3AY6A

Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
263
structure length
263
Chain Sequence
HHMYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKYPSFQFGRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided mutagenesis for the improvement of substrate specificity of Bacillus megaterium glucose 1-dehydrogenase IV
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
molecule keywords Glucose 1-dehydrogenase 4
total genus 98
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ay6A00
4W9NA 3IUPA 3HG7A 2GZ1A 3R1IA 3UCXA 3ITKA 5ITVA 1IB6A 2YV2A 1LNQA 3T7EA 1KC3A 4WLVA 3KEOA 3OSUA 5AXDA 5IXSA 1PS8A 3RKUA 3QY9A 3HDHA 1RYDA 3F46A 5JO0A 3ZWOA 1KEVA 3D5QA 1YDWA 3DAFA 4BUCA 4CR7A 3ZCXA 3LVFO 2DKNA 1ISGA 3GHYA 4J49A 3NGXA 2O7QA 1I0ZA 5C3MA 4YAKA 4EZBA 1B8VA 1QYDA 3LF1A 3I5MA 3O38A 4MJLA 5CP8A 1IULA 5BSGA 1YOVA 3GRPA 4YAIA 4DMMA 3QVOA 4IJUA 1H5QA 2OOSA 4L4XA 2VHYA 2DPHA 3DR3A 1NWCA 3LZ6A 4B8ZA 5U9CA 1CRWG 4WUVA 3GNQA 3T7CA 4D44A 5COBA 4QO8A 5I9LA 4MVJH 3I23A 2IRWA 1I2BA 2NWQA 3KYCA 4QFCA 5JO9A 4J0FA 2P2SA 3I3OA 1HE5A 4OXYA 3HUDA 3VKVA 3ZV3A 2Y1FA 4ESOA 3D3EA 4CV2A 5BSEA 3KSZO 1LLUA 3QWHA 4MP8A 5TX7A 2HU2A 3ZDFA 5C7IO 4GH5A 3AOEA 2Q1UA 1FJHA 3W4IA 4GMFA 3VAZA 4UEOA 3LC2O 4FC7A 4UVDA 2OP0A 4BNJA 1TB4A 1VE9A 3D3WB 4ZRMA 1FF9A 4BKRA 5A03A 1JW9B 1UXJA 3R3SA 5JC1A 4JX8A 4RPKA 2I9PA 5CDTA 4DPLA 2ZB4A 3AUAA 1E3WA 1YQDA 5ENDA 3F4BA 3RIHA 3VVCA 4CMEC 1SO8A 3PDUA 4B7UA 1K5HA 1WLYA 5L4LA 4WCFB 1MG0A 1E6WA 1HLDA 2JHGA 3HFSA 5JAZA 1ZIDA 3RQSA 4DLLA 2EEZA 1GV1A 2EG9A 2VUUA 3GPDG 3JQGA 4IBOA 1LBEA 4KTTE 4DA9A 1PGQA 2NVUA 5JAQA 1SC6A 1F8FA 3VZPA 1SZJG 4W99A 1ISFA 1LLDA 3RFVA 4XQEA 3JYNA 1U5CA 3D4OA 5TQVA 2O3SA 2ILTA 3HN2A 3QVTA 4MIEA 5IZCC 2WDZA 5DBFA 1KC1A 1B3BA 1JU9A 3ZWNA 4CLRB 1C1XB 2Y66A 1EFKA 3IUSA 4RDHA 2CZCA 1YH3A 4W9NC 5EN4A 4HY3A 4DPMA 1M76A 2X5OA 3VTFA 3ORFA 1FDVA 2DAPA 4ALLA 4FR5A 4Z3DA 4OOEA 1DB3A 2Z5LA 5F5NA 1QR6A 4Z6KA 5GY7A 1I3KA 5CEFA 1BXKA 3JQFA 1WXDA 3RU7A 3A28A 3IJPA 2O3UA 4RVDA 1LTHR 4YJDA 5DDIP 1LDEA 1UAGA 3GVXA 3WGHA 2NVBA 3PEFA 3PGXA 1U8XX 2UUPA 3WICA 3RROA 2DLDA 4KDFA 5F1PA 4EUHA 2JFHA 2BGKA 3TZCA 4KUEA 4AJIA 1ONOA 3RUDA 3PTZA 3GPIA 3ZHZA 2DUWA 5FFFA 5G4KA 1HRDA 3HNPA 4OQYA 3U5TA 3NRCA 1U8FO 2GERA 3I6IA 1U1IA 2PH3A 4AJPA 4GX1A 1E7YA 4B4WA 1I2CA 2EKLA 2R00C 3NTOA 2VHWA 2J5KA 5KWEA 1NX6A 1UZMA 1S7CA 2B4TO 2X0IA 1MC4A 4MVJD 2C0CA 4I1IA 5JYDA 5CFZA 1DC6A 2OGUA 5JYEA 2BGMA 2ZYDA 3KLPX 4CMHA 4OOFA 4UEKA 2PKRA 2V6BA 3UHAA 3IL2A 2FN7A 4YA6A 2Q46A 2BLLA 2Z1MA 2A35A 1QORA 1U3WA 4OAQA 2PFGA 4J1SA 4A5OA 1KERA 4EJ0A 2X5JO 4MVJP 2EW2A 2FR1A 1XCBA 4AJ1A 1Q1NA 3RKRA 4PVCA 4FJ0A 5G0VA 2EP5A 4XZ3A 4CPDA 1P0CA 3OBBA 3OM9A 3ZWXA 5T67A 3TDKA 1Q7CA 4NBVA 1MV8A 1E7SA 2ZJ1A 5G0UA 3ON5A 3EDMA 4MVJI 4E32A 1LLQA 4F46A 1XG5A 1LRKA 5L45A 3DXFA 1ENPA 1O95A 3PZRA 4W82A 3I9NA 2X9GA 3WBFA 3OA0A 1XA0A 3ANNA 2C54A 4NK5A 3CZRA 2GZ3A 2ZJ0A 2VHXA 2VN8A 4U5QA 3E03A 1NTOA 1HZJA 2TMGA 2NTJA 2PWZA 1MGOA 1EVIA 2XAAA 3MJSA 1I33A 3TZHA 4R16A 3ASVA 3DOCA 3COSA 1GYRA 4R1TA 5IDXA 3WGYA 3JV7A 3A14A 2EERA 4WEOA 1YOVB 1I5RA 1PEDA 4UREA 3FTPA 3G17A 2JFGA 2NACA 1C1DA 2Z95A 1EFLA 1NQAO 4CL8A 3C3XA 4E5PA 2P5UA 1M6HA 1Y5RA 3CH6A 3BMCA 3WFJA 5L95A 2WYUA 5CHEA 4IS3A 3CKYA 2Q4EA 3GY0A 3P19A 1ONPA 2JD1A 4YTEA 3ZU4A 4CM7A 2OO5A 1QSGA 2E82A 1HDZA 5JAMA 2Y99A 3WWYA 4M89A 1C0LA 2CDCA 2GN9A 3JQEA 2VT2A 4NH4A 4QEDA 4XR9A 5I8ZA 1NM5A 4AJOA 2CF5A 1HWYA 2H9IA 2X0JA 1WNTA 2PTGA 5DCUA 3KO8A 5A02A 1TLTA 1PZHA 1E1LA 1E5QA 1YVEI 3QVXA 4NFYA 1HL3A 1L7DA 5CDGA 1PIWA 4NJMB 5FWNA 1A27A 3RWBA 3GDGA 3UOGA 3TOZA 2O50A 1Z75A 4MKZA 4P4LA 1PGPA 4HFJA 5JSFA 2AG8A 2I99A 4MIOA 3OH8A 5A05A 2POQX 3RFTA 4RL6A 5L4NA 4J4TA 1HDYA 3ADPA 2B69A 1XU7A 2JAPA 2O3RA 5KJEA 4CLDA 5GZ1A 1HT0A 1PJ2A 1HDCA 4OSOA 3C1OA 1PJBA 1UP7A 5AXCA 1NBOA 5COQA 4RLSA 1GQYA 2I5PO 1NHGA 2HK7A 1BW9B 3OJEA 4PLVA 4IXTA 4YDRA 3OIGA 1MX3A 3PJEA 3C7CB 1A7AA 3R6DA 4M86A 1FDTA 5DCWA 4BO6A 4D43A 4IUYA 4O0LA 3CSDA 1ZEMA 3H4VA 1B2LA 3KYDA 1XGKA 2V7PA 5F3RA 4PG5A 3AOEC 1F0YA 1LRLA 3PQEA 2X8LA 1XEAA 4NDNE 3AY6A 2FPGA 1U4SA 3OQ1A 3EK2A 1DJQA 4QQRA 1P44A 4GKVA 1DJNA 3U3XA 2BHLA 4EW6A 1DFGA 2Y0CA 1EUZA 2FPIA 4DC1A 1EVJA 3DAPA 1B8UA 4YJHB 5A5EA 4E12A 4E6PA 4RF2A 1TA4A 4BO0A 3H9JA 3RD5A 5L7TA 3GUCA 2VUTA 3VPHA 5JY6A 2HDHA 3DHEA 3FNEA 3HADA 3S1LA 1UXGA 4XJTA 4K9DA 1YB1A 2X0RA 3WGTA 5A04A 2VYNA 4D45A 3ICCA 1LC0A 1RWBA 4DQXA 4LVCA 3FWNA 4CUZA 1E6EA 1ZSYA 1ZH8A 1EZ4A 3Q2IA 3KBOA 3IOYA 2FOIA 2EXXA 1E6UA 5IDWA 1CWUA 4KOAA 3BMOA 4LRTB 2NUAA 1T4DA 3EMKA 3VH1A 1Q0QA 4Q39A 5L7WA 1NQ5A 1J0XO 1YONA 4KZPA 3DZFA 5JCJD 3WX0A 1LLCA 3H3JA 4DC0A 2W90A 2YHIA 2WYVA 2OBNA 2BI7A 1K3TA 2FSSA 3UF0A 1DEHA 1N2SA 1HYGA 2C20A 2IXAA 2VTEA 3LK7A 4FFMA 3TQHA 3GC6A 2A9FA 3B6ZA 4A26A 3F5QA 1L7EA 2AQIA 2VNSA 5I9MA 2C82A 1Z7EA 1GAEO 1IYZA 1OZAA 4F45A 4R54A 2OP1A 4YAEA 5G0SA 3ZWYA 4CM1A 4WNCA 4WKGA 1HETA 1OI7A 2GDZA 3CEAA 3D4NA 4IXWA 4CV3A 1DC4A 1GZ4A 1T25A 2NADA 3I9KA 4NMHA 1IOLA 1ARZA 1Y5MA 4XIJA 5IN5A 3G79A 4BO3A 5I9NA 2HMUA 3DTYA 3MJ4A 3GRKA 4IDCA 3ETGA 4Z9XA 4CMCA 1BDBA 3HJAA 4BMNA 3H7AA 4L9RA 1BXZA 1JTVA 2VHZA 3M1AA 4HP8A 4RPHA 2OXIA 2QRLA 1DRUA 1NASA 3AI1A 2EIHA 3FI9A 1ZMTA 2NV6A 3GQVA 3I83A 3C24A 3KTDA 2NSDA 3NV9A 1A71A 4E4YA 4E2WA 1B26A 1HLPA 2EGHA 1K6XA 1TT7A 5THQA 5L53A 5J23A 3QIVA 3F4LA 3GAZA 1F17A 5JDCC 4D3DA 1YL5A 3CIFA 4ND4A 3W6ZA 1UR5A 1LI4A 2NVWA 2EWMA 1F8GA 4J9UE 1ZK1A 1YBVA 3TZKA 1EQUA 3ROPA 2O4UX 3ITDA 4RF4A 4C7KA 1PTJA 2DUUA 4R3WA 2GZ2A 5IDQA 3H6KA 2VWGA 1NXQA 2O48X 4DQVA 4GPD1 2DTDA 4JP3A 2V6FA 3NJ4A 3PHLA 4Z0HO 4HX5A 2X7HA 2GN4A 1EMDA 5GZ3A 2PKQP 2Q3EA 2Y93A 5CDSA 3ETDA 1PQPA 1U7HA 5KVQA 1RPNA 4QFDA 4GLLA 4XQCA 3FBGA 5BT9A 4UVIA 4NU6A 4TRJA 1TEHA 1M67A 1DBVO 1QYXA 4ONEA 2X6TA 1HSZA 1LDBA 1DSSG 4FJ2A 1J49A 4MOWA 5EQDA 3B1FA 5ENVA 2W2KB 1YO6A 5CPBA 1WPQA 4X54A 4GWGA 3JQ9C 1SB9A 3WBBA 3AWDA 1AXGA 1SOWA 2VOEA 1OC4A 4CMIA 4HXYA 2GD1O 2D2IA 4ZHSA 2G17A 1KIFA 5TC4A 1ULSA 1Y9EA 1VJTA 1V3VA 4WCFA 3CPSA 4BOYA 4MP3A 1WWKA 3IC5A 3D1LA 3TNLA 5ICSA 4AG3A 1HE4A 1SEPA 3QRWA 2ZB3A 3MWEB 3S2EA 1I3NA 1PWZA 1SOVA 4DIBA 1QKIA 2QIOA 3M2PA 3L6DA 3PWSA 1E5LA 4IJWA 2DBRA 1CJCA 1HDXA 4CQMD 4MVJE 5AYVA 1G6KA 5T8KA 3QWAA 4OH1A 4U0KA 5LCXA 2W98A 2GCGA 5JC8A 1RM3A 3BIOA 5TT0A 4DREA 2I66A 9LDTA 1PS0A 2PA3A 1E3JA 3K2EA 2FPPA 1UDCA 3FF4A 3DMYA 3P2OA 1R4MB 4TRNA 2FP4A 1LSJA 4IJVA 3KZVA 3G3EA 3AK4A 4KMSA 2GF2A 3SJ7A 3PIIA 4OXKA 4KQXA 2J6IA 1I36A 1X0VA 2O3QA 2X4GA 4HNGA 2Y1OA 4LK3A 3HZZA 4RVFA 2W8ZA 2O2SA 5HRUA 4PG6A 1HE3A 3HWRA 1VJ0A 3JQ8B 2VOJA 4NG5A 3IQDB 4L4SA 3VPSA 2LDXA 1S6YA 1QV6A 4J16A 1CQJA 3N74A 2YYYA 2IE0A 3KEQA 4E31A 1FXSA 4D3SA 4UVGA 4YWJA 3HDYA 1JAXA 3U9LA 1ZK2A 3NYWA 3OJFA 4DIOA 1E3IA 1EUCA 4BNIA 1I01A 3RAJA 3WMWA 1LX6A 2GSDA 1ZK0A 2JJYA 3I1JA 2BFPA 2YHUA 3MJEA 4J90A 2CY0A 5K0ZA 2NLOA 3QWFA 5TLSA 2JAHA 5TGDA 2Y05A 4TZTA 2IYPA 2BI8A 2HMWA 3P7MA 2BFAA 2B37A 3OIFA 1P1FA 1Q2XA 2OUIA 1QP8A 2GNAA 4NNJA 1R0KA 1U5AA 3UICA 3V8BA 2QRJA 3ZWMA 2NTVA 1WDMA 3LF2A 4II2A 4B79A 4DXHA 1NHWA 1UZLA 1V6AA 2PY6A 3DFZA 4ND5A 3D7LA 3WR5A 3RUIA 4R1NA 2P4HX 4FOOA 1LUAA 1VL8A 2PD6A 2NU8A 3VZSA 5C37A 3AM4A 3DBHB 1R0LA 3JQ6A 1PL6A 3AM5A 1PL7A 4CM5A 4YQZA 3MJCA 1XQ1A 4I08A 1SNYA 3B20A 3INGA 3WLEA 1GUYA 3OEYA 1C3VA 3IS3A 4PZEA 1DFHA 4BQRA 1LSOA 5C5IA 3GVPA 3DBRA 3BMOB 3OJOA 4YVFA 3TSCA 3WQRA 3ONDA 3L0DA 4NFHA 4WLUA 1H9AA 1Q7GA 3O26A 2DFDA 1Y9AA 5B4TA 1AUPA 3W4KA 3KXDA 4D0RA 1K0UA 1X15A 2XOXA 5CPFA 1OC2A 1UXIA 4J43A 4RV9A 4KWIA 4L0QA 1P74A 1OMOA 1ADGA 3P5SA 4U7WA 3H2SA 1R6DA 4D41A 2YDYA 5BSHA 4ZD6A 4J4BA 5KIAA 4BNLA 2HMSA 4HFRA 4IQ8A 2NVUB 3DMTA 1F06A 3GVHA 5FEUA 5B1YA 1EVZA 5EESA 2AHRA 4LGVA 5KNLA 1YDEA 2Y1DA 5AQ1A 1ZMOA 4AJNA 2QX7A 1C1DB 2VTDA 4IJKA 4ZVVA 4CLEA 3MOIA 2J3JA 4CQLB 4BKQA 2J5RA 4HNHA 1J6UA 4FS3A 3JQ7B 3TOXA 2RAFA 3EAGA 3KM0A 1ZK4A 4FFNA 2GN8A 4DVJA 1V3UA 1MB4A 1U2GA 1FMCA 3DTTA 3PP8A 3KYBA 4R5MA 3PLRA 3DBHA 3W6UA 4U6SA 5BSFA 1T2FA 3DZGA 1CEQA 2BH9A 5JPIA 2NM0A 5JDIC 4B3HA 3W1VA 1YE3A 1JVBA 4J6FA 4DYDA 2CFCA 1CIVA 3NJ8A 3U4HA 4NBRA 2VWHA 1LDMA 4CM6A 3BHIA 1B14A 4UUNA 3FSRA 2WE8A 3WXBA 4Y8VA 4AJ4A 4EUEA 2HKIA 4RZIA 3H8VA 4GX2A 3ICPA 3WFIA 4NFSA 3X2FA 3RUEA 4DMLA 3KV3O 4B3IA 2VYVD 3RCBA 1H93A 2P91A 2PD3A 3DZJA 3OFSA 1YWGO 3SJUA 1H6CA 3WYCA 2C7VA 3UUWA 4WK6A 1T1RA 4ALIA 1NNUA 2QYTA 1EK6A 1H9BA 2AEJA 2AMFA 1LRJA 4WLEA 1VC2A 3EUWA 1T26A 4J7CA 1NPDA 2QZ9A 5TIIA 3E1KA 1E1NA 3I52A 2ZTLA 3KHUA 3C8MA 4TVBA 3KSDO 4GSKA 1X13A 2HJRA 4RPJA 3DDNA 4P22A 3BTSA 3IAHA 1H2BA 3ZV5A 3NEPX 2PR2A 2EKQA 4XQ9A 4PN3A 2DBQA 2W2LA 1BWSA 3PIDA 1JLLA 4K6CA 4BKOA 2WWRA 4YJFB 1X1EA 3K6JA 2Q99A 4TWRA 2ZQYA 1R12A 1HKUA 1LA2A 3BTVA 1N1GA 4CR8A 1WMBA 1SPXA 3GN1A 3VZRA 2AA3A 1LU9A 3SLGA 1PJ4A 1GZ3A 4DIFA 4DLAA 2CF6A 2OHXA 1YXMA 4FGWA 3BAZA 4E0BA 3QLJA 2VRCA 3ZNOA 4BNTA 3GNSA 2VYND 3WDSA 5I7VA 1O0SA 4IMRA 2D8AA 3SLKA 5AOVA 2WMDA 4XB1A 1ENYA 4FFLA 5JE8A 4BGUA 3DONA 4U0JA 4XGIA 4Z9YA 1LSUA 1ZFNA 2RHRA 4BGIA 2D5CA 4XDZA 1QLJA 1C1XA 2WEKA 4YJGA 3TN7A 3HSKA 2Q49A 3FN4A 2CMDA 3NT2A 4YRDA 3BMNA 3Q9NA 4IDFA 3EW7A 3BMNB 2YFHA 3VDQA 2I6TA 2E37A 5JCJA 3ZHYA 3GHHA 3RC2A 4EDFA 3GG9A 2JKVA 3AUUA 4HBGA 4D46A 4CLOB 3V2GA 3GN2A 3F9IA 4QX6A 5FYDA 4HKTA 1P1KA 2HRBA 2DU8A 1Y8RB 5ILGA 5ILOA 3DBLA 5IG2A 5H83A 5AXBA 2BGLA 3PHHA 3QQPA 4JJFA 4PLZA 1Z45A 4XWYA 1JWAB 4CM8B 1ZCJA 4NIMA 3AFNA 2CDBA 3LLVA 3ZNNA 1GEGA 4JK3A 1PGOA 4MINA 1NVMB 5KJFA 4BMVA 4WOKA 2PZLA 3GGGA 3GVCA 1GR0A 4E21A 2B4RO 4PVDA 1K6IA 2VNAA 1WAMA 4BKPA 4JJIA 2H63A 3AU8A 4OSPA 1JWBB 4ZU3A 1U2DA 1KBZA 1RJWA 1X1TA 4PRLA 4IS2A 3V2UA 4J91A 4NJOA 2E4AA 1EEHA 1IE3A 1KETA 2F00A 4L73A 1B16A 4FW8A 4A27A 4MO2A 1UP4A 5TJHA 4AICA 4EGFA 1L1FA 3RC9A 3PYLA 1P33A 4PLTA 1IPEA 4OKIA 3TWOA 3AFMA 2YW9A 4CMIB 2X1HA 5HA5A 1ISMA 1HEUA 1JVSA 1M2WA 4Y9DA 3EVTA 5B37A 4XYEA 2GLXA 3KSUA 1A7KA 2VHVA 3BTUA 5T5QA 1AHHA 3IP3A 3O8QB 1KVQA 3QJ5A 1IPFA 4FPXA 4Q3DA 3JQCA 4ZN6A 3RJ5A 4Z3KA 1FK8A 4EYEA 4WEQA 2HMTA 3GDFA 1ZKMA 2BF7A 1WZEA 3F6YA 3FWZA 4H16A 4ZRNA 2VYVA 2HLPA 4G2NA 1E1MA 1T1SA 1N5DA 3H9QA 3ZZNA 2IZ0A 1IY8A 5TF4A 5L3ZA 4CLHA 6LDHA 3O03A 3BMQA 2WM3A 5KTKA 1B7GO 3EC7A 4XQGA 4PFJA 4GAEA 3FR8A 4DL9A 4ALMA 3SEFA 3RASA 1UH5A 1R4NB 1U3VA 3V1TC 5JLAA 2UDPA 5DN9A 1VRWA 4R4JA 4XA8A 4XDYA 3GEDA 2X23A 5DCYA 1XIVA 7MDHA 4Q3AA 4PLYA 2BFMA 3B1JA 2XXJA 3QWBA 3ONFA 4WPGA 2P9CA 1DIAA 1KVTA 3I4FA 2D59A 4RVHA 4B4OA 4E13A 1ZK3A 4MP6A 4MKXA 4JGBA 4R69A 2AG5A 2PNFA 3U0BA 3S2IA 3INTA 3UGKA 1JQBA 1HXHA 2GRAA 1NYTA 3WNQA 1KVUA 4PG4A 1W8DA 9LDBA 5DT9A 3F47A 4GL4A 4R9RA 2EGGA 4GGPA 2BELA 4KP7A 3JQDA 2I67A 4OQZA 1KOLA 1NPYA 2ET6A 1N8KA 4DBZA 1TT5A 4OL9A 3SX2A 1O8CA 1NQTA 1WP4A 4RGBA 2YV3A 2ZCVA 4WGGA 3WJAA 4YT8A 1MG5A 2XPCA 3JQFC 5EINA 3RBZA 5L4SA 3F3SA 1O6ZA 3IIEA 4JROA 3ROQA 5LDGA 2DT5A 1D4FA 3WNVA 8ADHA 4TZKA 1DXYA 2WD8A 1K6JA 3FPCA 4YEDA 4CJXA 4QECA 1HDRA 4LCEA 4RVSA 4E30A 2J3KA 5IF3A 1QYWA 2RH8A 4G65A 2GPTA 3PHJA 4R1UA 4JP2A 4A10A 4B8WA 1ADFA 1DIRA 4M1QA 4WECA 1GQQA 1QXSA 3WGIA 4AFNA 4IDDA 2Z1NA 4E5MA 3C1AA 5C7LO 2J3IA 1PJ3A 1DOHA 3FRJA 2GGSA 1ISJA 4GSLA 1SCUA 4E5YA 3V1UA 1MC5A 3ABIA 3HE3A 1Q7BA 3VH3A 1BRMA 3ZW8A 3DEYX 1EBFA 2WJPA 5EL0A 3L4SO 3WSWA 1DRWA 3WQQA 2CSUA 3OETA 5ER6A 4WE3A 5IZ4A 1EE9A 1ENZA 4RF5A 4NK4A 3N58A 3TZQA 4ALKA 5B4VA 5ES3A 3NAQA 1MP0A 4DLBA 3MWDB 4I5FA 5KVCA 4YT5A 3ZI0A 3AW9A 3GEMA 2CVQA 1T4BA 1U3UA 3DMTC 4ND1A 2BD0A 4XX0A 1NR7A 4CMJA 1E3EA 2FZEA 2FZWA 3E8XA 4UUMA 3RUFA 2JCVA 3TL2A 1JN0A 1KS9A 4URFA 4BB6A 5JXWA 4XYBA 3ZWCA 4ALJA 4ND2A 4D7AA 1D1TA 3GH3A 1Q0LA 3WJ7A 3WLFA 1JAYA 3PWKA 1AXEA 3VH2A 3X2EA 4WOJA 3PI7A 1O9BA 2O3TA 4CMBA 3L6EA 3E9MA 1PX0A 4YR9A 3JYPA 2HUNA 2JCXA 3ZGYA 1I2ZA 3OF2A 2UUOA 1LXCA 2HQ1A 1QYVA 3D0OA 1LSSA 3B1KA 4BMSA 1U4OA 3RBVA 2W4QA 4I9UA 1ZO8A 4WCDA 4Y6PA 4I8XA 1XSEA 3Q1LA 5CEJA 3A9WA 3VPGA 4O6VA 4FBGA 2P9EA 2P9GA 4H15A 2UAGA 3I9MA 4A7PA 2JHFA 1E1KA 2PGLA 1P77A 3TFOA 4BV8A 1PGJA 3LT1A 1AN9A 2TMDA 3DZHA 3K5PA 4CM4B 1HSOA 2BKAA 2O4CA 2VWPA 2ZKLA 1F14A 3W8DA 4QO7A 4JBGA 1VL0A 4GQAA 4TMFA 5A9RA 4CODB 2PLAA 4TKMA 3NT4A 3DOOA 4B4VA 3F1KA 2Y1GA 4OYRA 5T64A 5HS6A 1X7DA 3BTOA 1CERA 3MJVA 3G1UA 4BKUA 4Q3EA 1ADBA 1DO8A 1U7TA 3AI2A 3JSAA 4DWVA 3DB2A 1YJQA 1KEWA 3K2BA 4RJTA 4RLHA 2HK8A 5A5FA 5CAEA 1KY4A 4XCVA 5EQFA 4HADA 3ANLA 2YDXA 5CEEA 3VH4A 5G4KB 2IZ1A 4JJGA 4WLNA 3H9UA 1LQUA 1NFRA 3U49A 2C2YA 1D8AA 3MTGA 5F5LA 1YJ8A 5JY1A 4PRKA 3M1LA 1Z73A 1GCUA 1ZSNA 4ND3A 4BO9A 2PGDA 4F6LA 3HB5X 4BV9A 4W4TA 2BFOA 5THKA 3PK0A 4IIUA 3I6QA 3CUKA 4ID9A 5IFLA 2CUKA 2GO1A 2HSDA 1UZNA 3MZ0A 4A73A 3SVTA 5B12A 1LJ8A 2J8ZA 2CD9A 1T2CA 3DC2A 4HFMA 4LRSB 1YB4A 3IP1A 4WLFA 2W2KA 4J1QA 1RYEA 2E49A 3RBXA 2IEBA 4CLRA 3BHJA 1NP3A 2B5WA 2D1YA 2VRCD 3IKTA 2YQ4A 5BNIA 3FNGA 4NU5A 4GX5A 4N5NA 5KJ6A 3L77A 1KVRA 4K28A 5T6BA 2W2LD 2X9VA 2FR8A 1GCOA 4RQTA 2B35A 4I5DA 1WZIA 3JQAB 4YAGA 4QSMA 4CLOA 4J1NA 3ZWPA 4RORA 1JKJA 1XHLA 4XEHA 4CV1A 3RUAA 2GYYA 3CMCO 3EGOA 1KVSA 3FCOA 3MOGA 2Y68A 3A4VA 3JYLA 4ZQBA 4Z9FA 4M8SA 2P5YA 1HTBA 4Q3BA 2X22A 4TROA 1UUFA 4UULA 1KEPA 3BZUA 3H65A 3OJ0A 3ZWWA 4BNKA 1H6DA 3BYZA 3PZBA 3H3FA 3PYMA 4RCVA 3WOHA 3D3WA 3VPXA 1ORRA 5K9ZA 2VWQA 1Y6JA 4CV0A 2WTBA 3UCEA 3PFFA 5JDCA 1EBUA 3TL3A 5A9TA 3FD8A 2QYSA 3KOUA 4Y98A 2D4AA 1GFSA 2EKPA 1VM6A 2HAEA 2X58A 1ZNQO 4XGNA 1NAHA 3EHEA 3QV1A 1H94A 1PJLA 2B4QA 4ROSA 3ZU3A 2WD7A 1DIHA 2PK3A 4IIVA 1R4NA 1P9LA 3KYCB 1MLDA 2NU6A 4IMPA 1SBYA 1MFZA 1Y7TA 3BHMA 4B4UA 3E9QA 3RFXA 2JFFA 2AQKA 3GGOA 4MKRA 1Y8QB 2Q2QA 4PLFA 1BDMA 2NQTA 2C29D 5BQFA 5TT1A 4F6CA 2C2XA 4CM3A 4FB5A 2IYOA 4DBVO 5AXAA 5DULA 2Q2WA 4AJHA 3FHLA 3TF5A 5MGBA 3L4BC 1YRLA 3OJLA 3WG9A 4JBHA 3QVSA 4UVHA 1EVYA 1VJ1A 4II3A 5JFOA 1PS9A 2Q1WA 2C07A 4D3FA 3INRA 4J4HA 3GR6A 2AQHA 2OFPA 1A9ZA 3LT0A 5CG2A 4JLWA 4KWHA 4K6FA 3GOHA 3VKUA 1ZUD1 5I7FA 5L7YA 1PWXA 2ZB8A 5JAIA 4R1SA 1VL6A 4EBFA 1XLTA 5K6AC 3NGLA 4JQCA 1N9GB 3JQGB 2OMEA 2IODA 3DHYA 4L75A 4C4OA 1MUUA 3D64A 5DZSA 4MDHA 4DTIA 3E6AA 3GNTA 3SBOA 4I5EA 5EERA 1D1SA 1SMKA 1IL0A 3K30A 4YBZA 4LW8A 3S8MA 1XU9A 3FNHA 3QVWA 4CM9A 1FDUA 3OICA 1C0KA 1H0KA 3WSVA 5G0WA 3K96A 1XELA 1XYGA 4G5HA 3UN1A 3PGJA 3WGOA 1KYQA 3WTBA 1CQIA 3V5NA 3K92A 3RU9A 3I4CA 3MEQA 3TPCA 3RI3A 5IAAA 1E7MA 1ISIA 4NZ9A 4Q3NA 2BMAA 3AU9A 3AY7A 3N7UA 3OECA 3O9ZA 4FJ1A 5CDYA 2Q1TA 2AEFA 2O7SA 1NFQA 3ZV6A 4PG8A 3AI3A 1W4ZA 5A9SA 1O5IA 2OBYA 4O1MA 1WDKA 3GK3A 5C7OO 2GR9A 3L4BA 4GBJA 4BO7A 5I7SA 3GDOA 3Q3CA 5DOVA 1PQUA 2YFQA 2QHXA 3NDIA 3O8QA 1C14A 2HRZA 3ZNPA 3ZWVA 2B0JA 1I8TA 2D3TA 2VUSA 3WTCA 5ADHA 4MPDA 4PLHA 3H5RA 1IUKA 1GADO 2FMUA 2PKQO 3LLSA 4N54A 3VVBA 4B7CA 3S2FA 3L07A 2EJVA 2Y0EA 3QSGA 5G2OA 3IJRA 1FDWA 3Q6IA 2O23A 1VKNA 3S55A 2AW5A 4IY1A 2RH4A 4Z0PA 1P0FA 5IZCA 2G1UA 5HM8A 1Z74A 4Y67A 1A9YA 3ASUA 3QP9A 4FGSA 3ZHXA 3ULKA 3ST7A 4BO5A 1UJMA 1YBMA 3OIDA 4IGEA 5EMHA 4AJEA 4D42A 2OZPA 5DP1A 2B36A 2E6UX 4MVJF 3WWZA 3CTMA 1M6WA 4A03A 3OMLA 4DQUA 1HDGO 4L8VA 5MDHA 1DDOA 1MA0A 3I9OA 3M6IA 3ZH2A 2Q1SA 1T2DA 3RVDA 1E7WA 2OORA 3ZV4A 1GTMA 3R0IA 6ADHA 1CETA 4AJJA 1X0XA 3BA1A 4O59O 4XYLA 3W4JA 1ZZEA 5COAA 4YB8A 3I9LA 4QXMA 3UKOA 5G4LA 1PZEA 4RF3A 2ZTVA 4IINA 3JQ9A 4EJ6A 3RUHA 3GAFA 4ZQFA 4IM7A 4Q3CA 4PLWA 2R6JA 1HYHA 4R68A 1ID1A 1YKFA 3JQBC 1A5ZA 2PV7A 3AUSA 3S2GA 4N5MA 4PZCA 3ZU2A 3LDHA 4UUPA 3HN7A 3HDJA 1R37A 2PZJA 3E5MA 4U6QA 3WIDA 2G5CA 4MIYA 2RHCA 3BXXA 2O2YA 2DM6A 1I3MA 3LC1O 4LMPA 4OMUA 4H7PA 4IDGA 3A1NA 1J4AA 1E3WB 1YS4A 2PZKA 5F21A 4BGEA 3U62A 4CR6A 1U9JA 5JMPA 1E3LA 2EV9A 2DFVA 1EDOA 5IN4A 2P68A 5JCXA 4PZDA 4PG7A 3NTRA 4YYZA 3JD1A 4OHUA 4ZQGA 3PFWO 4E5NA 1NQOA 1DIBA 3W8EA 4JNKA 2QZZA 1PR3A 3DBRB 1N7GA 1DHRA 3GF4A 3OEWA 3WQSB 4ZJUA 4R41A 1LDYA 3ENNA 1RM0A 3T4EA 4E2YA 5KJCA 3G1TA 3K8ZA 1B15A 2ZIZA 2QQ5A 3VTZA 1VSVA 3L9WA 1HDOA 5JNLA 4Y6SA 2BRUA 2Q45A 4PGFA 1EK5A 1H6AA 1ZJYA 3DAGA 2QRKA 5DOZA 1YQGA 2WSBA 2F1KA 4P4GA 1PJQA 4XD2A 1Y8RA 1GPJA 3AJRA 3DBLB 4L4RA 1ZXLA 1E92A 3MTJA 4ALNA 1DFIA 3D4PA 3JD3A 4AJKA 4BL5A 4BNWA 3U4DA 1T2EA 5K6AA 2EJWA 2P4QA 2HO5A 4CMAA 2PD4A 4TRRA 3E48A 4PLCA 1GU7A 3RUCA 3LYLA 3AUTA 4J2OA 2ZYAA 4YT2A 2C5AA 2ZTMA 3JTMA 4YCAA 4ZQEA 4EEZA 3JQ7A 4MVJM 1HE2A 2Q4BA 3PQDA 3PXXA 4A0SA 1X7HA 4LVUA 2HMVA 1RM5A 3ZW9A 4BNNA 1T2AA 3FR7A 4I9NA 3H2ZA 1PQWA 4ZGWA 1VSUA 1VI2A 4R9SA 3TRIA 2HK9A 2PH5A 3CXRA 1Z7BA 4LSWA 3JCZA 4DYVA 4E2XA 5A06A 2DC1A 4GVXA 1XDWA 4BO4A 2D5AA 1PU2A 1BVRA 1I30A 1GV0A 1UXHA 2HCTA 1DIGA 5DBIA 1UXKA 1QG6A 4EEXA 4H3VA 3V1YA 1GYQA 2AQ8A 3IKVA 3LU1A 1M75A 4NBUA 3DL2A 2J3HA 2PGJA 4Y6RA 2JD2A 4BNMA 3PYXA 1LEHA 2Q50A 1R4MA 4RZHA 1QV7A 3ZWBA 2H6EA 4NPCA 4EJMA 2VQ3A 4BO1A 4C7JA 1KEUA 4IZIA 4NBTA 4YRAA 2ZATA 1GUZA 1TT5B 2V6GA 5F1KA 2VCYA 4HWKA 1XWFA 4P38A 1HYEA 3WB9A 3HHPA 3EZLA 1JKIA 2YQ5A 1B3RA 3NTQA 3HB4X 1W6UA 5KKAA 5HWSA 2IDZA 3DBVO 1ML3A 2WE7A 4O63O 4FOSA 2A4KA 3OP4A 2FWMX 4LMRA 5H81A 4YT4A 4BNGA 1RKXA 5KVVA 1P1RA 3HDQA 1P1IA 1WMAA 3C7DB 3CZMA 5ICMA 3L9XA 4CUJA 3DQPA 4YRBA 2CVZA 1V0JA 5FI3A 3OA2A 3RC7A 3JQAA 1NR1A 5DNAA 4YQYA 1T24A 3G49A 2DTXA 4FQ8A 5JDIA 4I9HA 4R5HA 3PQFA 5JW6A 1UDAA 4NBWA 4S3MA 3LQFA 3CINA 4KUGA 3PJGA 1C0IA 3VHRA 4UAGA 4BHTA 5G0TA 3ZN2A 1PSDA 3SC6A 4EI2A 4RVUA 4TKLA 5KVSA 4N7RA 1JDJA 4IQGA 1Q0HA 3GVIA 3GFBA 5U4QA 3CMMA 3TJRA 1HZZA 2O3JA 2DBZA 4XIYA 3WIEA 1PJSA 4XJSA 3R3JA 3ZU5A 2SCUA 1CF2O 2IZZA 3L6OO 4IDAA 2JD0A 5CDUA 1GY8A 2DQ4A 3C85A 2CVOA 4GWKA 1W73A 3ROMA 2UYYA 4RQUA 3K9QO 3KUXA 4QT0A 4W7HA 1ZJZA 2VT3A 3BMQB 4YAJA 4CQLA 4OXNA 4JIGA 4BNYA 1PZGA 1DHTA 3E18A 3Q11A 3KLMX 3RJ9A 4YJFA 3H9GA 1GL3A 1E3SA 2AXQA 1LC3A 4JXKA 1H6BA 2FY8A 1ZEJA 3FPLA 4BO2A 2LDBA 2VZ8A 4CUKA 1DLJA 3QHAA 1H2HA 3DWFA 3SC4A 3VZQA 3QW2A 1B8PA 3JYOA 1DAPA 2DVMA 3MJTA 4IDEA 5EIOA 4QTZA 1GUFA 4U8GA 1V3TA 3RSHA 2FRDA 1I32A 3JQAD 4ZA2A 4DUPA 5JBIA 3DZBA 4YJGB 1PZFA 4FDAA 5HBRA 2FHSA 3JD2A 3CE6A 4INAA 4LN1A 4OM8A 1AHIA 4XGKA 5DP2A 3UH1A 3FNFA 3IMFA 3GT0A 3UW3A 2XXBA 3UCFA 1DRVA 4E3ZA 1ZXBA 4CM4A 1XR3A 3PLNA 5KCZA 4KUHA 3VDRA 2JCYA 2UV8A 4OKNA 5KOIA 1G1AA 1I10A 3PRJA 2GUGA 2EP7A 4J7UA 1IHXA 4M87A 1F12A 3H5NA 5KKCA 3ETEA 2WYWA 3UFXA 3F5SA 1MXHA 2Q2VA 4J9VA 4BQPA 4KDEA 2A94A 3JD0A 2ZK7A 1IZ9A 5EJ2A 1YBAA 1ULUA 3DZKA 3EYWA 1DC5A 2AE2A 4IPTA 4R51A 3E9NA 2EHDA 2R2GA 1ZBQA 4FSHA 4TSKA 1SAYA 4ITUA 3KVOA 3ROKA 1BXGA 2QW8A 2NU9A 4UEJA 3Q2KA 4LISA 4M54A 3PWZA 4CMKA 4S1VA 5TJ9A 4ILKA 1J5PA 1W0CA 2EF1A 3NT5A 5TNXA 4O5OA 5TRTA 4CLXA 4TQGA 1QMGA 1FDSA 3NKLA 2J5QA 3PHGA 4CL3A 3O4RA 3U4CA 3SXPA 8LDHA 3B70A 1N92A 3K31A 1EE2A 2CNBA 5DF1A 1ISHA 1IZ0A 1VLLA 4HFNA 4NJMA 1Y81A 3ADOA 1B0AA 4J2HA 4BB5A 3I9JA 4XKJA 1U3TA 1ZW1A 4XRRA 4DPKA 2FSVA 3JQ8A 1R66A 3RC1A 3PPIA 1GEEA 2X0NA 2YZ7A 4G81A 2ZQZA 1YQXA 3JD4A 1R0SA 4IGFA 5EPOA 1JA9A 2RCYA 4B7XA 4NHEA 3WGZA 4PLPA 2X86A 4A2CA 1DLIA 4J1TA 1P1HA 3NUGA 1LQTA 3U4IA 3WYBA 1GDHA 3NX4A 3KB6A 1I3LA 2X5KO 1BSVA 2ZTUA 4BO8A 4FD3A 3NDJA 3QE3A 3GZNB 1N7HA 3P2YA 3KRTA 4BNFA 4CQMA 3E5RA 5U1PA 4BNVA 2Y1CA 1BXGB 2YJZA 4F3YA 3UVEA 1Z82A 5GMOA 2HJSA 1X14A 2AEMA 3LT4A 4MVJA 4RO0A 3LT2A 4LSMA 4R01A 5T57A 4BGVA 1D7OA 1PL8A 2AE1A 1GPDG 3PDJA 1EQ2A 5HS4A 2E48A 1R16A 4JBIA 5T8KC 4YPOA 2VZ9A 2V6MA 4FFRA 4RPGA 1YL6A 3OQBA 4P8RA 5TSDA 2I65A 1PJCA 2DPGA 3OQ6A 1O94A 4PCVA 2C59A 1N9GA 4TRMA 1YGYA 1U28A 4K1LA 1EDZA 1OFGA 3M2TA 1UDBA 1QYCA 4GI2A 2ZYGA 4IDBA 3UAGA 5A3VA 4XRGA 1ONNA 1NVGA 4RDIA 2GASA 5HTOA 1YL7A 3AOGA 2DBVO 3GG2A 1NAIA 3E82A 3GFGA 4BNUA 4IZHA 5L40A 1TI7A 4RPLA 2IXBA 1BVUA 5IDYA 4ZICA 1PR9A 1LDNA 3PJDA 1OOEA 2I3AA 4MVJG 4M55A 3WMXA 4HUJA 5A1TA 4E33A 1NFFA 1TXGA 3STHA 3FTNA 4PIVA 1BW9A 4FC6A 4Q9NA 2G82A 3EY4A 5IXYA 2G0TA 5BR7A 1QRRA 1CYDA 2GN6A 4AJ2A 2OL4A 1MFPA 2ZB7A 3LC7O 3C1TA 1SB8A 3G0OA 2C5EA 3QA9A 4DRYA 1IHYA 4J7XA 1NPTO 1P1JA 1TVEA 3A06A 4FN4A 4CM8A 5ITWA 2A92A 4GKBA 5BNTA 1P3DA 4D0SA 2YV1A 1OAAA 1DAOA 4N5LA 3Q9UA 2NQ8A 2QG4A 5L9AA 1AGNA 1BGVA 4J3FA 3WS7A 4JN6B 4R3NA 1P45A 4FFOA 1V35A 3ZNQA 1A4UA 3WYEA 4LCJA 3H5AA 3H9EO 3NDRA 5A4DA 7ADHA 5ER9A 1V8BA 4WCFC 4CQMB 3OHSX 4OIMA 1C0PA 3GZNA 4KQWA 3ZHBA 4M49A 1VKOA 4BS9A 4RVGA 4J0EA 1GZ6A 4TVOA 1PJTA 2H1SA 3TFQA 4CMGA 4OJNA 2YUTA 3JQBA 4ZQHA 4L74A 3ZWAA 1BHSA 1WDLA 3HQ4O 5LDHA 5FF9A 3U09A 4GX0A 3GGPA 4NQZA 5LC1A 3Q0EA 4XYGA 3QWIA 1GD1O 1E77A 1GQ2A 1WW8A 3ONEA 3WGGA 2B5VA 4NR0A 1D3AA 4CM9D 3DZIA 4JCOA 1BMDA 1UP6A 1A72A 4E2ZA 5IJZA 1I24A 4WLOA 3BMCB 4P4NA 3PJFA 2I76A 1BTOA 1YB5A 2YHIB 4XYMA 3AM3A 1PGNA 3GMDA 4XR4A 1JKFA 2VRBA 3LSYA 5I8WA 3ENKA 3W8FA 4GMGA 2B83A 4WJZA 1K2WA 4CMEA 4UVEA 3DFUA 3GLQA 1XKQA 1XQ6A 3GA0A 2EW8A 3PVZA 5L51A 1LDGA 2R00A 2H5LA 2WD7B 1WVGA 4EITA 4E5KA 1ZVMA 2Y1EA 4NI5A 4BVAA 1ADCA 2XF8A 3KETA 4PLGA 1Y8QA 3ANMA 1G0NA 1Z6ZA 3K73O 1HF3A 2RBEA 4AJLA 4I5GA 4DGSA 1DPGA 1N1EA 3V2HA 5I7EA 1EUDA 5JS6A 2DTEA 3TZ6A 1Y1PA 4B3JA 3D5TA 1A4IA 2Y0DA 3WGQA 4YACA 2IEDA 1V9LA 1NWHA 5F1OA 5FI5A 4D79A 4QUKA 4YJHA 5GZ6A 2UVDA 3GEGA 5BNFA 2NU7A 5DBGA 4GGOA 1CDOA 3VC7A 2VZ0A 2CDAA 1M66A 2G76A 3UXYA 1DC3A 2D0IA 4W7IA 4WASA 4BIIA 3VPFA 1ENOA 4BNXA 1UAYA 3PHIA 3EVNA 4BNZA 4GLOA 3DHNA 4W6ZA 1MXFA 4WNIA 1E7QA 2FR0A 3GMSA 5H82A 3GUYA 4OO3A 2YY7A 1AE1A 1VPDA 1ZSVA 4IQ0A 5TS3A 3T4XA 3KYDB 3AY3A 3MCVA 2ZCUA 1SEVA 3EZYA 2RIRA 4K26A 4N18A 5A9SB 2I3GA 2V65A 1G0OA 1R15A 1BG6A 2NNLD 1RM4A 2PZMA 4XB2A 4FCCA 3VOSA 5JMWA 3DO5A 3C7AA 3GZ4A 1NVTA 4EUFA 1K89A 4OGWA 4HV4A 2NTNA 4FFPA 5B4UA 4L76A 1E0DA 4GVLA 1QLHA 5A3JA 3DOJA 2C7GA 3JYQA 4Z0TA 1KY5A 1E7RA 3IDSA 5CG1A 4UUOA 3FBTA 1X7GA 2Y67A 1O89A 4BNHA 2JL1A 4FIZA 2X9NA 3F1LA 3HFGA 4YXFA 1OBFO 5KJ1A 4AVYA 5AVOA 1P31A 4KTVE 1GYPA 4AL4A
chains in the Genus database with same CATH superfamily
3IUQA 1TZ2A 3FKQA 4M9ZA 1S2DA 1J24A 5CB4F 3AVYA 1EM8B 5C1BA 4AO8A 1JJBA 3COWA 2GZ1A 2QMEA 3ITKA 2IPLA 2E1RA 3DZ8A 4MR8A 5HG0A 4X7MA 4CDMA 3KQPA 4KR2A 4N48A 3T7EA 4EB0A 2LTAA 4DRXA 3KEOA 1RD4A 1YRHA 3NHUA 1WMFA 1YS9A 3I04A 3ZKWB 3LGSA 2JKYA 1K8QA 1BE6A 3LBYA 2HEGA 1AS3A 2AI2A 3IT0A 1O4WA 4QASA 2YIDA 1OYWA 4D4MA 4QFBA 2JBWA 4QOIA 1NBWB 3D8HA 3T15A 3IXMA 2ZFUA 2CYCA 3S6JA 3RC3A 2RGGA 4BUCA 3ZCXA 1HE8B 3LVFO 4JNCA 4HWSA 2BKUA 1TYZA 3CURA 4J76A 3IQIX 3RNLA 3RRXA 1GNTA 3H97A 1A9QA 2GVDC 2LIVA 4XPIB 3RSFA 3K94A 3NGXA 4BE7B 2O7QA 2V7TA 2VHEA 4YAKA 5HQ3A 1H0RA 1BS2A 4RJ2A 2UZ4A 1QYDA 3B5JA 5ETJA 2FWNA 1J8YF 3TGPA 4YAIA 2J59A 4IJUA 4LQ4A 1C9DB 4K9LA 1QVVA 2UZ0A 2VHYA 3DR3A 3OLYA 3PC8C 4EA9A 3HM9A 4MITA 4ECEA 3ORYA 1KDOA 3BSFA 3HCFA 5CURA 2HD4A 2JRCA 1BROA 3QFSA 3N86A 4LZNA 2C4WA 2HHAA 4W9RA 1EM8A 2QNIA 1G3MA 5TVKA 2YN2A 5CGQB 5GONB 2OM2A 2ZSAA 4OXYA 4UXHA 2WHEA 3ZV3A 5CX1A 3AFOA 1G55A 2Y1FA 3N76A 2F67A 4Y7DA 1AB5A 1GAQA 1K5GA 3LQKA 2TSYB 4MP8A 3U7RA 2H31A 4BNDB 5TX7A 5DGDA 2XXAB 2WUFA 4EX6A 5IVKA 3ZDFA 3CCFA 4D0LB 3CX4A 5E6UB 1J9EA 4GH5A 2YNMD 3EFEA 1OIVA 2PRKA 4KQJA 5HEKA 4FC7A 5DXJA 4YCCA 1KQ3A 4UMFA 4BNJA 1NMEA 1FUYB 4QATA 2PS1A 3CZAA 5LWHA 4ZRMA 1I7DA 3AIKA 2VH2A 5A03A 3R3SA 3GQBB 3BJZA 1FFSA 4MRMB 4DPLA 5K8JB 4ZRDA 3HTXA 2BOVA 2ZB4A 2EATA 3BXGA 2O5RA 4KHZA 4CMEC 3JALA 3PDUA 4IDQA 5NLLA 3TRHA 3CBGA 3WISA 4DV3B 4WCFB 3WLTA 1MG0A 1HLDA 3DEJA 1IBMB 2P2NA 4DLLA 2EFHB 2YYAA 2EG9A 5CIYA 4L15A 1SD2A 1BH6A 3HCCA 2P2GA 3R3UA 3CW2A 4KTTE 2B1JA 3CF2A 4L0CA 1SC6A 4LRYA 4DA9A 2NYUA 3VZPA 3L04A 1I2AA 1PDWA 2B8WA 2I7XA 2NO9A 3MYYA 3TRKA 4L3OA 4Z4HA 2PKYX 1LLDA 1MHPA 1OWOA 2IWHA 3RFVA 4EPWA 5KTRA 4KQCA 2Q5JA 4FBLA 3JYNA 3D4OA 3EFHA 4DV1B 1BO6A 3UOWA 2W4MA 4C9BA 4U2DA 2RBGA 2ZYRA 4OXQA 3GUZA 3QVTA 3TGWA 3UYKA 3ELYA 1KC1A 1JU9A 1E3MA 3OOEA 1C1XB 3IUSA 2XD9A 4OI4A 2OB2A 1WSBA 4W9NC 5EN4A 1W94A 3FPSA 3BSSA 3I9V1 3KPJA 4FP9A 3R7NA 3V4PB 4EPYA 4ER7A 6PFKA 5A62A 2OE2A 1FSSA 1NJSA 2WWFA 4FR5A 1WUTA 3R77A 4Z3DA 2Z5LA 3W06A 1II0A 3NZEA 5KNDA 4YV7A 3GBPA 4Z6KA 1TVCA 2FUKA 3AZQA 3H5WA 3TJZA 5ALNA 3NHSA 3A28A 3IJPA 1PT6A 5E9JA 4CDNA 5I47A 1UEXC 3FFXA 5DDIP 3ZBUA 1YQWA 3F96A 3MXTA 3OQIB 4YCDA 2ISSD 1LDEA 1UAGA 5BPFA 4EJ2A 1YVRA 4YRCA 1JEDA 4DGQA 4QQFA 3UXEA 3PGXA 4XEUA 1U8XX 3F74A 4FBMA 2BTQB 4HRXA 4KDFA 2WIAA 5AHKA 3L6CA 2JFHA 5F1PA 3A6EA 2VNKA 4NE7A 3RIMA 4A23A 3GPIA 2DUWA 5FFFA 4OQXA 2RJOA 3K1YA 4CKEA 4GUAA 1HRDA 1N2IA 3P26A 3C7KA 5IU6A 2LP4Y 5I9SA 5CYFA 2VDPB 1VIMA 3V4LA 1U8FO 2GERA 2Q9AA 3MAGA 4L8GA 3EY9A 1JB9A 4AJPA 2X8WA 2R6DA 1BMFD 3LGXA 3MTIA 4E5SA 1OUMA 4G5SA 3BIWA 2R00C 3GLKA 3L43A 3Q12A 3WYFA 3JZIA 5KWEA 2P9BA 1NX6A 3QVGB 3UV6A 4UPVA 3BXZA 1DC6A 1W59A 2G1KA 1NI5A 3Q7SA 3I1IA 4HVTA 3KLPX 2X1VA 4D57A 4J7AA 5BO5A 3A2LA 5C8ZA 1J33A 2HDWA 4JVNA 5AKLA 2HSGA 1Z6QA 3DT8A 2KPOA 2FN7A 3QW4B 2Q46A 1AY0A 4O1HA 5EWJA 4ERNA 1WD7A 1OXKB 1TUBB 2VH1A 3HM2A 3S7TA 4S0ZA 4TVSA 2K7FA 2CXUA 4A5OA 4YMUA 4UBLA 1C7RA 5AVKA 1QFZA 2YWRA 4ETIA 1Q14A 1XCGB 3OCUA 3VNUA 3IP5A 4IP0A 1Q12A 2WP8J 1Q1NA 2IOFA 4LMAA 1M1NB 2B8JA 2IX9A 3H17A 1DOAA 4G6ZA 5CH3A 4CPDA 1P0CA 2UZ1B 3OM9A 3ZQKA 1Q7CA 3NC4A 4Q48A 2B3TA 1YU9A 1CEXA 3TLBA 2ZJ1A 1P9OA 4K6KA 4MVJI 2C99A 4WKCA 3NUZA 3V4SA 5L45A 5K99A 2CXXA 4RDCA 3PZRA 1L5FA 4DG8A 3ZS8A 5KOJB 1CS0B 4ZT6A 5BSUA 3VPAA 3OA0A 5HFAA 3ZHTA 3ANNA 4R8SA 3CZRA 2O8BB 2ZJ0A 1QB7A 2QMUA 4O2AB 4DB2A 3K0AB 2TMGA 2NTJA 3PT5A 3S2ZA 1MGOA 4UUBA 2XAAA 3FGZA 1I33A 3C6ZA 2C57A 3HH8A 3MJSA 5C4GB 3T7DA 1ZISA 2ODQA 4F5EA 4R16A 3ASVA 5TXGA 3CLUD 5AW0A 3DOCA 2QENA 3WGYA 4IIDA 5G1OA 4H1WA 4IO0A 3GJTA 4F9EA 1IRIA 4EY3A 2X9QA 4JVSB 3PXDA 4G5QA 4M60A 4XCXA 3P9SA 2ZYWX 3GRRA 4I55A 1Y5RA 3DMHA 1F5NA 2G8NA 2AZMA 1NC1A 2WYUA 2CBGA 1ZL0A 2WPNA 1V47A 3CRRA 3OPMA 2GFIA 3QX9A 3CKYA 4C3OB 5CCBA 3PDIB 1T15A 4PZPA 1OX5A 4R8KA 5E0OA 2Q4EA 1U2PA 1TK9A 1ECCA 2CB9A 3P19A 2JD1A 4S2EA 1KEZA 2G4VA 4JXZA 5LBUA 1QTIA 2OO5A 1QSGA 3BKXA 1PFQA 1YZTA 3PRYA 5FQNA 1CLUA 5AVTA 4Q9LA 1C0LA 2GN9A 2JLRA 3JPYA 4QEDA 3AP1A 3X1XA 1M6YA 4HAXA 5IM4A 4GSYA 3IHKA 1E32A 1HWYA 3EIEA 4B31A 1QP4A 1B74A 5AI8A 4NENA 2OA0A 4WTOA 3HY6A 3BMXA 4RHYA 1WNTA 4UXJA 5DCUA 2BEKA 3EFOB 5A02A 1TLTA 3UK6A 3WRWA 2UYHA 3TXXA 4TSFD 1T9DA 4IKOA 4CTMA 5FUWA 3DG9A 4XWWA 1KR5A 2MINB 1YA6A 1T3HA 2YFYA 4QGHA 2IYEA 4D92A 8GPBA 1QGYA 3NHRA 3IIKA 13PKA 2RAVA 4X6UA 3RWBA 3BWMA 5HQTA 4FDTA 3IRUA 5LFAA 1WXHA 4JI3B 4EX7A 1Z63A 4O4IA 1JS1X 1VYVA 4FLEA 5FX2A 5FFMA 5BOSA 2A88A 5ECDA 1A5TA 2W2TA 2WAMA 1RYZA 2JIMA 2PXCA 1L8QA 1VGQA 1I0IA 4JEUA 1Q91A 4A4DA 5J4VA 5LU8A 3W79A 3V55A 3MT9A 1FFGA 1XTBA 4FDMA 4C0BA 2QP9X 5ALFA 4LY3A 1KQPA 1GQYA 1R8XA 2YL2A 5EYPA 4EPXA 1NUQA 2HCRA 2I33A 2C4UA 3IRVA 3NUQA 2H92A 1FUUA 3N0XA 4PLVA 4JOBA 3AVWA 5IARA 3ODGA 1DOZA 1O5OA 3C7CB 5DCWA 3IALA 3ZBQA 5F35A 2QT9A 1JDPA 4UOEA 1DS6A 2A9JA 1B2LA 2QLBA 3GDHA 2IU0A 2BFBA 1XGKA 2J0QA 2V7PA 2ZVDA 3LO8A 4PG5A 3AOEC 3AY0A 3MS4A 3QVVA 4AX4A 3HP1A 3PD1A 4UBKA 5ITZA 1TM3E 1U2QA 4YIHA 1AZTA 4G1CA 2IK8A 5BR8B 4IRMA 2WBLC 3CNBA 3U80A 3EULA 5AP9A 3RGWS 5JZMA 2A0WA 1P44A 1UK9A 3WB1A 4GKVA 1IY1A 4TLAA 1NI3A 1W4AA 2H4YA 4FGJA 1OKKD 4TV9B 2P75A 3CRNA 1EUZA 1A96A 2FPIA 1RPJA 1XRRA 1NUAA 2BPOA 2RIPA 1GQOA 2IU3A 2WG2A 3QMVA 4JJ6A 5A5EA 4I2NA 3SM9A 4E6PA 3HB4X 2L42A 4BO0A 4NJEA 5CM8B 1Y1KE 4TOIA 1YB2A 2GLTA 4Q9AA 4I2VA 4RJKA 5JY6A 3GLFA 3S8YA 4ACBA 1UXGA 4I4TA 1HBJA 1GSOA 2Y9MB 3MCTA 2XB6A 5JD4A 1P0IA 2DCMA 1OAOC 2XYQA 3IE2A 2XSZD 5A04A 3ISJA 2N42A 2ECFA 3ICCA 5FAXA 4ZYTA 4BNDA 1ETHA 4LVNA 3VC3A 1CP2A 1O97D 1JPJA 1FFHA 2IYZA 3NXKA 5CGZA 1NVXQ 1Q1QA 1TKRA 1G63A 5YASA 3LDFA 5IDWA 5IC6A 1CWUA 3CR8A 3DOEA 4U02A 5E6SB 1ZOIA 4WKBA 3BMOA 2NUAA 2YNMC 2Z9DA 1IQUA 4NCXA 4GDFA 2GILA 3NS7A 3O4GA 2CXTA 1HM5A 1MPTA 5CVCA 2DG2A 4PYJA 2G04A 4RM3A 1YHYA 3OPXA 4Y2SA 1S2MA 3TOSA 2QB5A 1LLCA 2AMLA 2QQEA 1LVGA 3B12A 4MRPA 2EX0A 1EXMA 4OUDB 2OBNA 2BI7A 5TJ9A 3UF0A 1HE1C 4AUEA 4N76A 2YWGA 2ZANA 1N2SA 2B0CA 2IXAA 1J99A 3LK7A 3LUBA 1JEYA 3GC6A 3B6ZA 5LQNA 3F5QA 4IICA 4FYIA 2AZXA 2AQIA 2JLAA 4DV2B 4RWZA 1Z7EA 1CJSA 1IYZA 1LBHA 4F45A 2Y0PA 2DZDA 4R54A 2GM4A 2IU4A 3OPYI 1N33B 3SNKA 2MU1A 4WL0A 5HUHA 3UAXA 2GDZA 3D4NA 3ELBA 2AG1A 2P9TA 1DC4A 1JR3D 1T25A 5GIOE 1OFTA 1Z5NA 3RVJA 4YCSA 3UGTA 3G79A 2LCIA 4R2KA 3G8DA 3MW8A 4WZAE 1W2GA 4OHYA 1YHZA 2EFGA 4BQNA 1OGIA 4E2FA 4QWMA 3OESA 4Z9XA 4CMCA 3HJAA 3WYEA 1P91A 5FYQA 4ZARA 3H7AA 4LXHA 4UAJA 3HO6A 4EO7A 2L2QA 4TXLA 3K8YA 4YUWA 3GGJA 2H7CA 2P78A 1KMIY 1W1UA 1F8XA 1NASA 4K2HA 1BE0A 4YGYA 1Y1RA 2NV6A 3I83A 3C24A 2NSDA 2WABA 3NV9A 4I4CA 3KWLA 1B26A 1HLPA 2GK6A 3BFKA 4E2WA 1K6XA 1A4RA 4L7QA 1V4VA 4C89A 5HKKA 5D85A 3UAYA 2Y77A 5J23A 3OU2A 1SVUA 2FF7A 3I62A 5JDCC 4D3DA 1AQLA 1HTTA 2C83A 1N2OA 4PX5A 5AJZA 4DQLA 1LI4A 2NVWA 3D2BA 4BWYA 4CHTA 4JEMA 1M72A 3CJRA 4K05A 4J9UE 4RHCA 4Z0NA 4DMGA 3I72A 4JB8A 1EQUA 2HQSA 2YN4A 1GIAA 1Z68A 1ILEA 1XVLA 4BATA 3FKSD 3N87A 4C7KA 5HSGA 1PTJA 2KQUA 4ER3A 5HIAA 4PX9A 3MIZA 4WRRA 2DUUA 5HIMA 3VPCA 4TYWA 1QO7A 2BFFB 3OZTA 4D02A 2G9VA 4CE6A 5IDQA 2OESA 1XZLA 5IAJA 1KYTA 4KKVA 1CUVA 1RT9A 2OWDA 3D0RA 1OWNA 3C8DA 5DBOA 1IH8A 5T4EA 2A9RA 4DQVA 1TMOA 1MR3F 3NJ4A 4Z0HO 1F7UA 5DGXA 5AKJA 4JXJA 4HX5A 4M2LA 3RF6A 5GZ3A 4PTLA 2P69A 4MDYA 2C0PA 3THWB 3DLHA 1D9XA 2R6CA 2HWYA 4CWAA 3CVYA 3EJ6A 1FDOA 3BIFA 4ZCPA 1RPNA 5AM3A 3FBGA 5AMXA 2HUPA 3UM9A 1KH1A 1K75A 1NW5A 4JD5A 4JKYA 1O95D 3N6XA 3FGNA 4L8WB 5TQ0B 4P4SA 2XT6A 4IOJA 2X6TA 1CY0A 2WIFA 4L0MA 5AW8A 3GJ3A 4FJ2A 5BUCA 2VPIA 2XVMA 3OFNA 4U2BA 1AKNA 3RVBA 4YLYA 5J1SB 3BK7A 2PUFA 4LGCA 4ND8A 4NU0A 5CPBA 4Z1OA 2NQ2C 5K3DA 2VP6A 5CVVA 3F6CA 1Z6PA 2BEUB 3WBBA 2GETA 1ZJJA 3IVGA 2FW7A 4BLSA 3D7MA 5HKBA 2ZYSA 1Y9EA 3T9EA 1K6EA 1V3VA 3PFHA 4ZC1A 3TK1A 5KAPA 3SYNA 3IC5A 4IUDS 4OATA 5CLIA 4WXMA 4WESA 3C7TA 1VB3A 2ZB3A 3MWEB 3ZLTA 4ZDJA 1PWZA 1V5EA 5EC8A 1KHHA 1W88B 3PWSA 2PZEA 1E5LA 3B1WA 3HDTA 4IJWA 4JZYA 4Q16A 3ENWA 3DKVA 3ZXSA 1CJCA 1HDXA 3K0SA 5K0SA 2YZKA 4HDMA 1G6KA 3R20A 2QRHA 5T8KA 5TV2A 4LF6B 3M4YA 3EX7C 4W6QA 2W98A 2V0CA 3D6UA 4R0NA 3AM1A 1NSYA 2ECOA 1QUEA 1RM3A 1YMQA 3M7IA 3LP5A 3PUJA 1OXXK 2O2DA 3I92A 2PA3A 1FZQA 2FFJA 2FJ0A 2V3VA 1UDCA 1C1HA 3DMYA 2XVXA 3AR8A 2FP4A 4IJVA 4ID3A 2Q0XA 3HU2A 3T9CA 3E2IA 3C16C 1U1CA 3SR3A 3O21A 1Z0KA 3AHCA 4KQXA 3FZGA 3WC4A 3DAOA 3C70A 3EB9A 2X4GA 4LK3A 5DHPA 4EJFA 1SRQA 2QORA 4ZO9A 2YRWA 3AETA 1CUXA 3CEHA 4PG6A 1A5SB 2VF7A 3HWRA 1E6LA 4TS3A 1SPBS 1PW5A 3WDLA 5ICEA 3IEMA 3HJFA 3QLVA 5JCZA 1VJ0A 4X63A 1U0EA 4CFSA 4HNTA 3IKLA 3TE7A 1HK7A 3N5KA 1S6YA 1CQJA 2HQBA 4BMYA 2YYYA 2IE0A 2WOOA 4UVGA 1P6UA 1W85B 2P3OA 4RK5A 3SBDA 2OV8A 3SVZA 4B3MB 2QM0A 3VKHA 3KR2A 4EVSA 1KO8A 1QC5B 4TM7A 3RAJA 1DQSA 5F52A 1DEKA 1OBCA 4YP7A 2JJYA 3VU9A 4HYEA 2BFPA 3FH0A 5K3AA 4RABA 4J90A 2ORVA 4CI9A 4XVCA 5CBKA 1XHFA 4DR5B 2GNPA 4TTPA 3J80A 1URPA 1JJVA 4RTLA 4MYUA 2D7JA 2R8RA 4TV9F 1T3GA 4TZTA 4FMBB 3AHEA 5AKKA 2VP9A 5AVUA 2VJLA 4BYMA 1F2UB 3OI7A 5JJKA 2DWOA 4WFJA 1A8HA 1KAQA 2PVCA 3QFRA 4FX5A 4LPKA 1U0BB 2XXAA 1QP8A 3CLTD 1R0KA 5B6JA 4MUHA 5CB8A 5CX4A 3V8BA 1G59A 3ZWMA 1RLJA 4ZZ3A 1QOQB 3K0BA 2DGDA 1HY3A 2EFYA 1V6AA 3KALA 1BWRA 4OHKA 2XE8A 3D7LA 5D8DA 4CKEB 5LDDC 4HYYA 2PGIA 5KQLA 1BFUA 3WP1B 3T0IA 4B09A 5DLYA 3ZTYA 2ILVA 2JANA 2NU8A 2WHRA 3DBHB 3DR5A 1R0LA 5KMGB 3JQ6A 2OCBA 1SZDA 3WLMA 1ZPDA 1Z4MA 1SNYA 3IQXA 3FVTA 3OEYA 3RDPA 2VK8A 2DE0X 5FQOA 3C3AA 1SC1A 3K15A 4PZEA 1E0SA 1P7CA 4ESHA 4UBIA 1G8JA 2RHLA 3BMOB 4MMXB 2ZRJA 3KQHA 3K16A 1XCOA 3GW8A 3ONDA 5EZYF 3DKRA 3ISVA 2M2IA 4M38A 1WKBA 3NWJA 2C7PA 3PX2A 1RQ2A 2DFDA 1GA4A 2AUTA 4D56A 1NJ1A 3GPBA 4KR7A 1AUPA 3KXDA 4EUKA 1PNQA 1X15A 2XOXA 3VRHA 4KAFA 4Q15A 3AHJA 3ZCUA 1VE6A 1NI4B 1KJ9A 1V48A 2Q5OA 4L0QA 3EXHB 3OZCA 1QCZA 3RLFA 5EHIA 3E35A 1BZYA 3P5SA 4Q6WA 2BM1A 4C7VA 1DDGA 5FWYA 2VHQA 2OILA 3TSZA 3K9HA 5ICCA 5I3CA 1YTUA 2VF2A 3HB0A 4D41A 2YDYA 5AHWA 4ZD6A 5BSHA 4FE7A 2WVHA 4UATA 5G41A 4YCJA 4LOHA 1Z9BA 1X7WA 2P35A 3ML1A 4HB3A 1XRLA 3SNHA 1N8TA 4IQ8A 5H3CA 3T7SA 1F06A 1Q7EA 4MUXA 3GVHA 5L3QA 1V8PA 2ZI6A 1F7VA 2OQ2A 3NHFA 4LGVA 1WCV1 1YJXA 1K98A 1WXEA 3CX6A 4AJNA 2CXNA 2QX7A 1UJCA 1C1DB 4C5BA 4CLEA 3O95A 4MUKA 2CLDX 3MOIA 4E5NA 4CQLB 1PG0A 2C8JA 3D8RA 4MWGA 1E96A 3CO0S 1H4TA 3F4KA 4PPQA 3AXTA 2RAFA 4BP3A 3WNZA 2P67A 1C1YA 1R6TA 2XUQA 3D6MA 4HRAA 4F4JA 1T9CA 4MRVA 4O8CA 3NIFB 2J5BA 5EP3A 3DF7A 1MB4A 1AXRA 4YREA 1VFNA 2PX8A 3KYBA 3DBHA 4U7FA 2QJOA 5BSFA 1T2FA 4R1OA 1CEQA 2X3FA 3VR3D 2BMDA 1JTFA 4B3HA 1YE3A 3FZYA 1JVBA 1A4XA 3KEFA 3VO8A 4DYDA 1LLFA 4OGLA 3DQZA 4K40A 2HJWA 5JTTA 2WW8A 3SZ3A 2PEYA 1ZRHA 1Z8HA 4KZKA 1LDMA 3K9WA 3GP3A 1DTWA 3S5JA 2BFCA 3O31A 3BHIA 4X3PA 4UUNA 1DAFA 3I2FA 1EVEA 1V16A 3U44A 4W1RA 4B6SA 4TZ6A 1N2BA 1XTUA 4AJ4A 5GWXA 4Z4IA 4R2XA 1C8VB 2HPZA 1M2GA 1ZOSA 3DE2X 5GP1A 2CFSA 2W0MA 1Q0SA 1WXGA 2HTEA 3K6KA 3IP7A 1AO3A 4GX2A 3ICPA 4JAVC 3Q6NA 3UNXA 2Y6UA 3V1NA 4UD2A 4YJ2B 4IYJA 3ZYZA 2NX2A 1EFVA 5DO9A 2XNDA 1H93A 2GMWA 2PD3A 4JLPA 4KGXA 4BUZA 2WTUA 1IATA 2ZR0A 1NLMA 2MCFA 3MMZA 4U9HS 2Z1DA 4WXHA 5E3JA 2OGZA 4ALIA 2L19A 1NNUA 4L6IA 1EK6A 4DVGA 3VR4A 5TEVA 1G21B 1UQTA 5LQJA 1ZH4A 2ZOSA 2JK1A 1R4ZA 3U7GA 3VZBA 4YIKA 4PYLA 4M1OA 1Z26A 1CD5A 5TIIA 4NEHB 5IWCA 2X0FA 2DT8A 2Q9UA 1QE3A 4PO3X 3G2LA 3WJ1A 5DI3B 2G0NA 3T1NA 1S0UA 1W48A 4MICA 1WVIA 4KQKA 2EYQA 4M6WB 1NYLA 1TM5E 2HJRA 3VO1A 1E6CA 1QFSA 4YROA 4RPJA 2OENG 1AZLA 1ETUA 3OJXA 3IAHA 3LOPA 2WAAA 3CG0A 3DE7X 3NEPX 5DWQA 1WUJS 4DBLE 1ZS9A 4PN3A 2W2LA 3MWGA 2PGOA 4PX3A 1NP7A 2QTAA 1ZM3A 2HLDA 2I71A 4MR7B 4MUIA 2EBHX 4KCGA 5E8RA 5FNVF 1S1MA 5BQ5A 5TDHA 4TWRA 2Q99A 4J0DA 3DTVA 5LMUB 2XTNA 3QF4A 4F8JA 2BC9A 1L0BA 2CUNA 2X8BA 3OPVA 4U63A 4AIRA 5C3UA 1R12A 1CSEE 3BTVA 2QAGA 5AK3A 5DLDA 3WL4A 4NX2A 2XEDA 1XRJA 3ANYB 3C5EA 2FUCA 2AA3A 1LU9A 4D5GA 1S8NA 3Q8WA 3SLGA 2OHJA 1FU4A 1JR4A 4G85A 4DIFA 1NVEA 2B82A 3DBOB 5CITA 2WSIA 4YXWD 2SCUB 3OIUA 2Z4TA 1I4TD 4MQ6A 3K0AA 1THGA 2VRCA 2I2XB 2FP3A 2XSZA 1V8DA 3GFVA 5FPYA 1UKEA 3BJMA 2IZ5A 4TWZA 4S35A 2WMDA 2GXQA 4QSHA 1J42A 3DZCA 4PHCA 4FFLA 1E1RD 4I4TF 4WDRA 4C4AA 2PMKA 1ZFNA 5EJIA 1S5PA 4XDZA 1MOQA 3DE5X 3OY7A 4M36A 4QPCA 4Y3UA 3V1KA 4Q12A 1DX9A 4OI2A 2C3OA 5KCMA 3TIGA 1L4EA 1T34A 1YS2X 3EARA 1QB8A 5DWDA 1RMYA 2A1UA 3N05A 5D87A 5DJ5A 3DGFC 1Z18A 3FOZA 3PFNA 4JT8A 4D4IA 3BMNA 4LTNA 1NU8A 3KJNA 4EW1A 3QUTA 1QC5A 5HOEA 1PFUA 4NPAA 3RVRA 2BCGY 3UO8B 5FRDA 1P0QA 1Z39A 4EDFA 1O94C 1QP0A 5HF5A 2YY6A 2JKVA 3GG9A 4HBGA 3KELA 3SY8A 3NXSA 1Q11A 4LJLA 3UMFA 4CLOB 3V2GA 1PVVA 1PJ8A 2QTNA 3GN2A 2EQAA 3H6GA 4PO8A 3EEBA 1O96A 2P4SA 1M54A 1Y8RB 1UM8A 3DBLA 1U0NA 3INYA 3MC1A 3PIRA 3V1LA 1X80B 1OYOA 1RHJA 2I4LA 2AOTB 3PHHA 3AJAA 1G3UA 3LDUA 3ONVA 4JJFA 4PLZA 4G4SP 3TVTA 5HR5A 1GAXA 2C3PA 1TKAA 1JWAB 4EYOA 4L07A 4CM8B 1YAHA 4QLOA 3VSCA 4X1KA 5LA6F 1M2VB 3GPCA 2CDBA 2H1IA 2F55A 3MAAC 1KJJA 2WZBA 3HY4A 4XTRA 1QPZA 1K5PA 1PTJC 8OHMA 1NVMB 2EJUA 2O0KA 3LC0A 2XUOA 3B38A 3LH5A 4WOKA 4RSGA 4XI9A 1AB6A 3L1HA 1TTHA 2IPNA 4AY5A 1GTZA 1XFDA 4FKZA 2B4RO 3RSCA 1XRNA 3BGWA 1DCKA 1NLZA 2NXCA 4PVDA 2FWIA 4TUYF 4RKEA 4BKPA 4JJIA 4EKGA 3HKEA 3Q85A 3HJNA 4UEWA 4GXRA 1RBQA 5A4MS 3OOWA 3ZVKA 5FADA 2AH5A 4IX1A 1U2DA 3D3KA 3EF0A 1RACA 3SKYA 1RJWA 4HXEB 4PRLA 2OCYC 2VAMA 2XZPA 3B7GA 4FYYA 3V2UA 3ZV7A 2ENWA 4IGKA 5TS2A 3ZUGA 1NV8A 3VJMA 4IIJF 4L73A 3EGXB 1NBEA 2JDIA 3IDFA 5EWMA 4Q6BA 4DV0B 5JYBA 2JBAA 4MYRA 3RK1A 2JFXA 3NTLA 4AICA 4LOJA 2B99A 3RC9A 4RE6A 3PKZA 4O2LA 1KWGA 2ZU0C 4HUTA 4CMIB 5HA5A 1ISMA 5BWCA 3VU1A 1JVSA 3KDPA 3PFGA 3JRNA 1XAJA 1I1OA 3O8OB 3MBIA 2QZPA 4XYEA 5EZYB 1R0XA 2I55A 3SJCA 3HJGA 1D6NA 4LVOA 1JA0A 3GJRA 1T8UA 3IP3A 3O8QB 3P0HA 4GVPA 3SF0A 3BB4A 1RKVA 4D9HA 3QJ5A 1IPFA 2ZPUA 5JJIA 3JQCA 2LR0A 1F0PA 5GTDA 4KGZA 3A2KA 3RJ5A 2WUVA 1EI9A 2FXVA 2BP7B 2P6MA 4KPUB 4P81A 3KUCA 4WEQA 1ZKMA 3A25A 1E4EB 2BF7A 1E1CA 4LDZA 5F3WB 2PJZA 1WZEA 3F6YA 3OU7A 4FCWA 3PQCA 4ZRNA 2IEIA 4G2NA 1E1MA 1XZGA 1F4PA 3FCAA 1T1SA 5HJ2A 1M8FA 1N5DA 1Z4IA 1PYGA 1BKDR 2BHTA 3NWEA 4Q7QA 6YASA 1M0WA 4AMGA 5TF4A 2BFFA 4OMDA 4E1AA 1G2PA 2X2FA 5AOCA 1KSHA 2FFHA 4JCCA 1KYZA 1Y1SA 1YQUA 5FBQB 3L06A 1QRUA 2BW0A 4XQGA 3LO5A 2FRXA 4MKGA 4X1OA 1UFQA 1QFJA 3MA0A 1FB5A 2ZR8A 3QX8A 1F2TA 2ZIGA 2IHUA 4RANA 3SEFA 4D98A 4M98A 4RZUA 3RRJA 3GJ7A 1GJRA 1UH5A 5IMSA 4LE1A 2WM9B 3N2KB 1TEVA 3GA5A 3NRBA 1XF9A 4IF4A 2H3EA 4K87A 5DN9A 1MOSA 3W1WA 3SIWA 4XDYA 5H80A 1YQEA 2PWBA 5DCYA 4A3SA 5L3RA 3W04A 3WRYA 1XIVA 4DZTA 1R0ZA 3NC0C 2AYXA 2BFMA 3I9FA 3BQMB 3GCDA 5LLDA 2VLIA 3QWBA 1YI0A 4CT4B 2ODEA 2C9OA 1O57A 3SP1A 2PUDA 3IAXA 4P34A 4Q05A 5FPQA 2V3CC 3EZXA 2QR5A 4FX2A 3A6KA 1U6KA 1Q6YA 1RWWA 1D6SA 2C4TA 4B4OA 4E13A 1XZBA 4DR6B 3VZDA 4JP1A 5TPWB 2PNFA 2R5FA 2JW5A 1ISPA 4KYVA 2HM7A 2ZJ8A 4JVMA 5DTEA 1JDVA 3RTGA 3I45A 3F47A 4GL4A 4INPA 2XE6A 4R9RA 2EGGA 5TVGA 4Z9BA 3B6JA 4Z5XA 3KQNA 1EINA 4W5RA 5IF9A 4PZ9A 1TT5A 5FHRA 3I2HA 5KNCH 2YV3A 2C2HA 3MB5A 1C29B 3WJAA 4XLTA 1QJCA 1MG5A 2XPCA 1D6MA 1G3IA 1UANA 3LUGA 4MIKA 2HRRA 4PEVA 1NDQA 2EG5A 1L4HA 4KV7A 4P32A 4EHLA 3V3TA 2GJAA 2N9UA 1XZMA 1MV5A 2HHHB 4H4CA 4FDLA 1L7QA 2IE8A 4Z7QB 3DMRA 3FCUB 4MA5A 4DRXB 2QN9A 3OKCA 5JXGA 2C88A 3U9TA 4W1PA 1JHDA 5H3LA 4RVSA 4XVRA 3UB4A 5IF3A 1OX4A 1QYWA 3PXEA 4GR9A 2GPTA 3IGFA 1F3OA 1GU1A 3PHJA 2WIKA 1XEWX 5KHAA 1K8ZB 4WECA 3ABZA 1RC1A 4M1QA 1LF5A 1N7IA 4ZEWA 4RTSA 3G0BA 3CUYA 1NIPA 4ZOLF 3C1AA 5C7LO 1V95A 3FRJA 1PJ3A 1DOHA 3OD5A 3MMXA 2B1QA 3W2EA 5EJ9A 3UMCA 5BWMA 1QF6A 4FYPA 5FWXA 3DXZA 1OR8A 3H75A 2I8LA 1QHIA 1MC5A 3RYHB 3Q3JB 4BVLA 4YJ2F 2AUNA 2HXYA 3L4SO 3P97A 1R0WA 1U3CA 2AN9A 2VT7A 3G9ZA 2GCIA 3GROA 1JQ5A 3SICE 1IQRA 2NPOA 2G63A 1JHXA 5DCLA 4DEYA 1OIWA 1KR2A 4RHEA 2V8OA 1YHNA 2A7QA 2JZOA 3RODA 1YKGA 4KQIA 4WE3A 2XKJE 2F9MA 4UE6A 4AX8A 4E7PA 1JJIA 5BQXA 1GPUA 2UVPB 3I2KA 5ALSA 2QLFA 1EHYA 4ALKA 3T1TA 3EODA 5KB3A 1A9XA 1TADA 1G4UR 2Q0QA 4BXOB 3SZRA 1KGSA 4IJQA 3MWDB 2QRZA 3FB4A 4YT5A 3ZI0A 4YCNA 1M34E 2O0MA 2CVQA 1U3UA 1R6XA 1AX9A 3DMTC 3FFTA 2BD0A 1PCXA 1BDIA 4XX0A 3PDHA 5DRYA 1NR7A 3LE8A 3LX4A 1E3EA 2FZEA 2ETVA 4QYTA 1EIWA 3DGEC 2IHVA 2FZWA 3O7WA 1JEEA 4UUMA 4QRDA 4LNUB 2JCVA 4RSRA 2BR4A 5IYZF 3TLEA 3DOUA 1KS9A 3TTXA 3DEZA 4D0NA 4EY4A 1B6SA 2FZ5A 1M8JA 3R23A 3ZK9A 4ND2A 3T06B 3ACBA 3GH3A 4EHAA 1Q0LA 1T4CB 1KZ9A 4MAFA 1O9BA 2Y71A 2O3TA 1CFZA 3L6EA 4HGNA 3SDZA 3UWOA 1PX0A 4D4GA 3JYPA 2HUNA 2JCXA 4YR9A 1S8FA 1I2ZA 2Z4SA 4HTFA 2CLLB 2G3YA 3PE6A 4JJKA 4GNKA 5JNTA 1DVRA 2XH8A 4G8CA 3RVQA 1UJBA 1QZZA 3ZD9A 3GLGB 2O0HA 4QBKA 2W4QA 1J0EA 1ZLYA 2AJDA 4D6XA 3G2NA 4I8XA 3SYRA 4O3MA 1RXYA 3TM5A 1UM9B 2HXSA 1TU0A 5CEJA 1WLSA 4FBGA 4O6VA 3DTNA 4X8HA 4KFUA 1SXHA 2PEZA 3N0VA 2GHQA 3GEIA 4H15A 4I81A 4E22A 3HMKA 3R7SA 4A7PA 1E1KA 1WXWA 2I4MA 4BFSA 1IEQA 4BV8A 1PSWA 5AW2A 3BCRA 3U1TA 3LT1A 1AN9A 1GP2A 3BKWA 4CM4B 2WKWA 2VWPA 3PUWA 3DXXA 4QO7A 1CFJA 1WG8A 2W71A 1VL0A 4AY4A 5CIWA 4FZ5A 1PNRA 4B9AA 2H4ZA 1YBFA 2WU8A 3PICA 2PLAA 3Q9SA 1ZH2A 2QKYA 4QYMA 5EIBC 5AW9A 4TV8F 4CCAA 5AUPB 3F1KA 2FZCA 4J0KA 1DL5A 1G20A 2V7UA 1DU4A 3KPYA 4CNQA 3RGGA 3MJVA 2WNSA 3G1UA 4F38A 3NYIA 3OKAA 3AI2A 4Q3EA 4WAUA 3SPXA 2WYHA 3NIGB 5TMEA 3T3HA 4TMKA 1E2LA 2WQ6A 1YJQA 2ZW9A 3EPHA 4RJTA 2ZPTX 2OR3A 1GZUA 1IB0A 2HK8A 3M4JA 4RLHA 4Q4AA 2KW5A 2REXB 4MQLA 3WLRA 5ICGA 3OQJA 5EQFA 3IPCA 2EBUA 1Q83A 3ANLA 3HVKA 2YDXA 4GI7A 3FYTA 3QLVC 3QEBZ 4LF7B 3E7FA 3AMVA 5KDOA 2WR8A 1N2HA 5BRAA 3HB1A 4M21A 3DM5A 3F6BX 1C7FA 1YJ8A 2A9QA 1NX9A 3QELA 4L16A 3SDBA 1JQDA 4N8DA 2QI9C 2GXSA 4FEEA 3O8DA 1LD3A 2C9MA 2PUHA 3Q40A 4BO9A 4YAUA 1X1AA 2JGDA 2QYOA 2NU6B 3HB5X 5D00A 3SOZA 4F6LA 1NP6A 3RHFA 3TLAA 5THKA 1EAMA 3PK0A 1DJLA 2GTPA 2I7DA 5AUNB 3QYJA 3CUKA 2J0VA 2SKEA 4KQ6A 4ND7A 1CUGA 5K45A 3SVTA 3O73A 3HRKA 5B12A 2AFIA 4HRYA 5IH7A 4JV5B 2FOXA 3OZVA 1E1RA 3DC2A 2DQZA 2RGNA 2WUWE 1U04A 4HFMA 4LRSB 4CW7A 4DCCA 1LS1A 2X7XA 2JH3A 4LI3X 3DMPA 3VJLA 1FVOA 3BHJA 1TL7C 5KOYA 4EB6A 2B5WA 5GM1A 5LUBA 2VRCD 1YRQA 3FNGA 5SZJA 4ZT3A 4NICA 1F9EA 1JZTA 5F23A 3O47A 5KJ6A 1AS2A 3LUFA 2PJDA 3M83A 3FB1A 5AVVA 4DKXA 4DWWA 2I6UA 4FGKA 4ICIA 1OY1A 2HIAA 1Z17A 1SXPA 1GCOA 5BN4A 1KXZA 2QJFA 4RQTA 1WZIA 3AR4A 4DG9A 4CL2A 3KJEA 2F3TA 1SBHA 4YAGA 4CLOA 3MS7A 4RORA 1XHLA 2ID9A 3T0GA 3CMCO 3Q88A 2Y1WA 3FCOA 3IOCA 3PNQA 2ONZA 5SZHB 4BZXA 3EXEA 5JMTA 3CFYA 5KTSA 3ZE8A 1Z0SA 4Q3BA 2CFTA 1HFJA 1OXBB 5K4AA 2GUWA 1KEPA 4F4UA 1QIHA 1KRWA 1YMUA 1H6DA 3CNNA 2JBHA 3PYMA 4NF2A 1IHDA 3D3WA 1U7UA 1ECLA 2VWQA 3K1AA 3V00A 4CV0A 4RACA 5B3JA 2BYTA 3ZDCA 3CZ4A 1NVKA 4B0PA 5FOVA 5IS2A 4OI0A 1Z4LA 2G7MC 1SKAA 2YZ2A 4Y98A 5FORA 5P8WA 2CWDA 3H8JA 3P94A 2X58A 4ETMA 2OZLA 1PBNA 1RWKA 3QKUA 4CF6A 1NAHA 4YP5A 1NW4A 3PE3A 3QYAA 4M1YA 2IFTA 1P80A 1NY6A 3ICWA 2AFIE 4JB0A 1Z2NX 3JAWA 3UJPA 1UKCA 3OCWA 2VNJA 2WD7A 1U8ZA 2PK3A 4IIVA 3OEEA 2JAXA 4CRWB 4EF4A 3KYCB 5KQRA 3U17A 3IOMA 3K9BA 1F60A 4DS3A 1ACJA 3G7SA 4C78A 1SBYA 1Y7TA 1XL0A 3NM5A 1IJKA 4ZXFA 1XMQB 1WDWB 3LDAA 5H68A 3OQMA 4LJ7A 2IV7A 3FSGD 1IK4A 3P9NA 4PCUA 4C7XA 5E38A 5I01A 4GYJA 3GGOA 4MKRA 4OK5A 2HHCA 3PF9A 4OA8A 4NSNA 2ZBVA 5BQFA 4HUQB 3OCZA 1JLRA 4QRIA 4CM3A 2JIRA 4IQFA 4UCWA 1BJRE 5EKDA 3LW7A 4DBVO 2VSFA 5AXAA 1VIAA 1AGXA 2I80A 5DULA 4Z1MA 1XFAA 4AMBA 3TF5A 4RD1A 4KRXA 4B6QA 4C6TA 4I6EA 2Y27A 4TTSA 4UVHA 1LTQA 4D3FA 5F9FA 4RTQA 1QH9A 3BL8A 1N6NA 1WCXA 4KN9S 1PD0A 1XTZA 4PR0A 4F4IA 5EHQA 2WJVA 3TG8A 2CVHA 3LT0A 4JLWA 1RXCA 1N3LA 3GOHA 3VKUA 4YV1A 4F56A 3SD7A 2ZB8A 1KSFX 3GZTB 1EJ0A 1OKKA 4HS9A 4TUYA