3AYCA

Crystal structure of galectin-3 crd domian complexed with gm1 pentasaccharide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
135
structure length
135
Chain Sequence
b'MPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-3
publication title Structural basis for distinct binding properties of the human galectins to thomsen-friedenreich antigen
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 33
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aycA00
1RINA 4YW5A 4WVVA 1DYKA 3T2TA 1XQNA 3NWKA 4LBJA 5JOYA 2A71A 4M00A 4FOYA 1QNYA 3ASIA 2R1BA 3FLRA 3WDTA 3WHUA 3WG4A 1WD4A 1FNZA 4JRAA 2VW0A 4Y1VA 2DTWA 3R4UA 2ZGOA 2A75A 4M3CF 5T5JA 4Q27A 5KXDA 5IK8A 3BODA 1RITA 1LOAA 4C1XA 2JKBA 1LULA 1IS3A 5L73A 1S0EA 2YV8A 2A7AA 2D44A 5E88A 2P3KA 4JCKA 4YLZA 2GNTA 3PMEA 3OYWB 1WLDA 1WW7A 1A78A 3M3QA 3W59A 4YZ3A 1Q8QA 3CNAA 1LEDA 2ZMNA 4XIOA 2ZGUA 3N3HA 5GZDA 2DWRA 2PELA 2CWSA 1IKPA 2AYHA 2E7QA 5JDBA 1SLCA 5JOZA 2ERFA 3OYWA 3AYEA 3H0OA 3USUB 2V73A 4FOVA 4C1WA 2EXIA 2JE7A 2A5ZA 3B69A 3IKWA 1BZWA 2D6MA 2NN8A 1U0AA 5FREA 1FX5A 2OUHA 3N36A 3LCPA 1EPWA 4K1ZA 1JBCA 3SLIA 4Z8BA 3T1LA 1V6MA 1G9CA 1DIWA 1V00A 4U36A 3USUA 2DV9A 4WZFA 4YGBA 3HR9A 1JOJA 3KQRA 1ZM1A 1A8DA 3UJQA 1UX6A 2D7FA 5KXBA 3AZYA 4LBMA 4PBPA 2ZHKA 1QDOA 1YXWA 4Q1PA 3WDWA 1N1SA 1N47A 4AYUA 4LBLA 3AJZA 1WUVA 4SLIA 4R9CA 2D6OX 1CPMA 2DURA 4XMIA 1FV3A 1APNA 5GALA 4M01A 1BYHA 3M3CA 2GNBA 4XHBA 3IM0A 2CY6A 1KJRA 1DBNA 1PZ8A 3HN1A 2OUJA 3WNXA 4TYSA 1JHNA 4XOGA 1H9PA 1S0DA 1V6OA 3IN9A 2WT1A 4GKXA 3DUIA 2D3RA 3WVJA 1SCSA 1LGCA 1AX1A 2R0FA 3SH3A 1LCLA 3OY8A 2DVAA 1LOCA 2ENRA 2NYYA 3BIWE 1HDKA 1MS4A 2UWCA 1DZQA 4ITCA 1KQRA 1GZCA 4XDQA 4GA9A 3AZZA 1BKZA 2JD4A 1JXNA 3NV3A 3T1MA 2UURA 4WVWA 4YM0A 1UL9A 5DZEA 4FPEA 1F31A 4GWNA 3ZYPA 4ASMB 3WUDA 2UWAA 2VH9A 2LALA 1AXYA 2A3XA 1JUIA 4YGCA 2I2SA 3OGGA 1HLCA 1KITA 1LOGA 1YIFA 4LBQB 3A0NA 3MW4A 1LGNA 2D6NA 1MZ6A 2YY1A 1QU0A 3FLTA 3ILRA 5DUXA 3A0KA 2VY0A 5GLWA 1S0GA 1FATA 1UPSA 2ZGTA 3TAYA 4XJZA 2A6XA 5GZGA 1LU1A 4R9AA 3GALA 4RL7A 2PHTA 3M3OA 1ENQA 3M3EA 5T5PA 2AH2A 4LBQA 4YZ2A 3PVEA 4UW3A 1D0HA 1N3PA 4L8QA 4OZXA 3WDYA 3UL2A 3AYDA 4XYXA 1D2SA 1DQ4A 3O5SA 1IS4A 1GNZA 1WLWA 2W08A 1QNWA 1VLNA 2DVDA 4CRQA 1G9BA 1O4ZA 4P9YA 4FPLA 3W58A 1Y7BA 2GN7A 5JOXA 4W65A 3ZYRA 1G9AA 1CIWA 2E7TA 2P2KA 2ZHNA 3ENRA 1R1ZA 2FHRA 2ZZJA 3VV1A 4Q1RA 3PVOA 1Z0HA 3QCWA 4FPKA 4Y20B 5E8AA 5FRAA 2CL2A 2DTYA 5H9SA 2EAKA 3M1HA 4XTPA 2C9AA 4TZDA 1LJ7A 1N1VA 1BQPA 1MVEA 2EXKA 4XZPA 4ATEA 4XIKA 4CTEA 1NXD1 2VW1A 2GNMA 1W6MB 4ISQA 1Q8VA 4UW6A 4XXAA 2ZGQA 4FVVA 1CJPA 4Y20A 1WW5A 1KDMA 1IS6A 4DRVA 3RMYA 1DFQA 4FPCA 2NZ9A 3B01A 5IK7A 3U4XA 1CPNA 1ULDA 2PHUA 2V5YA 3RG0A 5CNAA 2A3WA 3UJOA 5BYNA 1BXHA 1MS1A 4P9WA 5T50A 3PVNA 5GLVA 1W6MA 4AVVA 2DVFA 1KRIA 3IMNA 1N3OA 4HL0A 3N7MA 1DQ1A 1C1FA 1FAYA 2ZGRA 4AGGA 4DRRA 2NM1A 2R0HA 1MR5A 4YW4A 4YW3A 5JMCA 3SITA 4YM3A 4LBNA 4Q26A 2NMNA 2PHWA 2R1DA 2PHXA 1WW4A 4FPHA 4R9DA 4BPZA 2KM2A 2XB6C 4AVSA 3ZXLA 1S1AA 1VIWB 2PHRA 3C2UA 2AENA 1AJOA 4YG6A 4BOWA 4JC1A 5CA6A 1ULGA 1LOFC 1C4RA 2TEPA 1GLHA 4GKYA 1AJKA 4XJ8A 3DGTA 1CN1A 1SACA 2E53A 2DUPA 3WG1A 3AK0A 1AVBA 1DLLA 3BTAA 2ZACA 5CBLA 5DUWA 1WCSA 2RHPA 2JJ6A 3N35A 4DS0A 3B00A 5EWSA 3RS6A 4YZ5A 2SBAA 1CESA 1JW6A 2ARBA 3Q9OA 2WT0A 4FPOB 3M2MA 3AXEA 3UK9A 1LHWA 2YMZA 2ZMLA 3OPZA 1CVNA 4MYEA 2XG3A 5EYXA 2YZ4A 4KBBA 4XBNA 2DU1A 4YZ1A 2A6YA 3A4UA 4FPYA 4M3CE 4FOQA 4DQAA 1FV2A 1GNHA 1W6PB 4NOTA 2EXJA 2GMPA 3OBRA 1Z78A 2WSUA 3FUQA 4FQZA 1GKBA 5IT6A 4RA0A 1I1EA 4Y22B 3PJQA 4XILA 3N7LA 3FLPA 2AGSA 4BLJA 3IPVB 2E51A 3L2YA 4XJAA 2ZGKA 1AXZA 2SLIA 2W52A 1N1TA 1S0IA 1W6PA 1IKQA 4GWMA 3ZSKA 1W6OB 1V6NA 3VKMA 4BMEA 2D3PA 5GJ6A 1S0FA 5T5OA 2ZHLA 5GZFA 4LBKA 1J1TA 4YFZA 1GANA 4Y22A 1KDKA 1MS8A 1GZ9A 1LHNA 1JYCA 1H9WA 2DUOA 2EALA 3IPVA 1OFSA 2AR6A 1MACA 2VU9A 4FQ4A 1BJQA 2WJSA 4Y1ZA 3POWA 1N1YA 2CYFA 1ENSA 1G9FA 1SLIA 2UU8A 1SBEA 2DYCA 2Z42A 3AZXA 5DZFA 3V0AB 4DFSA 1W6OA 2CWMA 4Y26A 4PCRA 1GZWB 5DUVA 1Q8SA 4LBQD 2A3YA 5DXDA 2ZBJA 1VAMA 1LESA 3ATGA 3WV6A 2OVUA 3V0AA 5KXEA 2WKKA 3WCRA 4BMBA 1Q56A 3D5OA 2OW4A 4GALA 1GZWA 1LOEA 3WUCA 1F5FA 5GZEA 1G8WA 1QMJA 1SBDA 3AP7A 5GLZA 3TB0A 1B09A 1AF9A 4XE9A 5EXOA 1X50A 1N3QA 4ISRA 3POSA 5EYYA 3NV4A 3SISA 1I3HA 5SV8A 3SH4A 3POYA 2B7YA 4XJWA 3SNMA 3BOPA 2GDFA 2GMEA 3AP9A 3WHTA 4XBLA 5HCBA 3RSJA 3JU9A 1IS5A 4Q2FA 2VUAA 4K21A 1AX0A 2VW2A 3AX4A 1VAVA 1W6QB 1RIRA 2NP0A 1ONAA 1LOFA 1YO8A 2DUQA 3OBTA 4P9XA 5T55A 4UW5A 3VKOA 2WT2A 3QLQA 3VKLA 3GNEA 4M3CB 1GV9A 3AXDA 3ZPYA 3WG3A 3R4SA 1OQ1A 1WBFA 4Y1UA 1ENRA 3V64A 3AYCA 1V6KA 4P14A 4XBQA 1LEMA 1UN1A 1W6QA 4XJUA 1WW6A 1C1LA 1HQWA 3O0VA 5T5LA 2ZMKA 4YG3A 4ATFA 2VXRA 1G9DA 1QOTA 3AFKA 5GZCA 2EIGA 2ZA9A 1QKQA 1WBLA 1FYUA 2ZGNA 3MEPA 4M3CA 2D6KA 5IK4A 3O0XA 2WSVA 2P3IA 4XXPA 5E89A 3RMXA 4AGRA 3AP6A 1UZYA 2ZABA 4D69A 2E6VA 4YM2A 1LHUA 1UMZA 1H30A 2GMMA 1QOOA 3O12A 3LSDA 4PF5A 4YW2A 2ES3A 5HCAA 3VUOA 1OKQA 1ULCA 5DUUA 1G7YA 2ARXA 3WCSA 5JLVA 1LU2A 3RRDA 5CB7A 1W0OA 3B9CA 5JVVA 1UAIA 4FP2A 4XMAA 2A6WA 2UWBA 2ZAAA 2PHFA 4YG0A 3WDUA 4AVTA 3I4IA 1O4YA 1DHKB 1MVQA 4K1YA 5KXCA 1CONA 1QGLA 1VALA 1S0JA 2EF6A 1YYNA 2DVBA 4FPFA 4PQ9A 1HKDA 3INAA 2GN3A 3MPPG 1SLLA 1KJLA 3ZXJA 1MS9A 3AZWA 1V6JA 4R9BA 4PBOA 2A70A 4ZXKA 4BLIA 1CR7A 3APBA 2R49A 5F5QA 5LK5A 1QOSA 4K20A 2ZGSA 2LTNA 4Q8KA 1V6IA 3WOGA 3WDVA 1UKGA 2P3JA 3MW3A 5GLTA 2D6LX 3LSEA 4AGVA 3AYAA 5H9PA 3V0BB 3NV1A 4YGDA 1DYPA 1GSLA 1WLCA 2W39A 3AP5A 4XJ9A 4Y1YA 5T52A 4BM8A 2ZGMA 2CNAA 2JDZA 5H9QA 2GALA 4GXLA 1HQLA 1AXKA 2R16A 2G4IA 4NO4A 4UW4A 1ZA4A 1LENA 1MS0A 3NV2A 1GICA 4YW1A 4AWDA 2JE9A 3AP4A 3OJBA 2WNEA 1GBGA 1IOAA 1PZ7A 2EXHA 3N7JA 3V65A 1DQ5A 3V0BA 4H55A 1DQ0A 1DQ2A 5IUQA 1AX2A 4I30A 4YZ4A 1W0PA 1NLSA 2JECA 2ZHMA 1SBFA 4YFWA 3RQ0A 3WLUA 2AREA 2NMOA 3N7KA 3ZSMA 3ZSJA 4F83A 4FPGA 2P37A 3OY8B 2ZKNA 3WZ1A 1LTEA 1S0BA 2P34A 3ZXEA 1LHVA 3JUUA 1TEIA 3ZXKA 3FBYA 4HANA 5IK5A 5T54A 1LODA 1ULFA 1A3KA 1V6LA 4YGEA 1AZDA 3WG2A 2FMDA 1C57A 5GM0A 1DGLA 2C5DA 3WDXA 3D6EA 3ZXFA 1MZ5A 5GLUA 2BQPA 2DVGA 4IQPA 2AUYA 1JN2P 1Q8PA 1URXA 3ILNA 1MS3A 4XHXA 5F9TA 3ILFA 1CQ9A 4Y24A 2GNDA 1QF3A 3VKFC 3SH5A 1ULEA 1FNYA 2CTVA 1LGBA 2WLQA 3I8TA 5DG1A 2D6PA 4DPNA 5CAZA 4FP3A 1YRZA 1GYKA 3FFZA 4FPJA 2H0BA 5H9RA 5DG2A 5JOWA 4CZSA 2Q5TA 4BQ1A 1S0CA 4Y1XA 5DZGA 1JYIA 5HCFA 3FUOA 1SLTA 1LECA 1SLBA 2D3SA 1G86A 2W68A 3ZSLA 1LHOA 3R05A 1SFYA 1W6NB 4YM1A 1Q8OA 2YXSA 1F9KA 3O0WA 4XTMA 1SCRA 3D4KA 3AZVA 3MW2A 4LBOA 4Q8LA 4FOWA 1SLAA 3B3QE 2HYKA 3KM5A 3AJYA 4U2AA 2D43A 1DQ6A 2DU0A 1LOBA 2YROA 3VKNA 1MS5A 1W6NA 2A6VA 2ZGLA 5AVAA 1UZZA 3HMYA 2A6ZA 2WQZC 2ZGPA 4ZKTB 4WV8A 3ZVXA 1QDCA 1YI7A 1WD3A 1PZ9A
chains in the Genus database with same CATH superfamily
2WYFA 1RINA 2WR9A 2G19A 2XWJB 3T2TA 1AR72 4AFDA 2PAMA 4S2GA 2OT7A 2A71A 1POV1 4FOYA 4M00A 5JOYA 1GQGA 1ND3A 3FLRA 1YQ5A 3WHUA 1WD4A 4JRAA 4OI2A 4A44A 2PN5A 2DTWA 4SBVA 3GZEA 2OZJA 4XFFA 1MQTC 3W5NA 3O1UA 3LDRA 4XUNA 1H4HA 1YJLA 4ZXEA 4FCAA 4DEQA 5I0RA 1J83A 4JVAA 1D7PM 1LOAA 2JKBA 2E9QA 1RMU1 4PI2A 4YLZA 1BCXA 3FN9A 4CDQB 1A78A 3PUQA 5FLJA 1CD3G 2ZKLA 2VM9A 3CNAA 1J1LA 1XNBA 1IPSA 5F2WA 2VBPA 2H6CA 5ABJC 2VTXJ 4W6YA 4IV3A 1IKPA 3CKHA 1PGW2 4QT6A 3ACIA 5JDBA 4FTSA 4QGLA 2N7GA 4LKFA 2PHLA 2V73A 1NCQB 1AUYA 2JE7A 2A5ZA 5FLIA 3B69A 4MO3M 1BZWA 2W91A 4LULA 3AKRA 4BWOA 3N9MA 2VR4A 3NRUA 4LHNA 3UGHA 1EPWA 4V2VA 2C1FA 3SLIA 2VNOA 4M0NA 4UBHA 3LIHA 3THCA 4LUMA 4TLGA 4A6SA 4WZFA 2WIIB 1NCQA 2IFWA 3UJQA 4A7KA 2BDRA 5LCWL 3ZFGB 1TG7A 4N43C 5FZKA 4PBPA 2VZQA 1QQP1 3EJKA 5L9BA 3WDWA 1N1SA 1ST8A 1SDWA 2Y6LA 4GJYA 5C9AC 5A1FA 1WUVA 2K2SA 1UYYA 2OIIA 4RN5A 1NQDA 5F39A 3SMHA 2VUDA 5LBBA 1KEXA 1FV3A 1HJGA 1D4VB 2PXJA 4QAWA 4RGAA 4XMIA 5A3LA 5I8TA 3I2JA 2CDOA 2GNBA 3TYJA 3ZFGA 2CY6A 1BHGA 1DBNA 4ES8A 4Z2WA 5F5IA 2Q8CA 4JV4A 1IQDC 3SKJE 2UYAA 4RR3B 3WNXA 5FO9B 1W9YA 2WINB 2IC1A 2R073 3UNPA 3GJAA 1V6OA 1RUF2 4XW3A 2F6BA 4I02A 4Y33A 4J25A 2J22A 5IVYA 1R083 3THTA 1SCSA 3OY8A 2DVAA 3MZHA 1YFXA 3KV6A 3ETPA 5EQUA 4ITCA 3HNYM 4XDQA 4D7YA 3IAPA 4LA3A 1BKZA 2GP5A 3RGBA 2WZR1 2QQKA 2UURA 5DZEA 5FMBA 4Z92B 4ZU5A 3VD3A 3WUDA 4L9BA 2VZVA 2LALA 1AXYA 4M0HA 1RXFA 2ID4A 2VOXA 1W39A 1V9U3 3LOIA 4P00B 1KITA 2BERA 4BH9A 1O5UA 2WNOA 4UAPA 3D0JA 5FZHA 2J1VA 5CKQA 2D6NA 5FWJA 5BNPB 3MFAA 5DUXA 3E6DA 2VY0A 4XJZA 5GZGA 4Q4W2 3ELNA 1LU1A 3ES4A 5JZGB 1ZBE2 1ZRCA 1WMFA 2B9UA 5FKBA 4COYA 4RFT0 1E5SA 1ND2A 3PVEA 3P1IA 4DXTA 1ASJ3 3I2FA 4LKEA 2XR4A 4Q4W1 1D0HA 3GBGA 4L8QA 3AYDA 4N7IA 4X8NA 1DQ4A 1XE8A 2MEV1 3MBWA 1COV2 2BW8A 4WM8B 4I2OA 2WO1A 3GZUC 3NKTA 1JHJA 3LFMA 3VBOC 1OC1A 3OEBA 4HLTA 4P9YA 4QHBA 2VE1A 3DKWA 5LB6A 5JOXA 4CDUC 5FP4A 1ZZ9A 3VZJA 2BV4A 3MF6A 4CCDA 2P2KA 2WZ8A 4WM8A 2FDIA 2IZWA 5FYIA 2I07B 2FHRA 3JCIA 4M4PA 4J6GA 2XH6A 3USSA 1OA4A 4Q1RA 4Y5TA 1FOD2 3VV1A 1A34A 5DAXA 1H8TC 4MZUA 3WW4A 1IZ3A 3DECA 1XE0A 3ZR5A 4NRPA 3E6BA 4F3JA 4Q0UA 2P5BA 1FOD1 1N1VA 3POEA 1BQPA 1H2NA 2BBVA 1OLMA 2WN3A 5KBFA 4XIKA 4I01A 4IXLA 3ACFA 2GNMA 4GZ9A 4ISQA 4FI9A 5A6YA 1OKOA 3OCPA 4FVVA 1CJPA 5LATA 1I9RA 1JYTA 3JD72 4O7XA 4Q0PA 4GMP1 3WP4A 3KT7A 4CDXB 1DYOA 2VG9A 5LRSA 2PAKA 1CPNA 3POGA 4COVA 3RG0A 2V5YA 4CXWA 4EV0A 1RUG3 2JENA 1BXHA 3JD71 1YQ8A 4XEZA 3RZLA 2XBO2 4QX8A 3C3VA 5KHJA 2HBUA 1OI6A 1BEV3 4MLOA 4QGMA 2XUEA 4JKKA 1OVPA 1N3OA 1RTVA 1HB1A 3ZFFB 3M8LA 4DRRA 3CIHA 2XBO1 4CDXA 2K0GA 2NM1A 4YW4A 2EIBA 2QTWB 5C8WA 3SITA 4MGKE 2ET7A 3MO4A 4HPKB 1UU6A 4Q0SA 2XOMA 1WW4A 3FMGA 5A7PA 4DOUA 5JWPA 1RB8G 2KM2A 4ARXA 2XJSA 1TMF1 3WNOA 1M4WA 4GB33 3ECQA 1Y9GA 2R30A 1SFNA 1DP0A 1VIWB 1Y43B 2AENA 1AJOA 4YG6A 4E4HA 4JC1A 5LEKA 3O1RA 3KHCA 5L7OB 1LOFC 2NPIA 2TEPA 1YNAA 4CDWB 5IVEA 4HG6B 3FX3A 3VGIA 4JGZB 3VD7A 3PUHA 2V4VA 3BTAA 1DLLA 5CBLA 5IYYA 1DLCA 1W8ZA 2BPA2 2R041 3PUAA 4XURA 3UKTA 2JB4A 1UWWA 5FOJB 5K7PA 2GAUA 4YZ5A 2ARBA 4FPOB 3IDAA 3Q9OA 4Y4YA 1AYN2 1LHWA 4CDWA 2FCTA 4LT5A 4WBBA 4JHZA 3SKVA 4PIYA 1J3RA 2WYSA 2A6YA 3A4UA 4FPYA 1ZZ8A 4FOQA 4LO8A 4PLOA 4D8MA 3KZ4C 1AYN1 5C3RA 1CZVA 3VZMA 3O14A 2XQXA 3FUQA 1PK6B 3IZOA 3OD0A 4CSWA 1RUC1 5IW0A 1WA4A 2ZPXA 4RA0A 5J98B 3BOWA 4AK3A 1DF0A 4PDWB 4BLJA 5A32A 3KB5A 4NHXA 1AXZA 1YFWA 5DN2A 4D0QA 1W28A 1HQNA 2P1BA 1S2BA 1V6NA 3NKGA 2RJ2A 2D3PA 3VKMA 2ZX1A 5A70A 5JI9A 2KD7A 1W90A 4OUSA 1PK6A 4LBKA 4EWDA 2WUHA 1GZ9A 1H9WA 1QEXA 4QPYA 1OFSA 3H1YA 4N53C 3PUSA 5GM0A 1BJQA 1N1YA 2J1AA 1RGSA 5FP7A 1VR3A 2Z42A 4XAEA 2CU5A 2JDYA 5KHHA 2B45X 2OQ6A 4Y26A 1FPN2 2VZPA 5BNQA 2VTFA 2VOTA 3VN4A 3H50A 3S5AA 3KGZA 1Y9MA 4LK6A 1EAH3 2GC2A 2VVEA 3ATGA 4XVHA 2HWE1 1FPN1 2OVUA 5F7UA 3KQ4B 1Q56A 3NJYA 3KCCA 2WZPP 3CQOA 2YUEA 3POIA 4JDOA 5F3GA 3J8F3 1L7QA 3SEEA 1GWMA 1LOEA 4B3NA 1G8WA 5IVJA 2NLRA 3FE5A 4I3PA 2W3JA 5GLZA 3TB0A 4E2GA 4CYDA 4V1PA 5DDJ2 2BZDA 1KFUL 1X9TA 4I0AA 4PQQA 1TME3 1XXNA 1Z7S3 5CFCA 3SISA 1I3HA 2JDAA 2QQPA 1JTZX 5G04L 2YPDA 3CLPA 3H1MA 3NQHA 5DDJ1 3SNMA 3BPZA 3DXTA 2HWC2 2RDNA 3PUIA 4XBLA 5I0SA 2OKXA 4QX0A 4N7UA 4BIFA 4IGOA 1VBE2 2IUWA 2R062 4Q2FA 3POJA 3T2QA 2VUAA 4K21A 4RQPB 1VAVA 1YWKA 2XJQA 4V2WA 2HWC1 1IHMA 1RIRA 4YRDA 4AL9A 3IDBB 5FPXA 1UW8A 1VBE1 3LA3A 2R061 4BQWA 4P9XA 2WL1A 2WA3A 5T55A 1JZ8A 1NT0A 2WT2A 3OGVA 3VKLA 2FDFA 3GNEA 1GV9A 1KS4A 3AXDA 1JU3A 1WBFA 4Y1UA 1ENRA 3SCHA 3V64A 4RQPA 1I5PA 1V6KA 5CYYA 4P14A 4CU9A 2BNMA 2X53S 1HQWA 3O0VA 2ZMKA 5EFUA 1RHI1 1QOTA 3AFKA 3WP6A 5GZCA 1E5IA 4NIGA 1FYUA 3H7YA 3LA7A 3NL1A 5E89A 1QY4A 1VRH3 4QPIA 1UMZA 3O12A 1LR5A 5CIRA 3VUOA 2ES3A 4JKLA 4MXWB 2C4XA 5HCAA 4BDVB 1J84A 2FCVA 1OSGA 2WNVC 2XJRA 3PLQA 3WCSA 4XZUG 4A42A 2B8MA 4LITA 4YWAA 3AKQA 2ZCWA 1HX6A 5EJZB 3NNGA 3HNBM 5JVVA 2WBKA 4K8FA 5D2AA 2VZTA 5LASA 1UKRA 4MXWA 1ND2C 2Y26A 1UY1A 2FZ2A 4AVTA 4YG0A 2HWF2 2X5IB 1DG6A 1O4YA 3I4IA 4K1YA 1WCDJ 1S0JA 1I5ZA 4AI3A 4PQ9A 3INAA 1UCXA 2GN3A 2HWF1 3MPPG 3RPQA 2WWSA 1V6JA 2PMWB 3N9NA 5FIXA 2Z69A 3VBFC 4Z82A 3APBA 2VCCA 2QDRA 5D1IA 5F5QA 5LK5A 4F7ZA 2QQNA 2ZGSA 5KC6A 4HONA 1V6IA 4AFBA 2W1UA 3ES1A 3WOGA 2WNUC 2F4PA 3LEGA 4CPBA 4G9SB 1UOFA 3CF6E 4AGVA 2W92A 3KCXA 1VBD3 4KH9A 3V0BB 2J1RA 4LKDA 4YGDA 3U11A 1GSLA 1WLCA 3AP5A 4XJ9A 4JGYA 5T52A 4BM8A 5CFDB 2ZGMA 1XBFA 5A3TA 1QJX3 3O1TA 4OHVA 2BVVA 4K6BA 4K9SA 2RS12 1RUOA 2R16A 2G4IA 4NO4A 1YEWA 1ZA4A 1LENA 4AWDA 1GICA 2RG4A 4YW1A 1S4CA 2JE9A 4QKDA 1WGPA 3MIBA 1IOAA 1IGOA 1RJ8A 3CL1A 2EXHA 3V0BA 4QKNA 1JOPA 2RS11 1AX2A 4FFGA 3ACGA 4UFLA 1NZIA 5FZ7A 5CFDA 2ZHMA 4YFWA 4CP0A 4AE2A 4F83A 3N7KA 3OGRA 4NR1A 2ZKNA 3ME2A 3T0AA 1S0BA 1MZFA 2ILMA 3GBFA 5FKCA 1HRI2 3CZUA 3JUUA 4HKOA 5FY4A 3B5LB 3R4DB 4Y4RA 1A3KA 4NAOA 3PU8A 1AR73 1V6LA 4LO6B 3RWKX 5CG8A 1DGLA 2C5DA 1HRI1 3IBMA 1QIQA 3ZXFA 3CZJA 3HT1A 5LY1A 2X10A 3ILNA 4TLFA 5CKNA 1YQCA 4LE3A 3H1WA 3ILFA 1POV0 2DCKA 4IGQA 1CQ9A 4LKSA 2VMCA 2UYBA 3LD8A 5C4WC 1LGBA 1W2UA 4P5YA 3X29B 2D6PA 3H42B 5IFTA 1YRZA 1GYKA 3HN3A 1NY71 5FZ6A 5C7GA 2Q4SA 4CXXA 4Y1XA 4HKWA 1W3XA 2BTVC 4I3GA 1C8M2 1LECA 1SLBA 1SLTA 2D3SA 2Y8KA 2G9FA 1LHOA 3IT8A 5FZAA 3R05A 1O3QA 4A41A 1ZBA3 4MH0E 3L2HA 2L9LA 1X82A 3RVHA 1C8M1 4C0BA 2B9VA 3P3NA 4FTBA 4UT5A 1OT5A 2PAEA 4C0HA 4LBOA 1CAVB 2BOJA 1RUNA 2ZX0A 5JIAA 2QKDA 4MUVA 4ZZ8A 5CZKA 2HYKA 1JU4A 2DU0A 1PNGA 3VKNA 1YC61 2EICA 2RDQA 1GP5A 2EAAA 3RZZA 3MICA 4A6OA 3HMYA 1ENXA 1ZZ7A 2CGPA 2WQZC 4K3UA 4L11A 1QDCA 5JUVA 2AC1A 3DKQA 1GWLA 3HQXA 5C9AB 1DYKA 1GQPA 1DGWA 1XU1A 1LKNA 3MGUA 4AZZA 3PNAA 2V4AA 1QNYA 4HN0A 2R1BA 4TXWA 1U12A 3K4DA 4Q0VA 4W6WA 3WP5A 4Y1VA 2WA4A 3R4UA 2XVKA 4Y5SA 3IIIA 2A75A 4IV1C 4M3CF 1OLRA 1JYVA 1X8EA 1B35B 2TNFA 3R0RA 5T5JA 2O14A 4AAPA 1UIKA 4AQSA 3GF6A 4NIHA 1DDLA 3BODA 5IATA 3RZHA 1W3VA 1RITA 2CGOA 3AB0A 3AMHA 1RUF3 1IS3A 1RXGA 1W05A 3EXUA 1S0EA 3OB8A 1H2MA 2A7AA 2TBVA 2A73B 4JCKA 4LMFA 3PMEA 1UQXA 4OCTA 2DBIA 1Q5OA 3IIAA 1B35A 4YZ3A 1W2NA 1XE7A 1LEDA 1QWRA 2WWJA 2ZMNA 3CBNA 3EBRA 3GYDA 4MGSA 5SV5A 3N3HA 5GZDA 4CEWC 4CCJA 2AYHA 2E7QA 1BVVA 4DO0A 2ZEXA 1SLCA 4HK8A 5A3PA 1AL0G 5JOZA 3AYEA 5FZFA 5I0UA 1RUE2 3USUB 3VHPA 3IB3A 4QB6A 4QD2A 2Z4FA 4CPBD 4EN7B 4ORFA 1GZTA 2D6MA 4D94A 5I8YA 5IVFA 2JE8A 4JQRA 3N36A 5A3UA 1RUE1 3JBG2 4K1ZA 3I59B 4MVTA 3OGSA 1DIWA 1MZEA 4HXCA 4OFGA 4FFHA 4M4RA 3ACHA 4U36A 5FY8A 3BGAA 3HR9A 3USUA 4Q4V2 1VE0A 1GOFA 1JOJA 1H1AA 1VP6A 2D40A 2IFRA 3VBUB 2D7FA 5KXBA 1MEC3 3AZYA 3T08A 1PO11 1ZBE3 1JZ3A 5FPUA 1RUD2 1N47A 3NSTA 1K5JA 1JZ7A 3GDBA 3I59A 4KWJA 4LBLA 1OFNA 4Q4V1 5FZ8A 2XMLA 4RS5B 1K45A 2JG9C 2Q8DA 5FZ9A 2D6OX 1CPMA 1H1MA 1RUD1 2DURA 2JDMA 1APNA 1YJKA 1COV3 2XKOA 3H8UA 3VBUA 4XHBA 1UX7A 2FDKA 3IM0A 4XQWA 2JDHA 3HN1A 2OUJA 1ZX5A 3VD9A 3VL8A 5DMYA 4HMZA 1JHNA 2W95A 3NAPC 4ASLA 2XQRA 1GNYA 3IN9A 3FBMA 3WY6A 3GJBA 4GKXA 1CZTA 1ODNA 3DUIA 5FZ3A 3I54A 2C6SA 1LGCA 4IE6A 1FOD3 2QQIA 2MNGA 3AC0A 3Q8BA 2ZS6B 3BIWE 4QX5A 4J1WA 1HDKA 1MS4A 4O9GA 4AQ6A 2PQQA 1OPOA 3MV01 5ACA1 4GA9A 1F8VA 1S55A 3WQ1A 4TSVA 4XFHA 3NV3A 2IXIA 4GMP3 4JDNA 1RJ7A 5FPLA 3T1MA 4WVWA 3U0ZA 3ZYPA 3ZOIA 3SCGA 1XJAA 1GUIA 5FYHA 3HNMA 5JXGA 2BU9A 1OH3A 1SZBA 1HLCA 3K3NA 1LOGA 4LBQB 4WM7B 3VBHB 1VRBA 3MW4A 1XSQA 1HV1A 1UOGA 2YY1A 2YB7A 3ILRA 4NN0A 2QQOA 4PLNA 4UBGA 4CCEA 1S0GA 2QQUA 2W5FA 3MIFA 1AR62 1UPSA 4E4ZA 3BUCA 2A6XA 3VDBA 4GH4C 2VZ1A 4R9AA 4GMP0 1ZRDA 1L7LA 5BV6A 4QU1A 4QPGA 4WM7A 2VOVA 4LBQA 3JQXA 5JMOA 1AR61 5KHKA 3VBHA 3JZVA 2ORXA 1N3PA 2W46A 3SHRA 2VMEA 1D2SA 3O5SA 4JGYC 4AEDC 5HV4A 4QDSA 2JG8A 1STMA 1US3A 1BBT3 1JYNA 4PT6A 2VZSA 4N90A 1UXZA 4AVCA 1G9BA 5A6XA 1IQAA 3JQWA 5FP9A 3FC0A 3W58A 5FYMA 4DMIA 3VHRA 5BNNC 3ZYRA 4KMQA 1W8OA 2E7TA 2IVIB 1T2XA 2XXZA 2JIJA 2Q0AA 2Y6JA 5C8CB 1POQA 1J3QA 1MPXA 2JDKA 1Z0HA 2XVGA 4QX7A 1REFA 2YBSA 1XNKA 4Y20B 5F6LB 3MFCA 4AG4A 5FRAA 4DXRA 2CL2A 3JB4C 4EE2A 1AYN3 1PMHX 1RMU2 2RJKA 5H9SA 1W03A 2EAKA 3D8CA 4XTPA 3ZIWA 2C9AA 4TZDA 3BIEA 1LJ7A 4XFGA 1MVEA 5T3NA 4E2QA 1H6YA 3M7AA 4LIVA 2LS6A 2WZEA 4JTOA 4R4ZA 4ATEA 4EN0A 5C8CA 1NXD1 2VW1A 2JEMA 4YARA 1K5MC 3KVBA 3RI9A 2Q1MA 4QMAA 4Y20A 2BGOA 3TOJA 3E5UA 4LHSA 3WX5A 2DDUA 1IS6A 4META 3P6BA 2VQTA 3U4XA 3LE0A 4DUVA 2PHUA 5BNOC 1ZVFA 4P9WA 3GCXA 3PVNA 2DVFA 1QJU3 5LBFA 4MADA 5FK8A 4CDQA 1YQ2A 4AQ2A 4BQ2A 5C70A 1PM7A 2YYOA 1R1A2 1OA2A 4IEXA 4NAMA 4AGGA 2R0HA 5A80A 4LR4A 1WMXA 4CU7A 5LA9A 5AC92 1SG3A 5B4XA 3U14A 1R1A1 3P3PA 3ZFEC 4R9DA 1QQP2 1QJY1 1FXZA 5AC91 1OUXA 1GR3A 3PIJA 2PHRA 3C2UA 4NROA 4JQTA 2VUCA 1O3TA 2IXKA 4XJ8A 2JWPA 1O4TA 2E53A 4IEOA 1XNAA 2DUPA 4LO5B 1IPJA 1Y4WA 3K3OA 5DUWA 4EWEA 1OLME 1NKGA 1WCSA 3N35A 3B00A 2RM22 5EWSA 2VZUA 5FMCA 1OQDA 2WRAA 4OHZA 2FQPA 3M2MA 1NYWA 2WFF3 2PA7A 2YC4A 3KT1A 1CX1A 3OPZA 1CVNA 5LWBA 2XGXA 2YZ4A 1J58A 1HRV1 1NA1B 2RM21 4KBBA 4R52A 2DU1A 4XBNA 5FWEA 4B1LA 3LEIA 1I6XA 1AL23 1GNHA 3TNQA 3RJRA 2HWC3 4AI1A 2VZOA 1Z78A 2K9ZA 2R063 4FQZA 3URFA 5IT6A 1PO22 1F5JA 3AKSA 4Z2AA 1I1EA 2E33A 1IG3A 4RR3A 3IPVB 1NA1A 3L2YA 1EY2A 3QOPA 5K0UC 1LAJA 3S6PA 2WZR2 3MIDA 4E4DX 2W52A 3CJIC 1S0IA 1PO21 3L9JT 3ZSKA 1PGL2 4BMEA 4RGGA 1ZZ6A 4AXOA 1UU4A 1ZYBA 2P17A 4NHLA 2ZHLA 3HIFA 3TEWA 3DN7A 5FJHA 1FMD2 1Q43A 2FD8A 1KS5A 1KDKA 1LHNA 1CAWB 1JYCA 1PGL1 3IPVA 1L3JA 4D6RA 2WJSA 2K46A 1JH5A 1ENSA 5DZFA 4LEJA 1FMD1 1OUSA 3V0AB 2R6QA 5FY0A 4PLMA 2O1QA 4R8HA 4CA9A 5J1XA 3ZYGA 3BKZA 4PCRA 1GZWB 2YBKA 5APAA 1BK1A 4LBQD 3I3MA 5BUVA 4QQLA 5DXDA 1CAWA 2ZBJA 3IDEA 1OVSA 1VAMA 2PLV2 5HI0A 3T3YA 5E6HA 2Q8OA 3V0AA 3WCRA 2MEV2 3C8XA 3I2GA 4ONUA 2OW4A 1NUKA 2VMGA 3KSCA 2PLV1 4N8MA 5BNPA 1GZWA 3OBZA 1F5FA 4COZA 1RUH1 3WF2A 2VD7A 5FYCA 3VDDC 2VNRA 1SBDA 3AP7A 3PHMA 4E27A 5JZGA 1AF9A 4XE9A 4EZHA 4AVBA 4ZS3A 2DF7A 4QDRA 4RHV3 2J1UA 3NV4A 2RS32 1X33A 3BOPA 3I2IA 1UO9A 4FO9A 1HB2A 3AP9A 3T4VA 2RS31 3ZYFA 1YLLA 1IS5A 1ZRRA 4MOAA 3WT3A 2DFBA 1AX0A 1RL3A 2BOIA 3AX4A 4Z1VA 1W6QB 4K8RB 3DYOA 4XUTA 3GHNA 5FR3A 2ZTNA 1HXS2 2JX9A 1VBA2 2PTMA 1CJDA 2VZRA 5ERLA 4ZU4A 2X8KA 5FLHA 3OOXA 1XNCA 3ZPYA 4EQVA 2BP6A 1HXS1 3AYCA 3FHAA 1VBA1 4Q5OA 4E8CA 5FK7A 1UN1A 1XRUA 1W6QA 1AYM3 4HOOA 1WW6A 1EV12 4QX2A 5ANNA 1T6GC 2RS13 4YW6A 3RZKA 3EO6A 1C1LA 3E1F1 4JTNA 5FJKA 1CGPA 1AR92 5T5LA 4YG3A 3SEPA 4ATFA 5DAPA 4BK5A 2ZA9A 3LEMA 3VZLA 3MEPA 1EV11 3HQRA 2D6KA 2CGNA 5FYYA 5IK4A 2P3IA 1AR91 3AP6A 2ZABA 4URTA 4D69A 2BFUS 2E6VA 1PX3A 1LHUA 2QQVA 3DEMA 4PF5A 3RMYA 3VBSB 5FMOS 1WCQA 3VBRC 1OKQA 5DUUA 1G7YA 3TEXA 1O6UA 5LW9A 2ZEYA 1TMF2 4XF0A 2WABA 3PVBB 3ST7A 3RRDA 2AACA 4JRLA 5IVBA 1R092 4QPGC 5FZMA 3VBSA 4FP2A 1JUHA 2CHHA 2ZAAA 3WF1A 1UD1A 2Y6HA 4Q0QA 3ZFFA 1MVQA 5A1AA 2BRTA 1CONA 1R091 5KWRA 1VALA 5FUPA 5AFEA 1XPWA 4CEYB 2R042 2DVBA 2XVLA 4UXAA 4FPFA 2WS91 2X29A 1HKDA 4HPKA 1SLLA 1KJLA 5LRRA 3W5MA 4AI8A 1QXPA 3JB8A 3HJRA 4PBOA 2A70A 4BLIA 2R49A 4HZFA 4BU2A 4Q8KA 3WQ7A 5L7OA 2FBEA 1V70A 4AFCA 4OQ9A 1PIV1 3HD8B 4CEYA 5GLTA 4QHOA 2D6LX 4JGZA 2BNNA 4L2NA 5H9PA 1C8M3 1ND3C 3K4ZA 5FO8B 4YVSB 1RUC2 3NV1A 1EUUA 2VNVA 3CDZB 4B7KA 2YC2A 4Q4Y3 2W1SA 1JZ4A 1HQLA 1M06G 1AXKA 3S5QA 4EROA 3HBZA 5LY2A 2JXAA 2WNEA 4XABA 1GBGA 4CUGA 3KF5A 3V65A 2RR13 4YVSA 3PTRB 1DQ2A 3T0DA 4UFIA 1NLSA 4O61A 5JSPA 1SBFA 1H1IA 3ZSJA 3J7HA 2AREA 4LXLA 4AEMA 5FQ0B 3WZ1A 3J7LA 4AHZA 3J4UH 4LHKA 4PDWA 2Z2SB 3FBYA 3ZXKA 4I0BA 5T54A 3WF0A 4IV3C 1ULFA 3U78A 3ZYHA 2F4LA 1C57A 4MGIE 4CDQC 4D3WA 1YFUA 2Y38A 3D6EA 3BB6A 3MF9A 3FL7A 2HWE2 3AL5A 4UI9L 1CAUB 2AEZA 2BQPA 2BWCA 3VDCA 1URXA 4URAA 1MS3A 3FHQA 4HBNA 2G9GA 5F9TA 2ATFA 3OGJA 3H9AA 2XONA 3OF1A 1E5HA 4Y24A 2ZX2A 3NVCA 3VKFC 1ULEA 1JOBA 1NCQC 1CAUA 1SQ4A 1VBB2 2QJVA 3ALQA 4KQ7A 5DG1A 4FP3A 4LQRA 4TWTA 5CAZA 4OMDA 2B39A 5H9RA 2W1QA 3T2OA 1PVXA 3MHZA 1OBNA 5JOWA 1NCRB 1ULOA 4EN6B 4CZSA 2Q5TA 1VBB1 3LB9A 4GULA 4GAZA 3I7DA 4HFSA 4CEWB 3RZMA 1D0GA 3KMHA 1UYXA 3EQEA 4RFRB 5DZGA 2PYTA 3FUOA 3KVAA 1SMVA 3ZSLA 3TEZA 1G86A 3O7OA 4QDQA 3ZFGC 1RUE3 4B4PA 4NIDA 2OS2A 1W6NB 2I45A 5FZLA 3MLJA 3VZNA 1Q8OA 5LK7B 1F9KA 1NCRA 5FZ1A 2WAOA 3RI8A 4S2FA 3D4KA 2CAVA 4BCUA 3JBG3 4Q8LA 2D5FA 4FOWA 1BLZA 1SLAA 3T0BA 5A3MA 4YVWB 2VJXA 2OQ7A 3CJXA 3DYMA 5C3PA 2ZAHA 1XSRA 5FUNA 2BUKA 1LOBA 2YROA 4DUWA 1MS5A 3O1VA 1W6NA 1W2TA 3OG2A 4Q4V3 3JXSA 3AMQA 3RYPA 3KV4A 1UZZA 4RR3C 2HH9A 5L19A 1H4GA 4GQ7A 1RHI2 5F8PA 2R072 4NIIA 3ZVXA 1YI7A 4FXKB 4Q29A 1BVP1 1OD3A 2RMU3 2V72A 4WVVA 2O8OA 1OOPB 4HT1T 1XQNA 4YPJA 3VDAA 2VO5A 2R071 3OTFA 2QQLA 4CVUA 3THPA 2VW0A 3WW1A 2ZGOA 2WAAA 3K51A 4F8AA 4HVQA 2HWD2 2VAUA 4HN1A 3DPRB 4Q27A 5KXDA 1OOPA 5IK8A 2RVAA 2JKXA 4UFKA 2HWD1 3AVRA 1W8NA 2FDJA 2YV8A 2D44A 4NWVA 3SCFA 5E88A 1RUI2 2P3KA 1ZREA 5I93A 1W2AX 1WLDA 1PVC2 1Q3EA 3W59A 5IVVA 4BQXA 2VPVA 4CUCA 3DPRA 2ZGUA 1RUI1 2DCJA 2JICA 2VGDA 2WO2A 1PVC1 2DWRA 1W2OA 3CO2A 1VMJA 5BNPC 2CWSA 1V9U1 3PL0A 2ERFA 3H0OA 3I3BA 3OEAA 4C1WA 2EXIA 5B2GB 4Q4X2 3EMRA 4A7YA 1C28A 5FPBA 1TZOA 2CV6A 1S2EA 2OUHA 2X5IA 1YFYA 5A33B 1JBCA 3C7HA 3T1LA 1V6MA 1ZZBA 4Q4X1 1RVF3 1G9CA 2IXLA 2VCBA 1V00A 4MGZE 4WM8C 1ASJ1 3VLBB 2Q1FA 3WINE 4YGBA 1AR63 5FMDA 3KQRA 5FYZA 1ZM1A 1A8DA 2GH8A 4LOSA 1J59A 3RYKA 3SQOA 4P9JA 5FY1A 2ZHKA 1NE6A 1VB4A 4Q1PA 5A33A 1G6NA 2RV9A 3S0MA 3AJZA 3LDBA 3LQCA 3OUHA 4SLIA 4R9CA 4XCBA 2Y34A 5F3IA 4BYYA 1KXGA 4QKBA 3Q8AA 3ITQA 3WQ0A 5KHGA 1ZA7A 1K42A 5GALA 2VMDA 4M01A 2V09A 2DCYA 1TNFA 3FHIB 4PIXA 5K9YA 4R4XA 1JI6A 4KWLA 4IEZA 2A1XA 3A22A 5D8AB 4CCMA 4H7LA 4TYSA 1POV3 2BEOA 3PTYA 1H9PA 4XOGA 4XFBA 2EVXA 3N9PA 4G4FA 2WT1A 3KWVA 5JR7B 4LNVA 2D3RA 5EPAA 1OA3A 1PX4A 3WVJA 2VL4A 5AFBA 2I74A 1AX1A 2R0FA 5D8AA 3U07A 1LCLA 3BALA 5JI7A 4C8DA 4BISA 1C5IA 5FPAA 3HAGA 1LOCA 3C7OA 3Q8FA 4N9HA 1MQTB 4CDXC 5J96B 1RMU3 1RUG2 5LA1A 2JB8A 2PFWA 4CU8A 4JKMA 1DZQA 1US2A 1GWKA 1KQRA 1XU2A 2RDRA 3AZZA 2V5DA 3MV11 1BEV2 1NY72 1JXNA 4LE4A 5J3UA 1IG0A 1RUG1 4YM0A 1UL9A 4FPEA 3ZFFC 1F31A 5F2SA 4IEPA 4C90A 4LHLA 1MQTA 1BEV1 1WMEA 4UFHA 1JZ5A 2I2SA 2KA3A 2BNOA 2E32A 3OGGA 4PI0A 1WMDA 3ZXGA 2HEYF 2GC1A 5ABJB 5CADA 2MHFA 3SC7X 1LGNA 3H8XA 1F35A 4H2AA 4OUEA 4OUMA 3LKJA 3A0KA 4XFAA 5A6ZA 1FATA 2W2IA 2ZGTA 5FTTC 5JCTA 4ZY9A 5F6KA 3OPWA 1ENQA 1R1A3 4CDWC 4IEWA 2AH2A 5T5PA 4BE3A 1UY0A 2W1WA 4YZ2A 4P9GA 2RE9A 3VHNA 5AC93 1JMUB 3WDYA 3ZSEA 3UL2A 4I0WB 4AHXA 1RUJ2 5IAVA 1QQP3 4NHKA 1GNZA 3WQBA 3THDA 1WLWA 2BFUL 3ETQA 4IEVA 2F17A 4CE8A 2DFCA 1VLNA 5FMOL 1RUJ1 4CRQA 4N43B 4XFCA 1CAVA 2GN7A 4H3WA 4HKLA 3DV8A 4JZRA 4EJRA 3AMNA 5IVCA 4XC9A 1IPKA 1CIWA 3VD4A 1OH4A 1GP6A 1PK6C 1R1ZA 4DNYA 1NZCA 2XL7A 2G9ZA 4XF9A 3PVOA 3AM2A 3KS7A 4PDWC 2X05A 4FPKA 4N43A 5E8AA 4DUXA 2QFEA 5CU1A 1LNSA 1QHDA 1O91A 4FTEA 3M1HA 5C9AA 2VVDA 3PU3A 1UY4A 2GC0A 4QQPA 4CTEA 4K7JA 4AQTA 1Q8VA 4XXAA 5A7NA 4EZ4A 2YPJA 1WW5A 2KR2A 4Y5Z0 1KDMA 3AVSA 3ZN6B 3I3DA 1DFQA 2WQ4A 4FPCA 5A3OA 2NZ9A 2LM3A 3WNNA 2WZR3 5BYNA 1W8UA 1MS1A 5T50A 1NXMA 1VJ2A 4NPMA 4BZ4A 5FUIA 1X36A 1OMIA 4RYDA 4O65A 3ZX7A 1DGRA 2YG0A 5LBEA 4JAAA 1FMD3 4B4QA 4D7SA 2P4EA 5L36A 1KFXL 1OXCA 2P3YA 1DQ1A 4QXBA 2E63A 3ZN6A 5TSWA 4BJ0A 1C1FA 1FAYA 3K48A 4HK9A 5CFCC 1MR5A 3S30A 5JMCA 3PJYA 4JDMA 4YM3A 4LBNA 5F32A 1AHSA 2PHWA 2E31A 5FZDA 3OUJA 4FPHA 1PO12 2NQYA 2XB6C 5J48A 5FY9A 4GIQA 3ZXLA 3LOBA 4W50A 1TME2 2PLV3 1Z7S2 2CAUA 4BOWA 2WO3A 3J26N 1QXJA 4Q4W3 1UY2A 1ULGA 2GH2A 3M70A 2Y60A 1GLHA 4GKYA 1AJKA 2MEV3 4NJ4A 3ZDSA 4DY5A 3E6CC 4QXHA 3H3ZA 1TME1 1JODA 1Z7S1 3ABZA 3Q8EA 4QXCA 2FDGA 3K46A 2ADEA 5A7SA 2RHPA 2JJ6A 4RQPC 4INDA 4ZPIA 2SBAA 1GOGA 3E5QA 3AXEA 3K75B 2ETEA 2ZMLA 2QCSB 1O7FA 3VBOB 4RD7A 2RS33 1UPIA 5KC5A 4PJYA 1XYNA 3MDPA 4RS5A 3KCYA 1U5YA 4XF4A 3OBAA 3HQUA 1HJFA 5FZOB 4CDUB 4DQAA 1FV2A 4EN8B 4YZ1A 3E97A 5M0TA 3LPFA 1DZRA 2Q1ZB 2GMPA 3N9QA 4D6SA 2XWBB 2UY8A 4QPIC 4IERA 1W8TA 4MX3A 1GKBA 4OI0A 4Y22B 3PJQA 4MV2A 4XILA 4Z07A 5ACA2 2AGSA 3ZYBA 1H8TB 2E51A 4YSFA 4XJAA 3ZM8A 2ZGKA 2QUOA 1NQJA 3VB9A 4CDUA 2SLIA 1VBA3 1N1TA 3QD6A 5FZEA 1W6OB 4DINB 3P5BA 5GJ6A 2EIEA 5T5OA 5GZFA 3OPTA 4B7EA 1XYPA 1EPZA 4Y22A 1MS8A 4K40A 3WNMA 1YUDA 2DUOA 4IETA 2C9KA 1EV13 1H8TA 1MACA 2Y33A 5EP9A 3JD73 5LBCA 4QM9A 2R7EB 2CYFA 1VRH1 1SLIA 2UU8A 4Y1ZA 1AR93 5I0TA 2DYCA 3V56A 1W8WA 5LEJA 3LDKA 4DFSA 1W6OA 3MIGA 1O3RA 2CWMA 2XJVA 1LB2A 5FZIA 4TTGA 1TNRA 2ARCA 2VC9A 5DUVA 3EB7A 1Q8SA 5FZGA 1CWPA 1NX9A 3UT0A 1YQ6A 2XBO3 4DY3A 3B7MA 3ZPOA 1WZXA 2TUNA 3NW4A 4B4RA 3VD5A 4WZCA 1H2KA 3C7EA 3WV6A 3I3QA 4HSLA 4XDPA 2E7AA 5FXWA 5KXEA 2WO7A 4P08A 5KHIA 4BQYA 4CUBA 4GALA 1TMF3 1C3HA 1VB2A 1XNTA 4OHYA 4XFIA 4IDZA 3WUCA 5A7WB 4E4SA 2OYZA 3HT2A 2XLGA 3TN92 4NRQA 2RS52 1QMJA 4IL7A 4AOCA 1B09A 5B4NA 5EXOA 3IAQA 5ANQA 1N3QA 3POSA 3NNMA 5EYYA 3TN91 5SV8A 2RS51 3POYA 2GC3A 4JHTA 3UETA 1HN1A 1VBD2 5JR2A 2B7YA 3BU7A 2R043 1F2NA 3ZKUA 1ACCA 1PHMA 5CFDC 3BTZA 1U5IA 2GMEA 3ZN5A 5HCBA 2H0VA 3AKTA 2Q30A 3JU9A 4LK7A 1J3PA 4AR2A 1VBD1 3QBQA 2QE3A 3EHKA 4LO4B 3KHBA 4CCCA 4IEUA 3GCWA 4QX1A 5BPXA 2NP0A 1VBC2 4AAXA 1LOFA 1QJX1 1W04A 1YO8A 2DUQA 3MLLA 4NWWA 4P9LA 5C3QA 2WLPA 3M4FA 3QLQA 4A4AA 1ALYA 1RUC3 4KU7A 1VBC1 1BMV2 1REDA 3R4SA 3HEIA 3NNFA 1LEMA 5BY5A 1UY3A 2QQJA 1VAKA 4B29A 1BMV1 3OUIA 1G9DA 3AFGA 1QKQA 1WBLA 2ZGNA 5K4LA 4FBFA 3KF3A 1AR82 3ACLA 3O0XA 4FT8A 2WSVA 2QBXA 1AR71 4NPLA 3RMXA 4AGRA 4LIUA 1UZYA 3NJVA 4YM2A 4YW2A 5GKAC 1QOOA 4PIZA 1AR81 2ZX3A 4LUKA 1ULCA 3J7MA 4N53B 3HWJA 4IV3B 5FP8A 1QJY2 2ARXA 2HYXA 3U4SA 1UXXX 4ZS2A 5JLVA 1YHFA 1LU2A 5CB7A 2RDSA 4KWUA 2O0OA 2HWE3 1FPN3 1ODMA 1OD5A 1P8JA 2GZWA 3I2DA 4XMAA 2A6WA 2UWBA 4HVOA 3WDUA 2OA2A 5HBAA 2YFUA 3LPGA 4N53A 3VZKA 5IHRA 2Y0IA 5KXCA 5LA2A 2GP3A 3WNPA 1QGLA 2OPKA 2EF6A 2QQWA 1HN0A 1VMFA 4S2DA 3ZR6A 3PMSA 1SPPB 1ZBA2 2VCAA 3ZXJA 1MS9A 1VBB3 5J09A 1PGW1 2HLEA 4YYOA 5CEHA 4QKFA 4ZXKA 1HRV2 2LRPA 4LLFA 2LTNA 3ZXAC 1ZBA1 5C6CA 5DDJ3 4KU8A 5HPOA 1UKGA 3SXWA 2YGLA 3GBWA 3MW3A 4A2UA 1SPPA 2ORZA 2VOKA 3AMMA 3AYAA 3C7GA 1PNFA 1OPMA 2HKXA 3T2PA 1JYXA 1DYPA 2OZ6A 2W39A 2UY9A 2CNAA 2JDZA 1VBE3 2GALA 2BGPA 2ZJCA 1C5HA 4UW4A 4BHPA 4J1XA 5F1RA 1GP4A 3GXUA 1OF3A 3OJBA 3W9AA 4E9KA 2VCMA 2HWB2 1PZ7A 3N7JA 1WCKA 4KGQA 1DQ5A 4BXSV 4H55A 1DQ0A 2YBPA 4YZ4A 2BVBA 1W0PA 2JECA 3WLUA 3GZAA 4BB3A 5FPZA 1B35C 2HWB1 3OY8B 3UV9A 2P34A 5EV7A 5DQ0A 1RHI3 1LHVA 1TEIA 3NO8A 2OX0A 1LODA 1XB9A 1AZDA 3WG2A 4ET7A 2Y6GA 3NNJA 4XAAA 4UWDA 2HEWF 3G7DA 1RUF1 5GLUA 2JIGA 4NPRA 4XDOA 3IDCB 3ZXDA 3I2KA 1JN2P 1Q8PA 2HWD3 1OURA 4XF3A 4XUQA 5FPVA 1O8SA 3F95A 1RC6A 5DPNA 1RUH2 2VQAA 3ZO0B 2Q8EA 1CAXB 2GNDA 3K77A 1QF3A 4N9IA 1PMIA 1YCIA 2WNVB 3CEWA 1UZWA 1RUI3 3ZDVA 4DPNA 4BK4A 1PVC3 3UKVA 5JPMB 4FPJA 2H0BA 5HXVA 3NNLA 1ND2B 2PQSA 4AW7A 3AMPA 3BU0A 2J1TA 1S0CA 5JSOA 1CAXA 2HWF3 4QPWA 4CU6A 1GU3A 5HCFA 2ZXQA 2WNVA 3GGLA 4LORA 2B5HA 3VBUC 4DEVA 4ZONA 1MEC2 4MHRA 1SFYA 1O8PA 1KGYA 2W47A 4AHYA 4Q4X3 3O0WA 1SCRA 3UYJA 4RS5C 2Y6KA 3AZVA 3MW2A 3VBFB 1MEC1 4CUAA 2ET1A 5F5AA 1ZBE1 2FCUA 5L9VA 3MLKA 3B3QE 2WNUB 3KM5A 2D43A 1DQ6A 4IEYA 1D4M2 2IXCA 4KBZA 2A6VA 3O1OA 5A7OA 1COV1 2BGCA 3NMBA 3VBFA 3TEYA 4ZKTB 4WV8A 1D4M1 2NYYA 1WD3A 1HV0A 2VBBA 5C33A 1PZ9A 3WW2A 4MHUA 4YW5A 2WNUA 3BN6A 3NWKA 4LBJA 3T4HB 3ZYJB 1SHWB 4ZHNA 3ASIA 3WDTA 3WG4A 1FNZA 2B42B 1Y9QA 2OXBA 4E8DA 5ISLA 3KT4A 2QZ2A 1JYWA 1UU5A 4E2SA 1NE4A 1WWYA 3I2HA 3GHMA 1HRI3 2QQMA 2GU9A 4C1XA 2E26A 1LULA 4IEQA 5FAXA 5L73A 5JXJA 2GNTA 1QH7A 3OYWB 1WW7A 3M3QA 4BQ3A 4XQ4A 5JPNB 5LA0A 4KG0A 2IVJA 1Q8QA 3GM8A 4WM7C 4A7ZA 5F3CA 2VOWA 4HVRA 4XIOA 4AFMA 3VBHC 2WS92 3ZLIA 1W9SA 2PELA 1A6CA 4EYUA 3PIGA 5DABA 2DCTA 4X6QB 4QGNA 3TRSB 5C3OA 3OYWA 2JG8C 3DF0A 3RNSA 2QZ3A 5C4WB 4FOVA 3U75A 5DAQA 1PIV2 4P9IA 3IKWA 2NN8A 3A21A 4LOTA 1U0AA 2IXHA 1FX5A 4GWIA 5FREA 2FDHA 3LCPA 4EWAA 4Z8BA 1ULPA 1L7RA 3I49A 3N4MA 4OMCA 2DV9A 1X7NA 5C4WA 1BBT2 1DU3D 1WLTA 3R6SA 1UX6A 3G6JB 4LBMA 1QDOA 4TN7A 1YXWA 5G05L 4AHWA 5C71A 4OQ8A 4AYUA 2AZ5A 1BBT1 4LPLA 4QWNA 4CP2A 2CDPA 5IWFA 4MXVA 1PMJX 5FV3A 3ON7A 4LTAA 1UNBA 5C8CC 3GZTB 1RUJ3 4HETA 5LZ6A 5E1RA 2XLAA 1BYHA 3M3CA 4A3ZA 1DZTA 4MG2A 5CG9A 1KJRA 1PZ8A 3ZKYA 3A7QA 4AEKA 5EZWA 4D6QA 3H3LA 5A32B 3M3IA 5J7MA 2XPJA 1S0DA 1F15A 5EJ3A 1WA6X 4OHXA 3KD4A 4XCAA 4NMIA 3AL6A 2YFZA 3BYWA 3H7JA 4MGTA 3SH3A 5FQ0A 5D21A 5J36A 4W8JA 5EHDA 4H14A 1ZRIA 4IV1B 2ENRA 4CCKA 3VZOA 3BVCA 1V0AA 3POBA 2UWCA 4X8PA 1U5ZA 2FZ1A 1GZCA 1UOBA 4XUOA 1QJU2 5FY7A 2JD4A 4DZGA 2EA7A 3D3AA 4YNIA 4GWNA 4ARYA 4ASMB 2UWAA 2VH9A 3OD4A 3FFQA 1QJU1 1JUIA 2A3XA 3K4AA 1W9TA 4IV1A 4YGCA 5IJRA 1SFPA 2Y64A 3U37A 3VL9A 1YIFA 2D97A 3A0NA 4IESA 4OI4A 1WCUA 1H0BA 2WN2A 4FAHA 1MZ6A 1QU0A 4GJZA 3NJXA 3FLTA 4NIAA 3WR0A 3W20A 1NLRA 2D93A 2FMYA 2G1MA 3MI8A 5DAWA 5GLWA 4CP9B 5JAXA 1HW5A 2XKPA 3TAYA 4QM8A 3GALA 2LW8A 2JDPA 4RL7A 5FZBA 2PHTA 3M3OA 3M3EA 2VVFA 1UZ0A 5CFCB 2HBTA 3POFA 4CEWA 4UW3A 2MPFA 3WD5A 5C5TA 4OZXA 4CCOA 5FXVA 4BA6A 4XYXA 5FP3A 4CP9A 2W87A 2C26A 3ROUA 1PGSA 1EYBA 1PO13 1IS4A 1DCSA 2VXJA 4A3XA 2WFF2 2VMFA 1D2QA 1H2LA 2W08A 4XETA 1JZ2A 1QNWA 4S2HA 2DVDA 4OI1A 1NA1C 1DGRN 1O4ZA 3DYPA 4FPLA 3U1XA 4GD4A 1REEA 1RUD3 1UMIA 1WKYA 1X9PA 1Y7BA 4PF1A 1AL22 1TVGA 2WFF1 2ZEWA 4L99A 4W65A 1G9AA 4UOJA 4YVWA 5HV0A 5K8SA 3O1PA 3O1SA 2JG9B 2ZHNA 1R082 1VPHA 3ENRA 2BWAA 2ZZJA 3UGFA 4LO7A 1AL21 3QCWA 1YI9A 4KL1A 2J1EA 3MIHA 2DTYA 1R081 5EIYB 2VZ3A 4KNCA 3H3UA 2EXKA 4AI9A 2JG9A 5L9RA 4XZPA 1T6BX 2W94A 3NAPB 3PURA 2OPWA 1W6MB 3S57A 2ZGQA 4QPIB 2VTXA 3HPNA 1R64A 3S7IA 4DRVA 1V9U2 1ZRFA 5ACA3 2PHDA 3B01A 3LWCA 5IK7A 1ULDA 2IXJA 2C0ZA 4LJHA 2J1SA 4XUPA 5CNAA 2A3WA 4QQ2A 3UJOA 1W9WA 3NAPA 3WF3A 5GLVA 1W6MA 1HB3A 4AVVA 1JZ6A 1KRIA 4AFAA 3ZYIB 3ORJA 5FYSA 3IMNA 4IE5A 3B94A 4HL0A 4IE7A 3N7MA 5JZGC 2XJPA 1RYYA 1QJEA 2ZGRA 1HIXA 1QJFA 5FYTA 4I09A 1OHFA 4YW3A 1ASJ2 1GQHA 2ARAA 5FBZA 5DAVA 1UF2C 5JSRA 1CX4A 4Q26A 4AF9A 2NMNA 1Y3TA 2RJLA 3BPSA 4ZU7A 4RSUA 5FBJA 2CSGA 5FZ0A 2R1DA 2PHXA 3I2OA 4BPZA 5IAXA 4COUA 2Y6FA 2VMIA 5I91A 2VQUA 4AVSA 3RYRA 1F4AA 1S1AA 2XHNA 4RHV2 5CA6A 2HEVF 2VULA 2H6BA 4GH4B 5J37A 1C4RA 3RZJA 3DGTA 3KV5A 1CN1A 1SACA 2XDVA 4RHV1 3WG1A 1GMMA 1K3IA 3AK0A 1AVBA 4KI5M 2BBAA 2ZACA 1U5XA 2XJTA 4LLOA 5F3EA 5FY5A 1UYPA 4AEDB 4JGYB 3TN93 5FFOC 2RS53 4DS0A 4CXYA 3RS6A 3LZZA 4GH4A 1CESA 1JW6A 1XC6A 1H8VA 2WT0A 3UK9A 2YMZA 4MYEA 2XG3A 1NAEA 5EYXA 4P5HA 3ZIXA 5BNNB 4M3CE 5HCHA 1W6PB 4MSVA 4AEDA 2WQ8A 2YHJA 4NOTA 1O59A 2EXJA 2IWGB 3OBRA 1AYM2 2WSUA 3HVDA 3K2OA 3QH7A 2VECA 4KG8A 1XNDA 3WEZA 1FT9A 2JDNA 3N7LA 3FLPA 3OSDA 5FXXA 1VBC3 2XL9A 5FYVA 1AYM1 5BNNA 5JXHA 2R32A 3LIGA 4GWMA 2AEYA 1W6PA 1IKQA 1ZNPA 4ZZ5A 3QH6A 1S0FA 4COWA 3LA2A 3WP3A 2VBDA 1J1TA 4NHMA 4KWKA 2EIDA 3VBSC 4YFZA 1GANA 1K5MB 3T30A 2EALA 4FQ4A 2AR6A 1W06A 2VU9A 5GZEA 1SDDB 4BIOA 1HB4A 3POWA 1KD7A 1G9FA 3AZXA 1O3SA 1SBEA 4WVMB 1XOYA 4NUBA 3KGLA 1FI2A 4QX3A 4NRMA 3LGRA 2LUWA 3H8RA 5BNOB 1UOJA 1AR83 2KXLA 3DCQA 3HOBA 4NHYA 1K5MA 4GB32 4PHZA 1A8MA 2A3YA 3TWIA 3AKPA 3WNLA 2VUJA 4ES9A 1QJZA 2P6CA 3F2ZA 1LESA 4EN9B 5L7OC 5E16A 2B4KA 2BJSA 4WVMA 2WKKA 4UFJA 2YU1A 3WW3A 4BMBA 1X8MA 4GB31 1ZZCA 2HJIA 3D5OA 4CEYC 4JGZC 5ABJA 3MIEA 1QJY3 5A1LA 5BNOA 2B46X 1BK0A 1YIPA 3MPBA 2Z5WA 1K12A 3T09A 3C7FA 1GOHA 2BYVE 3ZFEB 1OF4A 5FYBA 1S2KA 3ZMNA 5FO7B 1W8HA 3ZN4A 5CISA 1X50A 3KV9A 4ISRA 3RWNA 3SH4A 3QACA 4X6RB 4XJWA 1W0NA 4YVSC 4AVAA 3LEKA 5F5CA 2GDFA 4FXGB 4DXSA 3WHTA 1E5RA 3ZFEA 4CP1A 4OULA 4Q4Y2 3RSJA 3O1MA 5CVRA 1JS9A 2YU2A 3J9SA 5FDBA 2VW2A 1HRV3 2RM23 1TQ5A 5I0DA 4O9EA 1ONAA 4UFMA 3W21A 2QVSB 4Q4Y1 2RR12 4IE0A 3TNPB 3OBTA 2ZEZA 5FZ4A 5FXZA 4UW5A 5BXXA 3VKOA 1NG0A 4M3CB 5AVPA 2D98A 3WG3A 2WFPA 1OQ1A 2RR11 4UF0B 2VMHA 4XBQA 4XJUA 1LRHA 3WXPA 4IW3A 1PO23 2QDNA 2VNGA 3I97A 4JX0A 3S7EA 5C3SA 4QHZA 2VXRA 2XUMA 3B93A 2EIGA 2HWB3 4UYBA 5K0UB 4M3CA 2GSYA 2JD9A 3D0SA 3CJIB 3UESA 1SEFA 4XXPA 3CU7A 4UF0A 4CCNA 1EAH2 1H30A 2GMMA 3FZ3A 4FAGA 3LSDA 3UKNA 2DBNA 3WSOA 2X09A 2ZX4A 3KLSA 2P6HA 5K0UA 3LF7A 4ASKA 1EAH1 3WNKA 3J8F2 2ADDA 3CJIA 3EYPA 3B02A 3IWZA 2C24A 1W0OA 3B9CA 2D5HA 4QQOA 4AEJA 3UGGA 3DXUA 5A6QA 2LROA 1UAIA 1NCRC 3J8F1 1O5LA 2PHFA 4DIQA 1DHKB 5KR7A 4FFFA 4BQ4A 4QQHA 1RUH3 4FFIA 1YYNA 4OYUA 4QXKA 3Q8CA 1CZSA 1OLQA 3AZWA 3CHXA 2ZZQA 4R9BA 3NJZA 3E5XA 3LAGA 4MGQA 1CR7A 4RGKA 3VDDB 1QOSA 4K20A 3BCWA 3N9LA 4YVWC 3WDVA 2P3JA 3FWEA 2XJUA 5EJ1B 4IUGA 5A7QA 1UZVA 3LFIA 4BXFA 3LSEA 1GFF2 2XLFA 3IMMA 3JBG1 3PDQA 4A45A 4W6XA 4Y1YA 3VDDA 3BI3A 1E57A 5H9QA 4GXLA 3J7NA 2WC2A 3U10A 2RMU2 1MS0A 1OOPC 1UYZA 3NV2A 3VBOA 3AP4A 3D82A 4KGGA 4NVPA 4L97A 4B8EA 4QB1A 2WWUA 5FZOA 1HXS3 5IUQA 3I3EA 1W8FA 2RMU1 3CMGA 4I30A 4W4ZA 1D4M3 3RQ0A 2NMOA 3ZSMA 4OZOA 1VRH2 4FPGA 2P37A 3RDIA 4XPVA 1LTEA 4HSJA 2J7MA 3DPRC 3ZXEA 4C91A 4G3YC 1CIYA 4HANA 2ZOEB 1QH6A 5IK5A 2O8QA 3VHOA 5FCCA 3MUZ1 4OLLA 4YGEA 2FMDA 5FOBB 3WDXA 2YDEA 5FZCA 4GWJA 4B1MA 1VMHA 1MZ5A 2DVGA 4IQPA 2AUYA 5CKMA 2VQ0A 4D7TA 5C5UA 4CCLA 2J42A 2X5IC 4BQ5A 1OQEA 4XHXA 3VBRB 2YC0A 5FYUA 4FSJA 3ZMOA 1W9FA 4XF1A 1EP0A 5IFPA 4H7MA 3N9OA 1H6XA 3SH5A 5JIUA 1FNYA 2CTVA 4IE4A 2WLQA 3I8TA 4OHWA 4MGYE 1UIJA 5HXMA 1PM4A 1XYOA 1QXRA 2QNKA 2Z79A 3FFZA 4L0PA 1DGWX 1R093 4DB5A 4QPGB 4XQDA 5DG2A 3HBKA 4P02B 3MUY1 3VBRA 2WS93 5JXIA 1RVF2 1NOVA 2YGMA 3A23A 3DL3A 4BQ1A 4L92A 4XACA 1JYIA 2XHKA 2W68A 1NLQA 4YW7A 5A7WA 1W99A 1RVF1 2JG8B 3MYXA 4YM1A 1QJX2 2YXSA 4XTMA 1PIV3 5I8SA 3H8OA 2WDBA 4IGPA 3WF4A 3RFRA 2W0XA 4AI2A 4DXZA 2Y0OA 1EUTA 4U2AA 4OVEA 3AJYA 4NE9A 4LA2A 1F4HA 3BTXA 4Y3OA 1TE1B 3BTYA 2JDUA 1ND3B 3B9IA 3FJSA 4WVZA 5D8AC 2ZGLA 5A3NA 5A3WA 5AVAA 2W9XA 2DCZA 3TBDA 3RZGA 1UMHA 2A6ZA 5F37A 2ZGPA 4QB2A 3RJ2X 1C8NA 4UW6A 4AI0A 4QU2A
chains in the Genus database with same CATH topology
1RINA 2XWJB 3T2TA 1AR72 4AFDA 2PAMA 4S2GA 5JOYA 2A71A 1POV1 4FOYA 4M00A 1GQGA 1ND3A 3FLRA 3WHUA 1WD4A 4JRAA 4OI2A 2PN5A 2DTWA 4SBVA 4XFFA 2OZJA 1MQTC 1H4HA 1YJLA 4FCAA 5I0RA 4JVAA 1LOAA 2JKBA 2E9QA 1RMU1 4YLZA 1BCXA 4CDQB 1A78A 5FLJA 1CD3G 2ZKLA 3CNAA 1J1LA 1XNBA 2H6CA 5ABJC 4W6YA 4IV3A 1IKPA 1PGW2 4QT6A 5JDBA 4FTSA 4QGLA 2N7GA 2PHLA 2V73A 1NCQB 1AUYA 2JE7A 2A5ZA 5FLIA 3B69A 1BZWA 4LULA 3AKRA 4BWOA 4LHNA 1EPWA 2C1FA 3SLIA 2VNOA 4M0NA 4UBHA 4LUMA 4WZFA 2WIIB 1NCQA 2IFWA 3UJQA 4A7KA 3ZFGB 4N43C 4PBPA 1QQP1 3EJKA 3WDWA 1N1SA 1SDWA 5C9AC 1WUVA 2K2SA 2OIIA 1NQDA 3SMHA 4RGAA 1FV3A 4XMIA 1D4VB 5A3LA 5I8TA 2GNBA 3TYJA 3ZFGA 2CY6A 1DBNA 4ES8A 4Z2WA 4JV4A 3WNXA 2UYAA 4RR3B 5FO9B 2WINB 2IC1A 2R073 1V6OA 1RUF2 4XW3A 2F6BA 4I02A 1R083 3THTA 1SCSA 3OY8A 2DVAA 3MZHA 1YFXA 4ITCA 4XDQA 4D7YA 4LA3A 1BKZA 2WZR1 2UURA 5DZEA 4Z92B 4ZU5A 3WUDA 4L9BA 2LALA 1AXYA 4M0HA 2VOXA 1W39A 1V9U3 3LOIA 1KITA 4BH9A 1O5UA 3D0JA 2D6NA 5BNPB 3MFAA 5DUXA 3E6DA 2VY0A 4XJZA 5GZGA 4Q4W2 3ELNA 1LU1A 3ES4A 5JZGB 1ZBE2 1ZRCA 1WMFA 2B9UA 4COYA 4RFT0 1ND2A 3PVEA 1ASJ3 4Q4W1 1D0HA 3GBGA 4L8QA 3AYDA 4N7IA 4X8NA 1DQ4A 1XE8A 2MEV1 1COV2 2BW8A 4WM8B 4I2OA 3GZUC 3NKTA 3VBOC 4HLTA 4P9YA 4QHBA 3DKWA 5JOXA 4CDUC 1ZZ9A 3VZJA 3MF6A 2P2KA 4WM8A 2IZWA 2I07B 2FHRA 3JCIA 4J6GA 2XH6A 3USSA 1OA4A 4Q1RA 3VV1A 1FOD2 1H8TC 4MZUA 3WW4A 1IZ3A 3E6BA 4F3JA 4Q0UA 1FOD1 1N1VA 1BQPA 1H2NA 2BBVA 5KBFA 4XIKA 4I01A 4IXLA 2GNMA 4ISQA 3OCPA 4FVVA 1CJPA 1I9RA 3JD72 4Q0PA 4GMP1 3WP4A 3KT7A 4CDXB 2VG9A 5LRSA 2PAKA 1CPNA 4COVA 3RG0A 2V5YA 4EV0A 1RUG3 2JENA 1BXHA 3JD71 4XEZA 2XBO2 3C3VA 5KHJA 1OI6A 1BEV3 4MLOA 4QGMA 1N3OA 1RTVA 3ZFFB 3M8LA 4DRRA 2XBO1 4CDXA 2K0GA 2NM1A 4YW4A 5C8WA 3SITA 4MGKE 2ET7A 4HPKB 1UU6A 4Q0SA 4DOUA 1WW4A 3FMGA 5JWPA 1RB8G 2KM2A 2XJSA 1TMF1 1M4WA 4GB33 3ECQA 2R30A 1SFNA 1VIWB 1Y43B 2AENA 1AJOA 4YG6A 4JC1A 5LEKA 5L7OB 1LOFC 2NPIA 2TEPA 1YNAA 4CDWB 3FX3A 3VGIA 4JGZB 3BTAA 1DLLA 5CBLA 2BPA2 2R041 5K7PA 3UKTA 5FOJB 2GAUA 4YZ5A 2ARBA 4FPOB 3Q9OA 4Y4YA 1AYN2 1LHWA 4CDWA 4LT5A 4WBBA 4PIYA 1J3RA 2A6YA 3A4UA 4FPYA 1ZZ8A 4FOQA 4LO8A 4PLOA 3KZ4C 1AYN1 3VZMA 3O14A 3FUQA 1PK6B 3OD0A 1RUC1 5J98B 1WA4A 2ZPXA 4RA0A 3BOWA 4AK3A 1DF0A 4PDWB 4BLJA 5A32A 3KB5A 1AXZA 1YFWA 1HQNA 1S2BA 1V6NA 3NKGA 3VKMA 2D3PA 2ZX1A 5JI9A 4OUSA 1PK6A 4LBKA 4EWDA 1GZ9A 1H9WA 4QPYA 1OFSA 3H1YA 4N53C 5GM0A 1BJQA 1N1YA 1RGSA 1VR3A 2Z42A 5KHHA 2B45X 4Y26A 1FPN2 5BNQA 3VN4A 3H50A 3KGZA 1EAH3 2GC2A 2VVEA 3ATGA 2HWE1 1FPN1 2OVUA 1Q56A 2WZPP 3KCCA 2YUEA 4JDOA 3J8F3 1LOEA 4B3NA 1G8WA 2NLRA 3FE5A 4I3PA 5GLZA 3TB0A 4E2GA 4CYDA 4V1PA 5DDJ2 1KFUL 4I0AA 1TME3 1XXNA 1Z7S3 5CFCA 3SISA 1I3HA 2QQPA 1JTZX 3H1MA 3CLPA 5DDJ1 3SNMA 3BPZA 2HWC2 5I0SA 4XBLA 4N7UA 4BIFA 1VBE2 2R062 4Q2FA 2VUAA 4K21A 4RQPB 1VAVA 1YWKA 2XJQA 5FPXA 2HWC1 1IHMA 1RIRA 4YRDA 3IDBB 1UW8A 1VBE1 3LA3A 2R061 4P9XA 2WL1A 2WA3A 5T55A 2WT2A 3VKLA 3GNEA 1GV9A 1KS4A 3AXDA 1WBFA 3SCHA 4Y1UA 1ENRA 3V64A 4RQPA 1V6KA 4P14A 2BNMA 2X53S 1HQWA 3O0VA 2ZMKA 5EFUA 1RHI1 1QOTA 3AFKA 3WP6A 5GZCA 1FYUA 3H7YA 3LA7A 3NL1A 5E89A 1QY4A 1VRH3 4QPIA 1UMZA 3O12A 1LR5A 5CIRA 3VUOA 2ES3A 4MXWB 5HCAA 1OSGA 2WNVC 2XJRA 3PLQA 3WCSA 2B8MA 3AKQA 2ZCWA 1HX6A 5JVVA 4K8FA 1UKRA 4MXWA 1ND2C 2Y26A 2FZ2A 4AVTA 4YG0A 2HWF2 2X5IB 1DG6A 1O4YA 3I4IA 4K1YA 1WCDJ 1S0JA 1I5ZA 4AI3A 4PQ9A 3INAA 1UCXA 2GN3A 2HWF1 3MPPG 3RPQA 2WWSA 1V6JA 2Z69A 3VBFC 4Z82A 3APBA 5KC6A 2QDRA 5D1IA 5F5QA 5LK5A 4F7ZA 2ZGSA 4AFBA 1V6IA 3ES1A 3WOGA 2WNUC 2F4PA 4G9SB 3CF6E 4AGVA 3KCXA 1VBD3 4KH9A 3V0BB 4YGDA 3U11A 1GSLA 1WLCA 3AP5A 4XJ9A 4JGYA 5T52A 4BM8A 5CFDB 2ZGMA 1QJX3 4OHVA 2BVVA 4K6BA 4K9SA 2RS12 1RUOA 2R16A 2G4IA 4NO4A 4AWDA 1ZA4A 1LENA 1GICA 4YW1A 2JE9A 1WGPA 3MIBA 1IOAA 1IGOA 1RJ8A 3CL1A 2EXHA 3V0BA 2RS11 1AX2A 5CFDA 4CP0A 2ZHMA 4YFWA 4AE2A 4F83A 3N7KA 4NR1A 2ZKNA 3ME2A 1S0BA 1MZFA 2ILMA 3GBFA 1HRI2 3JUUA 4HKOA 3B5LB 3R4DB 1A3KA 4LO6B 1AR73 1V6LA 5CG8A 1DGLA 2C5DA 1HRI1 3IBMA 3ZXFA 3HT1A 3ILNA 4TLFA 4LE3A 3H1WA 3ILFA 1POV0 2DCKA 1CQ9A 2UYBA 5C4WC 1LGBA 1W2UA 3X29B 2D6PA 1YRZA 1GYKA 1NY71 2Q4SA 4Y1XA 4HKWA 2BTVC 4I3GA 1C8M2 1LECA 1SLBA 1SLTA 2D3SA 2G9FA 1LHOA 3IT8A 3R05A 1O3QA 1ZBA3 4MH0E 3L2HA 1X82A 1C8M1 4C0BA 4FTBA 3P3NA 2PAEA 4C0HA 4LBOA 1CAVB 1RUNA 2ZX0A 5JIAA 2QKDA 4MUVA 2HYKA 2DU0A 1PNGA 3VKNA 3RZZA 2EAAA 3MICA 3HMYA 1ENXA 1ZZ7A 2CGPA 2WQZC 4K3UA 4L11A 1QDCA 3HQXA 5C9AB 1DYKA 1DGWA 1XU1A 1LKNA 3MGUA 3PNAA 1QNYA 4HN0A 2R1BA 3WP5A 1U12A 4Q0VA 4W6WA 4Y1VA 2WA4A 3R4UA 2XVKA 2A75A 4IV1C 4M3CF 1OLRA 1X8EA 1B35B 2TNFA 3R0RA 5T5JA 1UIKA 4AQSA 3GF6A 1DDLA 3BODA 2CGOA 1RITA 3AB0A 3AMHA 1RUF3 1IS3A 3EXUA 1S0EA 1H2MA 2A7AA 2TBVA 2A73B 4JCKA 3PMEA 1Q5OA 3IIAA 1B35A 4YZ3A 1XE7A 1LEDA 1QWRA 2ZMNA 3EBRA 3GYDA 5SV5A 3N3HA 5GZDA 4CEWC 2AYHA 2E7QA 1BVVA 1SLCA 4HK8A 1AL0G 5JOZA 3AYEA 5I0UA 1RUE2 3USUB 3VHPA 4QD2A 4EN7B 4ORFA 2D6MA 4D94A 5I8YA 4JQRA 3N36A 1RUE1 3JBG2 4K1ZA 3I59B 4MVTA 1DIWA 1MZEA 4OFGA 4U36A 3USUA 3HR9A 4Q4V2 1JOJA 1H1AA 1VP6A 2D40A 2IFRA 3VBUB 2D7FA 5KXBA 1MEC3 3AZYA 1PO11 1ZBE3 1RUD2 1N47A 3NSTA 4KWJA 3I59A 4Q4V1 4LBLA 1OFNA 4RS5B 2JG9C 2D6OX 1CPMA 1H1MA 1RUD1 2DURA 1APNA 1YJKA 1COV3 2XKOA 3H8UA 3VBUA 4XHBA 3IM0A 4XQWA 3HN1A 2OUJA 1ZX5A 3VL8A 4HMZA 1JHNA 4ASLA 3NAPC 3IN9A 3WY6A 3FBMA 4GKXA 3DUIA 3I54A 1LGCA 1FOD3 2MNGA 2ZS6B 3BIWE 4QX5A 4J1WA 1HDKA 1MS4A 4O9GA 4AQ6A 2PQQA 1OPOA 5ACA1 4GA9A 1F8VA 1S55A 3WQ1A 4TSVA 4XFHA 3NV3A 2IXIA 4GMP3 4JDNA 1RJ7A 3T1MA 3U0ZA 4WVWA 3ZYPA 3SCGA 1HLCA 4LBQB 1LOGA 4WM7B 3VBHB 3MW4A 1HV1A 2YY1A 3ILRA 4NN0A 4PLNA 4UBGA 1S0GA 3MIFA 1AR62 1UPSA 4E4ZA 2A6XA 4GH4C 4R9AA 4GMP0 1ZRDA 5BV6A 4QPGA 4WM7A 2VOVA 4LBQA 3JQXA 1AR61 5KHKA 3VBHA 3JZVA 1N3PA 3SHRA 1D2SA 3O5SA 4JGYC 4AEDC 2JG8A 1BBT3 4N90A 4AVCA 1G9BA 1IQAA 3JQWA 3W58A 3FC0A 4DMIA 5BNNC 3VHRA 3ZYRA 2E7TA 2Q0AA 5C8CB 1J3QA 1Z0HA 2XVGA 1REFA 1XNKA 4Y20B 5F6LB 3MFCA 4AG4A 5FRAA 2CL2A 3JB4C 1AYN3 1RMU2 2RJKA 5H9SA 3D8CA 2EAKA 3ZIWA 4XTPA 2C9AA 4TZDA 1LJ7A 4XFGA 1MVEA 5T3NA 4E2QA 3M7AA 4ATEA 4JTOA 4R4ZA 4EN0A 5C8CA 1NXD1 2VW1A 2JEMA 4YARA 1K5MC 3RI9A 2Q1MA 4QMAA 4Y20A 3WX5A 3TOJA 3E5UA 1IS6A 4META 3U4XA 2PHUA 5BNOC 1ZVFA 4P9WA 3PVNA 2DVFA 1QJU3 4CDQA 4AQ2A 1PM7A 2YYOA 1R1A2 1OA2A 4IEXA 4AGGA 2R0HA 4LR4A 5AC92 1R1A1 3P3PA 3ZFEC 4R9DA 1QQP2 1QJY1 1FXZA 5AC91 1GR3A 2PHRA 3C2UA 1O3TA 2IXKA 4XJ8A 1O4TA 2E53A 4IEOA 2DUPA 4LO5B 1IPJA 5DUWA 4EWEA 1WCSA 3N35A 3B00A 2RM22 5EWSA 1OQDA 4OHZA 2FQPA 3M2MA 1NYWA 2WFF3 2PA7A 3KT1A 3OPZA 1CVNA 2XGXA 2YZ4A 1J58A 1HRV1 1NA1B 2RM21 4KBBA 4R52A 2DU1A 4XBNA 1I6XA 1AL23 1GNHA 3TNQA 3RJRA 2HWC3 4AI1A 1Z78A 2K9ZA 2R063 4FQZA 3URFA 5IT6A 1PO22 1F5JA 3AKSA 1I1EA 4RR3A 3IPVB 1NA1A 3L2YA 1EY2A 3QOPA 5K0UC 3S6PA 2WZR2 3MIDA 4E4DX 2W52A 3CJIC 1S0IA 1PO21 3L9JT 3ZSKA 1PGL2 4BMEA 4RGGA 1ZZ6A 4AXOA 1UU4A 1ZYBA 2P17A 4NHLA 2ZHLA 3HIFA 3DN7A 1FMD2 1Q43A 1KS5A 1KDKA 1LHNA 1CAWB 1JYCA 1PGL1 3IPVA 1L3JA 2WJSA 1JH5A 1ENSA 5DZFA 4LEJA 1FMD1 3V0AB 2R6QA 4PLMA 2O1QA 4R8HA 3ZYGA 4PCRA 1GZWB 1BK1A 4LBQD 5BUVA 4QQLA 5DXDA 1CAWA 2ZBJA 3IDEA 2PLV2 1VAMA 5HI0A 2Q8OA 3V0AA 3WCRA 2MEV2 4ONUA 2OW4A 2VMGA 3KSCA 2PLV1 5BNPA 1GZWA 1F5FA 4COZA 1RUH1 3VDDC 2VNRA 1SBDA 3AP7A 3PHMA 4E27A 5JZGA 1AF9A 4XE9A 4AVBA 2DF7A 4RHV3 3NV4A 2RS32 1X33A 3BOPA 4FO9A 3AP9A 2RS31 1YLLA 1IS5A 1ZRRA 3WT3A 2DFBA 1AX0A 1RL3A 3AX4A 4Z1VA 1W6QB 3GHNA 2ZTNA 1HXS2 2JX9A 1VBA2 2PTMA 1CJDA 4ZU4A 5FLHA 2X8KA 1XNCA 3ZPYA 1HXS1 3AYCA 1VBA1 1UN1A 1XRUA 1W6QA 1AYM3 1WW6A 1EV12 1T6GC 2RS13 1CGPA 3EO6A 1C1LA 4JTNA 1AR92 5T5LA 4YG3A 4ATFA 2ZA9A 3VZLA 3MEPA 1EV11 2D6KA 2CGNA 5IK4A 2P3IA 1AR91 3AP6A 2ZABA 4URTA 4D69A 2BFUS 2E6VA 1LHUA 3RMYA 3VBSB 4PF5A 5FMOS 3VBRC 1OKQA 5DUUA 1G7YA 1TMF2 4XF0A 3PVBB 3ST7A 3RRDA 4JRLA 1R092 4QPGC 3VBSA 4FP2A