3FPCA 1UH5A 5JMWA 4ND4A 4P22A 4TMFA 3QLJA 3U09A 3OJOA 4DYDA 1YQXA 3MTGA 4RV9A 1WPQA 1UDCA 4TKMA 1I3MA 4RCVA 1EVJA 4FC7A 5HS4A 2BFMA 3QRWA 5IDQA 3DC2A 3KYCB 1CIVA 4DGSA 4WLUA 4PZCA 3RJ5A 2Q99A 4H16A 2VRCD 2X9GA 3I4CA 5G4KA 4CMIB 5A03A 3VDRA 1A7KA 4JNKA 1IHYA 1LNQA 4XDZA 2NV6A 3DZBA 1PS9A 3E5RA 3GQVA 2J6IA 1E3SA 5DCYA 5I9LA 3AY6A 4D46A 2GLXA 4OXYA 3LSYA 1GD1O 3CEAA 4GQAA 3ZN2A 3VZSA 2DM6A 4YPOA 3CINA 3LC1O 5LDHA 3WSWA 4MVJP 3I83A 3LLVA 2FR1A 4IGEA 2H5LA 5FYDA 3PYXA 1TXGA 4FFRA 1N8KA 4U0JA 4CMAA 3O38A 4OQYA 4DWVA 3NAQA 4YJFA 3WGTA 5B12A 4N7RA 3JSAA 1DXYA 5A9RA 5TGDA 1Q0QA 4C7KA 2OL4A 4MOWA 1P44A 1CERA 4Y98A 4A10A 3E9QA 3HB5X 5A4DA 4YWJA 3RBZA 5G2OA 3HDYA 4WLNA 1HEUA 1XELA 3OF2A 1EUZA 2P5UA 1IZ0A 2NSDA 1LSJA 4NHEA 4DLAA 1B2LA 5ILGA 5FFFA 4D0SA 5KTKA 1ADFA 4WKGA 2ZB3A 3IOYA 3MOGA 4I08A 1SB8A 4YAIA 2WYWA 1UZMA 1DDOA 2JCVA 3E03A 4GKBA 3TOXA 3U9LA 3JQ6A 3KYCA 4ALJA 1O95A 1HYHA 1G1AA 2Y05A 4D0RA 4F3YA 3JD2A 3RCBA 2V6BA 2ZIZA 4CMIA 3ZW8A 3GHHA 3WTCA 3I9LA 1J5PA 1J6UA 4A03A 2B69A 1JKFA 4O63O 4IY1A 1EFLA 1ZSYA 2Q4EA 2Y1OA 3H3JA 4J0EA 3SX2A 4BKOA 1YBMA 3G1TA 4BV8A 4CMBA 3JQ9A 3KEOA 3RUEA 3IJPA 4FQ8A 4I5EA 3K92A 3GPIA 5CP8A 4QQRA 3DEYX 4HNHA 3C7CB 4XKJA 2F1KA 4J1NA 4J1QA 1D1SA 2BGKA 4FBGA 1BDBA 1XKQA 4BMVA 4RJTA 2C54A 4E6PA 1ZBQA 2TMDA 3OMLA 1KYQA 1VL8A 4EZBA 3EMKA 1GZ4A 1IUKA 1JW9B 4A27A 3BYZA 1T4BA 3JQGB 3K31A 2VUTA 4FD3A 4IZIA 4BV9A 5HWSA 2CFCA 1CRWG 4PLWA 1SOWA 3NJ8A 1EK5A 4HKTA 1I3LA 4CV1A 5BSHA 1SNYA 3GT0A 2PV7A 3H9JA 3WYBA 1HYGA 3MEQA 1PJCA 5T67A 1O8CA 4D45A 3NT2A 4OMUA 1CJCA 1XA0A 2PY6A
chains in the Genus database with same CATH superfamily
1C7JA 1OTXA 3C8MA 2PWYA 1BEZA 5TGZA 3ZWPA 1MT0A 2RH9B 4GQBA 4G5RA 3D5EA 1SULA 2AV6A 4UU8A 3K5HA 2WJJA 4Y30A 3UMFA 4BV3A 3KQPA 1GGHA 5M7EA 2FYTA 2XHZA 2QZ9A 3V4PB 2I4LA 1X80A 2G9ZA 2IXAA 4F84A 3CRNA 1KZYC 4GHWA 4O2LA 4PR3A 4E33A 1DIRA 3ZI0A 1NUQA 2FE4A 1XROA 2HQOA 2EX0A 4JJEA 3O4VA 2BLLA 2RAVA 2VJMB 3W7VA 4CM4B 1EP1B 3A4NA 4FGLA 4JJGA 4FYMA 1DPGA 4KQGA 3L7KA 4DOMA 1RYZA 2E87A 5DO9A 1U2DA 3RVPA 4NAHA 2PU7A 2Q5LA 1SZJG 3EPRA 3T15A 3MW8A 2O54A 2VNHA 1TEHA 1E0AA 4G0UA 1SHLA 1JJVA 3LA6A 1JX6A 5DTMA 4KC0A 3BOSA 2PH7A 1X70A 5ADWA 3G2JA 3CNHA 5AESA 3JWJA 2OBBA 2GAOA 3N5KA 1A5BB 2OZLA 3UFXA 1U81A 1FYWA 4TVOA 3TSOA 3WL8A 4TKLA 3TWOA 4RIFA 5E6SB 5EGSA 1E1QA 5DP2A 4GLJA 1P8AA 1P2TA 3LT1A 3RK1A 2OYSA 1MC8A 2J9ZB 3BD9A 4HEJA 4ER0A 4H2DA 3DL7A 1HT2E 1CY1A 1W5SA 1KSJA 2IUFA 1KMCA 2ZJYA 1UWCA 1MC1A 2YX1A 3A1EA 3NEJA 3VR5H 2VZEA 4L9AA 2EJTA 1Z6GA 9LDTA 3SG0A 3SIPA 2DECA 4HN4B 1BEUB 4N76A 4CEJA 2FEXA 1CQIB 5IMSA 4MZDA 1KAHA 4NXMB 2GNOA 3DONA 3MWDB 4D3SA 3OURA 4II2A 4AJKA 2E4UA 5AK6A 2O9JA 1R9JA 4FGKA 4HATA 3WP1B 1NLZA 4D9NA 4C89A 4RSMA 2H92A 4RF5A 3KPJA 2VJPA 1V9LA 4F1WA 5JDIC 2IUEA 3GCWA 3IQFA 4RQUA 2QV7A 1FUIA 3DZFA 4NENB 2PWBA 2V5UA 1XQYA 4AYXA 1B6GA 1EWKA 3LOUA 4ZCLA 2R8BA 1LDNA 2WYUA 4LCEA 4NS4A 4TMVA 4BVBA 2NADA 2QMQA 3CBGA 2JRCA 2V8BA 3Q5DA 1G3RA 1D4AA 1UJ5A 4R1UA 2V4UA 3CE6A 2FPGB 2XB4A 2GN4A 1FJ2A 1J06A 2Z2JA 1OLSB 1XAJA 2HJWA 2LW7A 4H7EA 3R5FA 2NZ8A 5BMVB 2FP3A 2PPLA 3K0FA 5ALUA 4GPD1 3EVGA 4MVJH 4C9BA 5J1SB 5CA0F 2O0LA 1Q6ZA 4S1VA 3ZQ4A 5C1BA 2ZYHA 4BNUA 1E6KA 3BHMA 1U63A 3HQ4O 4Z4GA 2XDAA 1WU8A 3GLKA 1Y4UA 1MG0A 5EL0A 3QE2A 3VH2A 4ZGBA 4Q9NA 4BO8A 3IBGA 3AYZB 1JI0A 3GVPA 1R9MA 1J0DA 1AF7A 1YBHA 3S1LA 3H4TA 5I9MA 4ZVVA 2X0RA 5GOTA 4DLBA 3EVTA 3OLZA 2PXHA 2IPLA 3BK7A 1GCOA 4LWOA 2JLBA 4QLAA 5H9WA 1ZN9A 1MJNA 5FL3A 3UG7A 4BQFA 2J5QA 4HAWA 4OHUA 2Y93A 3NS7A 1EBFA 5B1IA 1AUVA 1ORRA 2J6HA 2Q1UA 4W1RA 5KVVA 3OQJA 1MXHA 3CUKA 3HY6A 3H84A 3I6YA 3O4IA 5G0UA 1XP5A 2TS1A 3L0DA 1PLKA 1E1YA 2C8LA 1VG0B 4KSCA 3W5UA 4YRZA 4JEMA 2DTXA 4CKBA 2CFOA 3FZQA 3OY7A 3SKVA 2G0TA 1OT3A 4GAEA 3H1PA 4PPYA 3N8GA 2DFDA 2WIBA 3N6VA 3PR1A 1BWSA 2XMGA 4L73A 2CXSA 4JJFA 5I48A 1NZDA 4W4TA 4A36A 4BNJA 5FUMA 4I4CA 4Z7NB 5JALA 1P39A 1PJBA 2QL7A 2E5WA 3LH5A 3ZVNA 4NL4H 5B4VA 2I6GA 1AGXA 1KI8A 3DUFB 3HB1A 3IKJA 3HWSA 2O1EA 1IZZA 3W2EA 1J4AA 2AB0A 3PC6A 4AMGA 5HZHA 4ON9A 1HDEA 3MJCA 4L2IB 5FTNA 2WWHA 2GYYA 3FCAA 2D74A 3GEIA 2I65A 3A05A 3DHVA 5KTNA 2PM8A 3FAZA 3EG5A 2XY4A 1PWEA 4MA5A 1DRKA 1S2OA 2PZBA 3LW8A 1UK7A 1T9CA 2JI7A 3Q98A 4QJ3A 1TQ8A 5CVUA 4EY3A 4TT8A 3RE1A 1W30A 4G0WA 4TQAA 5F5LA 2LBPA 5GONB 2FZVA 2QB5A 4O2AA 3DLCA 1N6IA 3FRJA 2CLKB 4WKOA 1JXOA 4YRQA 1QTNA 2IC5A 2I7DA 2MT9A 2P9JA 4H4EA 3RC7A 2VUSA 3I5AA 1RAFA 4E94A 4HXEB 3GFRA 4E6EA 2DY0A 3HL0A 4MROA 3PD7A 4BX9A 5HIAA 4GVXA 1S7CA 1HORA 4S3MA 1PZXA 4BNWA 3S8EA 1JYSA 1KAMA 4P3OA 2OZEA 4CPDA 3FNFA 4MA4A 3IB3A 3C5EA 4ESEA 1BCRB 1CUXA 1Q0HA 3AR9A 1WMEA 2C0QA 1RJ9A 2MMCA 3FOAA 5EMNA 3QV2A 4XJSA 4KKVA 4C0SA 3C3EA 3KVNA 3JYLA 2YWCA 5TPZD 4G1VA 5BQ5A 2R1VB 2EFCB 4IS3A 2WM3A 5ALJA 3KD2A 3GJTA 1N2GA 4QU5A 3ESQA 3ROGA 4CQMA 1X2BA 1DKUA 1UXIA 2IT1A 3B1KA 4U7HA 2VPWA 1QNLA 2BBWA 2Q8PA 1Q1ZA 2HA5A 4NE9A 3RS5A 2Q28A 4HAIA 3OCCA 1PLLA 3PGJA 2LCQA 2IZOA 1N25A 2JRLA 4NVRA 2ATEA 2PMKA 3B9QA 5H68A 2NYVA 3JCZA 4W7HA 4F4JA 2IKQA 2WF8A 3FYUA 4BNIA 3NDPA 3LW7A 3HABA 3QXSA 4PHCA 3FFWA 1J7JA 3LKVA 1TLFA 3B36A 3HUDA 3GGSA 4YV0A 1NJSA 2RARA 1GNLA 2J4DA 4U9IS 1KOFA 2O2CA 2ZOSA 4ESHA 2JFHA 3FI9A 3KUKA 3RYCA 4FDVA 2QRQA 2X5OA 3AK4A 1YD7A 5CBKA 3VZQA 3AUTA 5LYJB 3Q3CA 5L6LB 1WUTA 1UP4A 2QHXA 1HX7A 3WGGA 1B1AA 1ML4A 1TF7A 1UR5A 1C1XB 1SUCA 2JFBA 3ACBA 3DT6A 4G41A 4MVJG 4P3XA 1W9HA 4CT4B 1BOFA 3MCZA 3RC8A 1NM5C 1GZUA 2EVWX 3HU2A 1PNQA 3NVMB 1QIGA 1XSEA 1YWGO 4ROTA 3HPRA 3TLGA 1RKVA 1SBTA 1WZ2A 1D1PA 3DM5A 3E9NA 4WCFA 2IHJA 1Z0ZA 3NBUA 3NHFA 2OFPA 3ZYCA 4MAAA 4Z99A 2A14A 1WM1A 3BIWA 4PSCA 4QTXA 4Z9YA 2C2OA 4WEQA 1I7QB 4LN1A 1P2DA 1XU7A 3AC0A 5HF5A 5LQKA 1NBAA 4RQBA 5DYNA 1R8QA 4S35A 5HTKA 2L18A 2FX3A 3JYQA 4O4LA 5BSGA 2N9UA 1AN9A 1A98A 3G02A 4TRMA 3FPAA 2JHFA 4QUKA 4EGCB 1ZJZA 4EIWA 4BDTA 1D4OA 1BGVA 2GTIA 3KDSE 3RYHA 4MVWA 5JI3E 2C99A 4FKZA 4DMKA 3WFJA 1O94A 1N2CA 2NO9A 4BCBA 1A9XA 3EIQA 1OH6A 1WMBA 3PC7A 2YVLA 1OA0A 3B1FA 2F3SA 4KXYA 3C41J 3CH7A 2QUHA 4KR2A 4NV3A 1YIAA 3DMPA 3GVXA 2VXYA 4LC9A 1DAGA 3K2BA 1U7XA 3TVYA 3SJBA 3BMNA 1W25A 4XGKA 3E18A 5ENZA 5BWLA 3AESA 1VYHA 5G40A 3F5QA 2CBXA 2OUIA 2ZSJA 4RVDA 2X7HA 3AR2A 1XJCA 3IDSA 4O08A 1MB2A 1YJXA 2BEKA 3QEKA 4HX2A 1OQAA 3I8SA 4RTRA 4HGYA 4JBWA 4FR5A 4UDOA 5AWFC 2WPDA 3RADC 2JLZA 2PGOA 2R7KA 3TI9A 1KO8A 3G49A 4KPUB 1JU4A 5GV7A 4QXOA 2NU7B 1QPBA 3DBHB 3RHFA 3VC7A 1S8AA 1WV0A 3N0TA 4NMXB 3VZRA 2KJQA 1KYZA 4DMRA 3ZCXA 3DLTA 3EGDA 4OM7A 1DB3A 3DNMA 3FY4A 4JH0A 1F06A 2XZPA 4RZXA 4E7PA 2PDAA 1SBZA 2G1KA 4H59A 4RIIA 1QIEA 4ZZ3A 2C31A 5DYTA 4YJ2F 2C4TA 2CE2X 4BFWA 3GJQA 2X76A 3D54D 2GQ0A 4IJ5A 4LXGA 4MEJA 4Q19A 1DCTA 1N4DA 5JJBA 3L0OA 2GAAA 2P79A 3EMVA 2GZ3A 3OD5A 4ILEA 1OWMA 3SSNA 3K32A 1RJWA 1SXJB 2R6CA 4ZO7A 3CR3C 4TLCA 1AC5A 4AKSA 4MDFA 1THGA 5ICEA 5CT5A 2V1XA 1JEEA 1TK2A 3ME5A 3CX7A 4XR9A 1X8JA 3RU3A 4EUEA 5DI3B 5T3UA 3OG9A 3A8TA 1U8YA 1DKRA 1SUSA 2AJTA 2FNAA 5C3UA 4OHOA 1FYEA 2ZJZA 1EVYA 1H0HA 5D00A 2NX2A 3DE7X 4QJ5A 3WLRA 2ZSIA 4DPMA 4CEJB 3JD3A 3AVYA 3AHHA 3OKFA 2C1XA 2OLKA 1JHPA 3DPIA 1EVIA 3KKKA 2BZGA 4QYSA 2D6FA 3QI7A 1VLLA 3NC1C 3FYDA 3KOYA 3R4CA 3C8DA 4FI3F 5H81A 4YP7A 5LD2B 4QU8A 2C5LA 2PH3A 4GXRA 2Q7DA 4ONEA 4ABYA 1J90A 2IVZA 1VRCA 1NRXA 3G1WA 4I2NA 4AJ4A 5ADVA 2YYAA 2ZTLA 3O91A 3I76A 3TKAA 2A4KA 3R6TA 3GMIA 4UBMA 3QFCA 2W5UA 4OEHA 4RAQA 2EW8A 4DIUA 1Z5OA 2J9YB 1F2VA 3L18A 4IXDA 1I1OA 2PZLA 2XITA 3NTUA 1QVZA 2VJLA 3EEOA 1OV4A 4C0LA 3DC7A 2ABWA 4R8LA 4PYQA 5J4YA 2XWQA 3L7JA 4KE7A 5E6UB 4TS3A 2GMWA 4WA8A 3WLLA 3ORFA 4F46A 2G7MC 3HS3A 2YHUA 1ANKA 2ZAMA 1M7HA 3SFZA 5KKNB 4WINA 4I81A 2O0HA 3FPKA 2NQTA 1VI2A 1JG4A 1XA3A 4FE3A 4IIDA 4LVOA 2I8AA 1A88A 4WJKB 5EY5B 3RC1A 5CFLA 1X8KA 3QYAA 2GTPA 2C42A 5JAZA 5LP6B 3FH0A 1DBQA 3JAWB 1M66A 1RWBA 1U8XX 4FUQA 1OWPA 1RPAA 4M60A 4MS3A 5FAXA 5KSWB 1SD2A 4ND2A 4B45A 4W5TA 1BJTA 3L7IA 1PFUA 3ANNA 2P8SA 4A73A 4B7ZA 3L6DA 5J2TA 4NAUA 3QWIA 1GTRA 4BX0A 4DRXB 1IDOA 5FOQA 3K0KA 1PGJA 3DZIA 5KAPA 3GFGA 3ZDRA 1KKMA 1P5ZB 3N87A 2JFVA 3CF4G 2P2DA 3ZQKA 4C4AA 1L5WA 4F21A 2BM9A 3ABIA 5L3QA 4LQ4A 3FYTA 2PANA 4EFMA 3KDAA 4KRYA 3AXTA 2HQ1A 3UC5A 5HS6A 4BEJA 1J1IA 4HYQA 2XDQA 2HDOA 4H1HA 5KTPA 2B34A 1KOLA 3O94A 4J16A 3QOFA 4AO8A 1T1EA 2ERCA 1EH5A 5KOIA 4F5ZA 3OLWA 1GV0A 2GILA 2IYRA 2E4VA 4PCUA 2GFQA 5FBHA 1EWRA 3HDJA 4TXLA 5IKMA 3NHMA 1CEYA 5HJEA 2VOJA 1CVLA 3I9NA 5HK8A 2FWJA 5EC8A 2CC2A 1L4LA 3O0TA 4YRJA 4ZEVA 4C0KA 3AOGA 5G0VA 1E62A 3RYTC 2NAPA 1X7ZA 2DPHA 3FNQA 4NSNA 4Q15A 4YI3A 3WR5A 1AMNA 2FZGA 3PCXA 2DHDA 2ENWA 3B13B 4MV7A 3RSHA 4P83A 2YJNA 3GPDG 3LXUX 4RJLA 1B2RA 1NBEA 1NULA 2H48A 3AJDA 4MGYR 3A6PC 2P9ZA 3V3TA 2ISSD 2X8WA 3CUYA 1U0EA 3PC3A 4ZN6A 2RHTA 4Y1EA 3UH1A 5FOVA 3ODGA 4D81A 1N2HA 1R15A 5BT9A 1EXWA 1NUAA 1USUA 2ZWIA 3W4KA 2JLSA 1QZZA 1M6EX 3LT4A 2NAFA 3SHTA 3GD5A 5IYZA 3QPWA 5DN6D 3U7FB 1XXLA 3BMOB 4MULA 5DXFA 3AR7A 2GGSA 2C4NA 3IPAA 1EXDA 4NYJQ 2IU0A 5I8WA 3P2OA 3RHTA 4KXMA 1C9KA 3Q7TA 5F1OA 3ELDA 3THXA 3ASYA 1QHFA 1GGMA 1FB5A 2QQ0A 1CQJA 5AUQA 1J49A 1TKCA 4BJ6A 3UW1A 4ZI7B 1Z5NA 5EWLA 5JNVA 3HV0A 1D2EA 2QPOA 3NIGB 3GXBA 1JLRA 3C8ZA 3K1AB 2HCTA 1C7FA 5CLGA 5CX4A 2YWJA 3DDNA 1AMUA 2AI3A 3WAKA 1NQ5A 4X85A 3DXZA 5EIWA 4AWBA 4WXMA 5F76A 4A8TA 1X86B 2QI9C 3I2JA 3LPNA 5F9HA 2FPWA 3PE6A 5A06A 1S3FA 4C5CA 2ZB2A 2XEDA 3FM9A 3R75A 3HDHA 3N59A 3WK9A 2VJQA 1IG3A 4XIGS 4Q01A 2FWBA 2ADFA 4RANA 4YQYA 1AIPA 4GKVA 4AD8A 4X66B 3AVXA 3TZHA 3V1LA 4MI1A 3LTEA 3IERA 2X0IA 3EISA 3OIWA 1L4YA 2PZGA 2ZWOA 1BDHA 3RVMA 1XLTA 4Q3KA 1KEZA 1Q21A 2IZ6A 2GK7A 4MIKA 3WIVA 1WX1A 3C1OA 1GAJA 3UAXA 4YNBA 5JMOA 1G0NA 5D85A 4NEGA 1YNSA 1GKIA 2HPHA 2JARA 3GLVA 3UJ3X 2Y6VA 1THTA 4Y2HA 1RABA 5K3FB 1A2BA 5DIFA 1KYXA 1XEAA 1OILA 3DE4X 4ID9A 3K5IA 3T7IA 1HA3A 1AHPA 5TQ0A 2OA0A 2HA2A 1YS1X 3BE8A 2DU8A 3L6BA 1SXJC 4W5NA 1L8LA 2P40A 1OU0A 2IYTA 1DRVA 5IC5A 2AA3A 4HDMA 2G82A 3BDAA 2Z8ZA 1ODCA 2HCJB 3BQMB 2NUBA 3LF1A 4ZEWA 2I8LA 3H9QA 3WB2A 4TMTA 3WYGA 2IW3A 5F5NA 7MDHA 1N0UA 4YXWD 2GBPA 2W98A 3R5HA 1XDGA 1JPUA 2V55B 2VHYA 3NC0C 1E2IA 3HCCA 4B5LA 2R84A 4J8PA 2W2VA 1S02A 4FBMA 1QV7A 1Q0RA 3BICA 1M34E 1V39A 2B82A 1H2FA 2QAGC 4KLNA 4X20A 4EHHA 1LRLA 4M3NA 5JSHA 5LD2C 1T6YA 2A0WA 2QENA 2C2YA 1DUSA 3QVMA 4MVJD 2OV6A 3ZGOA 1T91A 4D4GA 5KQLA 1W0JD 1X15A 1PSZA 4AJPA 1JT9A 5C35A 3L7YA 5BR8B 5IG2A 3DZJA 1CWUA 2DPMA 4WNYA 2CNWA 1I8TA 3UA4A 4DGQA 2QMZA 5E38A 2YYYA 5T8KA 3UOGA 4C5AA 4URVR 1GYRA 1I0LA 2WLTA 2IV3A 4JJ4A 4EY6A 3KSBC 3JQBA 1ONPA 3OMWA 1KFJB 2P4EA 2I66A 5AP9A 4QARA 1JMKC 1J22A 2PZKA 1GPMA 4L0CA 4QHTA 5JH7B 2KQUA 4TYNA 2BRUC 1DLIA 2WICA 2YV2A 1TVEA 4PSUA 1RKQA 1RCTE 4A6PA 2VZ8A 4LBVA 3GQBB 5KCZA 5EKUA 1YUNA 2NO0A 4XIJA 1PSWA 4QO8A 1EAMA 4O2BA 2PYDA 4DSAA 2Q5FA 4L3OA 2KE5A 4RZSA 1I0ZA 2DQYA 5EWJB 5DDIP 1L4NA 4F3TA 3A6ZA 2KSQA 2F17A 1N2ZA 1YR9A 3G2IA 2GESA 2P27A 2LKDA 2UZAA 2QEQA 4CEHB 3H87A 3AFNA 2E7ZA 3Q8WA 2AOWA 3BH6A 4YALA 1MAWA 4KRGA 3LC7O 4YREA 3N7UA 2A67A 2GVDC 5FF9A 4KU4A 1WVMA 3QLUC 4UXIA 1Q0UA 1MH1A 1LQ2A 1V8ZA 4B40A 4EHAA 4GPIB 4R1OA 4F2WA 2VPZA 3O2QB 4US2R 4V39A 1QE0A 5DHSA 2D7DA 5M04A 2HQRA 1UKVY 2GJ9A 2W83A 5DNDA 3MTAA 2AEFA 5ALZA 3ASZA 3VZPA 5DZSA 3DOEA 4XH9B 1RFGE 3MLBA 4JIGA 4LHXA 4OD0A 1DAFA 1M74A 2FSHA 3HXLA 5BSTA 1O5IA 4A7PA 2H4YA 2OGTA 1HTTA 3T9BA 4EHDA 1Y1PA 2QTHA 3F7NA 3RC9A 5E7QA 1QE3A 1VL5A 1M2HA 2F1RA 4B3HA 2R4QA 3TZKA 5L4LA 1RRKA 1O54A 1SM4A 3G2NA 4OREX 1DZ3A 3CTPA 1OX4A 4OMDA 2ZM6B 2X4DA 1QQBA 1AHHA 1PS0A 4R0MA 1JP7A 3PT5A 2AMJA 3QLVC 1TJNA 1L6IA 3FUXA 4BYGA 4CM3A 1V95A 2Q41A 1V48A 2PSJA 1XVIA 4JJZA 2H7YA 3NGLA 3HO1A 2QXYA 2RC6A 4DAOA 4AMUA 1B43A 1FCJA 3HMKA 3W6PA 3WB1A 3AY7A 4C01A 2PG3A 2GEVA 1NNUA 2YS6A 4K28A 3GJ8A 4MGIR 1Q11A 2H59A 3WHIA 3W9BA 2Z2ZA 2NG1A 4OCZA 4Q4CA 2CFRA 3JARB 4JU9A 5BWMA 1FE8A 5KTOA 1CRZA 1ZD8A 4LHYA 3SYLA 4PCLA 1EVEA 1PW7A 3WB9A 4RSHA 1KO5A 2FE1A 1CEXA 3LKZA 5DV9A 3IAFA 4EO9A 2CJWA 2QP4A 1B3RA 2BE7A 3D3NA 3EC7A 3QVLA 3X1KA 2VH5R 1E7YA 2UYQA 4U6SA 2O8BB 5CT6A 1PK9A 3FSGA 1IY8A 2AFHE 2R4UA 3I1FA 4OA8A 5GOZA 3TH5A 3X44A 1O6GA 2CDNA 1G19A 2VAXA 3RK0A 2RCNA 4IQGA 1LSUA 3LX6A 1IUNA 1XMSA 1QHHB 4YH1A 2XWBF 1D8TA 4UCQA 5K6TA 5FJIA 4P58A 3Q72A 1RPJA 3UO8B 4BFYA 4CWAA 1ZNZA 4DG8A 1BFUA 1SUWA 3GPBA 2XAAA 5KYWB 1K27A 1CCWA 4D0GA 4NCKA 3FKSD 1FJGB 3F4BA 1C0EA 2P1RA 1QKIA 1WXXA 3E8MA 2NQ8A 4JJ7A 4JJ6A 2M6LA 2Y77A 3H4MA 5DI9A 3M0EA 3ZX5A 3BAZA 4CUZA 3EVBA 1NW7A 1HOTA 3A9WA 3IP9A 1JJ7A 1P6UA 1TDJA 2D0DA 4PAWA 5T6BA 5K45A 4YDQA 1MENA 1PFWA 1XAIA 2VT3A 4XX1A 2XKBA 2P9CA 4CG0A 5K0ZA 4URFA 1W76A 4LECA 3FCOA 4KQ2A 2XYQA 4Q7EA 4HUTA 2NMVA 3EB9A 1STOA 3N0RA 4NFYA 4YLGA 5DYIA 1DFHA 3DV2A 4IOJA 3SXPA 2R5WA 1F2UB 1G21B 2H2DA 2NT3A 2Y67A 4Q1FA 3WLSA 2AYYA 4D1YA 1T8TA 2ZT6A 4YP9A 3HJTA 5BT8A 6ADHA 3OM0A 4LPKA 4N0QA 1US8B 2ZGVA 2HB6A 2YZKA 2OYRA 4FMDF 1M2VA 1LDBA 5HMMA 1SHZA 2JASA 2QG6A 2EATA 3EGXB 1NHGA 3A6LA 3PI7A 5EHGA 5TV2A 4BRZA 1FZQA 3KQQA 5B2EA 2EYUA 5U1PA 1SHTX 2OP0A 2W6JD 4ZT2A 3WTBA 5FPHA 1R8XA 2VK2A 3GUUA 4JGIA 2NZUG 4Z8YA 2CK3A 3HJBA 5T4EA 2PJDA 1FQJA 3DP7A 1OASA 3NDRA 1K92A 5IMBA 5JAHA 4AKIA 1VL2A 3W77A 1XVUA 3HU5A 4DLYA 1KIMA 4KMOA 1OBFO 2FW9A 4J49A 5AVYA 1A1SA 5F7OA 1IZ7A 3ZJUA 4GMXA 5FB3A 1TIKA 1NW9B 2YCBA 2ZI6A 1TCCA 1XU4A 2B99A 2R1TA 4QYIB 3K73O 2W4QA 3WXBA 1JHVA 4CTOA 5LIRA 4BATA 4CKCB 5FULA 1EFVA 1QTIA 1C8VB 3I2GA 3THOA 1SWWA 2OB2A 4HDKB 4KRXA 3EY9A 3ZKAA 5I7SA 4L1KA 2BM0A 4BB0A 2REQA 1M6WA 5KQMA 1GXSA 2R68A 2E18A 2E85A 4F6RB 5I5EA 1UBLS 3ZZTA 3LP5A 1LPNA 4GP6A 1M75A 1A0OA 3LUJA 4DM4A 1XZEA 3WHKA 2VQEB 1WBJB 2E4WA 2XGGA 4NDAA 3H16A 4R9RA 5KNLA 2BMEA 1V16B 2PCJA 4ZOLA 5KWJA 3TQQA 4C29A 3QFRA 1QTRA 5B7PA 2JGNA 3WKDA 4GPEA 3Q88A 4RHEA 2OCAA 4IR7A 2V8OA 1BHJA 3KOZA 2W4IA 3GN2A 2YFQA 3HG7A 2AN9A 1S8FA 4J4HA 3D2LA 4NY1A 5B1DA 4CM8A 1QLWA 3I4LA 1XTKA 3OA2A 5JQGF 4DUYB 1JHAA 3DDHA 3I9V1 4U2BA 2WD7B 3IB6A 2W8BA 5CLLA 4K88A 1SVUA 1KZ9A 2FPSA 1V1MB 1SCAA 2OFWA 3H5LA 3R6WA 4JOQA 2AR0A 1WVIA 3LWNA 1Z8HA 5CU7A 3EZFA 4DB4A 4A23A 1IJBA 1BN7A 1UT8A 2G77B 5J40A 1FIUA 1H2RS 2IHUA 4KX3A 1DWQA 3KWMA 4NG4A 5IAGA 4PZ0A 4YRIA 1JECA 3UGJA 2GD2A 3ROPA 3OSUA 4MYRA 1QRUA 3SQWA 1P9RA 1HRDA 1E7QA 2BMVA 3C7KA 3D3WB 3KPYA 1EGHA 4RHXA 2FB9A 3H9CA 3WLAA 4INPA 3MINA 3CNBA 1TM3E 4JI6B 3EN0A 5CEEA 2AZMA 5AUPB 3P2YA 2A7QA 1P2GA 2R7LA 4QDJA 5FUWA 5NLLA 3LPDA 3U16A 3AILA 2E1RA 4GL2A 2FQQA 1JIXA 3QFSA 1IVNA 1KI3A 1U0OC 1W47A 2AE1A 2FMHA 4B75A 1RZUA 2IZZA 3ZX4A 1RTKA 2XBUA 1U98A 4MQFB 1H4TA 5EN4A 4WRRA 5ILOA 3C98A 3WFIA 4GVLA 4DLRA 1YI0A 1GCUA 3WIEA 5DH9A 3HR4A 2P35A 4MRSA 5AW7A 5DEOA 2VF5X 1JDSA 1CLUA 1LLQA 2KLHA 2RC5A 3DT9A 1XKXA 4K6HA 1YZGA 4CNBA 3Q85A 3UPDA 2Q4BA 1XTIA 1AZLA 1IULA 4YCMA 4OK6A 1PEYA 3U1BA 1YNOA 4BU0A 2AKYA 4RSGA 1TCVA 3E7XA 3JALA 3OJWA 1DV2A 5IULC 5H9VA 3L8HA 4EY5A 3F7OA 2D1FA 2F3QA 2X42A 1O0CA 2IHVA 1FTGA 4MRMA 4KQEA 2H9AA 2W6OA 4C05A 5C8DA 2X77A 3NZEA 1Q84A 2RHDA 3DTVA 3U44A 3M8KA 3GEHA 4GSKA 3G88A 1RHRA 2QYSA 1ZCBA 3CB2A 4RV5A 4G86A 4YRNA 5JCJD 3OQVA 3LK6A 1XXHB 4WN9B 1F8FA 2PAAA 2C57A 3T3MB 3RYFB 3V2HA 3R0VA 2V7QA 2IHNA 2WHQA 1FDSA 2RBKA 3GCZA 3TIIA 3MXTA 2IY8A 3PUKA 2YOFA 3ZNOA 3WRVA 1WXGA 3R9WA 3WADA 1S1MA 4HAYA 1YAJA 2BMJA 4EVRA 1ENOA 4N3GA 1GA6A 3PFFA 5J47A 3GUYA 3BULA 3DQZA 3HBFA 4D8VA 4LJ9A 4EUHA 4D25A 4A0HA 3QWBA 2FUG6 3I32A 4YT2A 4JLMA 4RMNA 4U2EA 3L8MA 4DR5B 1JR4A 3PFNA 4YIHA 3GVHA 1KF0A 2CD9A 1XVLA 3V4VB 2PJUA 2NVWA 1Z9BA 4HYYA 3X1DA 1MC5A 5A3VA 2CJYA 1B8VA 2XDYA 3TNYA 1M10A 1YKGA 4KAFA 2G8NA 4M1EA 2OAP1 1Z4QA 1JBKA 3NBAA 1PR2A 4FZ5A 4AM8A 3C3KA 3R24A 1QZ3A 5CW1A 5EXDA 3E22A 3REOA 2V3WA 1K06A 4RY8A 4MUEA 5BUSA 3U1TA 4O59O 3KYDB 1VIDA 3IULA 4B34A 5JNWA 1ECCA 2HEIA 4Z3KA 3EHEA 1CQZA 2Q5CA 4J03A 1Z6YA 4OUKX 1WHSB 3EGIA 3LUHA 4N3NA 3LRPA 5JS8A 1N2SA 2CXQA 4D96A 3HK2A 4FUTA 2JFXA 1EWVA 3EMBA 2OBFA 3E4CA 3BCRA 4HB3A 4Y2YA 3UCFA 4CFZA 1YULA 3GOQA 1YFKA 4QBTA 1OH7A 1EK2A 2JFQA 5AVWA 4RA9A 5EXEA 3OX1A 3TLZA 1LI4A 2QE6A 3NYRA 4GEKA 4ZO6A 3UQZA 1AKMA 3LLMA 3VSCA 3NFYA 3ZV7A 3EWAA 1U3TA 3QBEA 5FP0A 3ZIDA 4D5GA 4J0CA 1RR6A 3B7PA 3U7GA 2HK9A 1Q14A 2SNIE 1XJ5A 3I9OA 1QP7A 4UTRA 1LVHA 4BUCA 1UZUA 4ZZ0A 2M1XA 1YJBA 3G2HA 3UJ7A 4WQMA 4ZPJA 1L4KA 1Y3HA 3UANA 3MPOA 3BF8A 1FUKA 4J0KA 5KU7A 1TT5A 4GSLA 1T4MA 1YB7A 1ZEMA 1OCEA 1WHTB 1LPBB 4JBHA 4BQIA 4ECEA 3T5CA 5A3RA 3DLHA 4FJ2A 2Q07A 2RKOA 4LDAA 3KT6A 2FCAA 1CVRA 3FCUB 4G24A 4FNOA 3WHLA 3CLUD 3VPFA 3KEGA 3E7WA 1OAOC 1VBNA 1ZM4A 1H1LB 3AXSA 2FAXA 1TQDA 4AX8A 1YB4A 3ELYA 4D74A 4OV6B 4ZKDA 3OE4A 4H6WA 1Y1LA 2X2EA 4N65A 4R1MA 3D2BA 2EHJA 4ZQBA 1JKJB 3L06A 4W8GA 5EG5A 1R0WA 1SQGA 3NEAA 4GEGA 1CG6A 4AJ9A 4XR4A 3F0TA 4F2GA 1XRJA 3N74A 4QDTA 4WL0A 3U9TA 3OHMA 3K1JA 4ZVKA 4BVGA 2GN8A 3L7AA 4GD3Q 1Z13A 4C2UA 3PQ8A 1YC2A 3MS2A 3K9GA 1EFPA 2BD0A 2H4XA 4JN6B 4ZPXA 5JCZA 3N6XA 3O3CA 3D1VA 3W3AD 2Z2YA 1X6VA 3SZ3A 1CRLA 3UK2A 5LNK6 4RTOA 5JIBA 4KFRA 4I19A 2A9KA 1G8YA 1F2TB 5HTOA 1WCYA 4E07A 2QQ5A 3P0EA 5HM6A 5CXXA 1P75A 1SB9A 3RG8A 1MX5A 5CAEB 1HDRA 2SKCA 1FDWA 1O03A 2ERXA 2MINA 3NNSA 4IDCA 3TL3A 4ZFNA 1CUEA 2EQAA 2ZI4A 3ENKA 2WWRA 3ILHA 4G5SA 3ZE1B 2D0OB 1CDEA 4BLPA 3MTEA 4OOEA 3F5DA 2EJWA 2Q4RA 4C4SA 1A5TA 3INNA 3K4PA 4V03A 1ZHOA 5AUOB 4MYDA 4AG6A 3HM9A 3G13A 3RFVA 3H3FA 1CUWA 2VQ3A 3A2MA 4PAQA 1BDJA 2FUG1 1ODJA 2K5UA 3GRYA 1O6BA 3PUWA 5FPKA 2RH8A 2QD3A 2X9LA 3KKOA 4K8OA 4LXTA 4EMUA 3C7TA 4WBXC 2X0KA 2ZATA 2RFLA 1K8XB 2OXFA 4OHPA 3JQFA 3R7FA 3BQ9A 4C1BA 1EYZA 1PT6A 1WEKA 4G5FA 4N6GA 4J7CA 3GG2A 3FR8A 2CL5A 3EXHC 1WMFA 3BWCA 3KPVA 4PRZA 1NMYA 3N86A 3UWMA 3X3HA 2JLXA 1EQUA 1LF0A 1EFDN 1QC5B 1VG8A 2D2FA 3P9QA 4MLPA 5ECYA 4A92A 2FMTA 3CEJA 3KYJB 4UCXA 2G9VA 2GH1A 3IXQA 1QGED 4L27A 2JKZA 4MMXB 1NXTA 5MN6A 4E31A 2P6NA 1RJDA 1GP2A 4D4MA 2IRWA 3DB2A 5K8CA 3LI2A 1CY4A 4I1OA 4K46A 4RFLA 4JLOA 4JVSB 3TZLA 3X1YA 3ZHTA 4DQUA 4RKFA 4C30A 5FI5A 4ECAA 2VYVA 3VGPA 5EIXA 3GDWA 4XJXA 4BUZA 2XOKA 4IIEA 3EXEA 4ZK2A 1WZNA 2VUIB 3DFIA 5KDOA 4B3RB 4P4LA 4R6WA 3VSDA 3PSHA 1ZW1A 5U4XA 3NTRA 5FPTA 1I2DA 2J3EA 1H0KA 3OSZA 3P9RA 5D51S 1J99A 5DM2A 5DX8A 3TW8B 1ZOIA 2II6A 3TDKA 1LNZA 1JHOA 1UFRA 3ZC3A 2BKUA 2CDBA 3OETA 3JQEA 4BGDA 1ENZA 1UOEA 4MUIA 3WBKA 5CBPB 5I7FA 1GVNB 4GIBA 4JVOA 4CTJA 4L6CA 3FJYA 4RLQA 2AFIE 5IJ0A 3N2GB 3TYXA 1CFZA 2AI1A 4E4RA 3FOWA 2J32A 2G0AA 5HRCA 2NTEA 4AS2A 4KAXA 3O4HA 5M2QA 3QE4A 3IT1A 2PUCA 1Z7BA 5LMCA 1IU9A 3OVMA 2ZQYA 3Q3GE 3DR5A 2WF9A 3R7NA 2A5YB 2GN6A 4U2CA 4BJ5A 4AY6A 3WJAA 2BP7B 1NXSA 5DM4A 1ZN7A 3KFXA 2HNBA 2NZYA 1KR5A 2VHEA 3NIWA 4ZCSA 3P96A 5FX2A 3TDMA 3HJUA 1GPAA 2MSEB 2NZWA 4TTQA 4FYVA 3UQYS 5KREA 2PUFA 3P4YA 1SXGA 1UXJA 4X65B 2GR9A 1YVRA 4F7DA 3CSDA 3KL4A 3IT2A 1FTYA 4F3NA 2AFHA 4M49A 3TNDA 5CXUA 2C4KA 4Q48A 3QVXA 1OB2A 2EARA 4I14A 3H05A 2UXCB 2Z6UA 2XE8A 3IC5A 3ONNA 3Q3JB 2RD2A 4X6LA 4E2WA 2IUTA 2W6IA 3L4BA 2ZS7A 2GPJA 5IASA 4XRGA 1YZUA 4AIIA 2CXRA 4E03A 5LNK1 2OC4A 3BXXA 4QD3A 4Q4AB 3AIMA 3M7IA 2XZLA 4LOKA 5CHEA 2G76A 4DLTA 5FHQA 1CZKA 4U9HS 4OHZA 2O2YA 3BS4A 5BYJA 4TM7A 4EW3A 2Q27A 1VXRA 1SUDA 4WBNA 3QX8A 3TW0A 4XTRA 5TT0A 2RB5A 4HI0E 4HQFA 3DPUA 3VUEA 1NLUA 4YXWA 3O1JC 4DMMA 4CMCA 5ITVA 3BHJA 3I1YA 5IXJA 3JR3A 5BV7A 5LQUA 1U7TA 1HNXB 3RAFC 4CQJA 1QJ4A 1MQ9A 4D92A 4QNMA 4CLOB 2OD2A 4KE6A 4E0BA 3RAPR 3BGSA 4A8JB 1GUYA 2C9YA 3UN1A 3VHRA 2QWXA 4EUNA 1L8XA 3L7NA 3VUFA 1A8SA 4G4JA 3QX7A 1O6ZA 4TSFA 4C3OB 1PVDA 1W0JA 4D98A 3GN1A 2XTNA 3O8QB 2HSWA 2JGEA 3ZE6A 4MUYA 1EINA 2XUJA 3CNNA 4L22A 5CLIA 4KREA 1N9ZA 1VP9A 3MCUA 2FFAA 1W87A 2IOHA 4ZTZB 3MERA 3PGMA 3EW7A 2YRFA 1FFXB 3TXYA 1H2YA 4O4IF 4OL9A 2COKA 4U63A 2ZXEA 4O4JB 4IIYA 4KR7A 3BZWA 4EQ6B 4DCSA 1NNSA 4JWTA 1YCDA 5D3MB 1SZCA 5JCXA 1VJ0A 3AL3A 2QOEA 4B17A 4FYIA 3TSZA 1GKLA 1D2NA 2CF6A 2DH6A 4CDMA 5GAJA 2Q2WA 3GZJA 1ZVMA 3MWEA 3RLFA 4RLHA 3C4VA 3UGTA 4D6XA 5KJ1A 1DC5A 3IBSA 4M1WA 1M2JA 4CGYA 1U28A 3DOJA 4HDRB 4FYJA 1UPUA 2D5LA 4E88A 2PYIA 2ZAGA 1G7CA 3FPBA 5DGCA 2N1MA 4XX0A 3DXXA 4ZU1X 4ZI5A 4J43A 1EM8B 1U6JA 1WNTA 3OQIA 3LCMA 4DLNA 3ETHA 1AX9A 4ZCTA 3KKNA 1FMLA 5H83A 4ZDIA 1DG9A 1R8SA 2JAPA 3BD7A 4KLAA 1DAPA 3NGXA 4D9JA 1P2UA 3QNUA 1DIGA 2WU0A 2QW0X 3G0OA 4Q39A 1SCQA 3M49A 4I5GA 1XEWY 2FQ1A 1V4NA 3PUIA 4IDPA 4OSPA 1ZGAA 2NTNA 3RW9A 1JKMA 1MKYA 4DV1B 3KELA 3RK4A 1XRPA 3K94A 2G07A 1GG2A 5K8UA 3V8BA 4WSOA 2C2ZA 4LXIA 3LYHA 5E1DA 3KQUA 3NKLA 2NP7A 1KH2A 3PLRA 2X23A 3OZCA 2D5AA 3JRWA 3E3LA 3SPXA 3OEED 2GFHA 1E77A 1JMYA 1HZZA 1M7GA 4RIGA 3TLKA 3RI3A 2PN1A 2RG1A 2WZCA 3CZCA 4OH1A 1ISHA 1T8PA 3ASUA 3KALA 2J7KA 4E7OA 1KMMA 1CSEE 2NPOA 3GWGA 5EJIA 3C45A 4AJOA 4C07A 5HKKA 5JXJA 4YJ2A 1UBGA 2QVYX 4AXBA 1DJPA 1R1DA 1WZUA 2GPBA 2JLQA 2PLNA 2YJGA 4V02A 5FUQA 1PEDA 1PF7E 1JG7A 2CLMB 3FHLA 1AKYA 2AG8A 3E3MA 3WLTA 2QSJA 4H7IA 1QAOA 2W6MA 3HBLA 3QQ5A 3WK8A 4S1NA 4H7KA 5JS2A 2FPMA 1Q1GA 1WE2A 4YJDA 4KR6A 2VHQA 3JXEA 2YWXA 3GFTA 1JZSA 5BN3A 5JBQA 1NT4A 1CJTC 1E1CA 4GPZA 3SC4A 1KARA 2Q2VA 4XLZA 2AF3C 1MRNA 3EVNA 3OX3A 5F3DA 3OWOA 4IL5A 2AG0A 3NBKA 1Z2OX 1C3VA 4INOA 2YVKA 3WSTA 1TEVA 4FR0A 5FLEX 1OFUX 1R6AA 4PG4A 1AGRA 4KXNA 3V8VA 1XMVA 1YK0A 4BP1A 5FH9A 1NN0A 3PEWA 2XQVA 4RZHA