3AYCA

Crystal structure of galectin-3 crd domian complexed with gm1 pentasaccharide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
135
structure length
135
Chain Sequence
MPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-3
publication title Structural basis for distinct binding properties of the human galectins to thomsen-friedenreich antigen
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 33
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aycA00
3N7MA 2LALA 2UURA 3LCPA 5KXEA 2P34A 1TEIA 1QOTA 4YGBA 4YW5A 5EWSA 1JYCA 5KXDA 1WW6A 4GWNA 5IK7A 2OUJA 1SLTA 2D6PA 2GN3A 1G86A 4WZFA 3ZYRA 3ZYPA 1WCSA 2DVFA 5DZEA 3OJBA 3B3QE 3VUOA 4XE9A 2ERFA 2AUYA 1CONA 3RG0A 5DXDA 1Q8VA 1WD4A 1WLDA 2WT2A 3BOPA 1DQ2A 3OBTA 3V0BA 2EALA 1NLSA 1NXD1 3WG4A 1DGLA 4BMEA 1GYKA 1S0IA 4KBBA 1KITA 4DQAA 1S0JA 3AYCA 3V65A 1WUVA 4Y1UA 1A8DA 3AP7A 1QU0A 4UW6A 3AYEA 1F31A 2PELA 1RIRA 1CPNA 3KQRA 5CA6A 1EPWA 2AH2A 5GZGA 3HMYA 3OYWA 1WLWA 2LTNA 3SH5A 1ULCA 4LBQA 2AYHA 1LJ7A 3NV4A 5JOYA 4LBQD 1AXYA 1HQWA 4YW3A 1URXA 1V6IA 2WJSA 3O0XA 4Y20A 2NZ9A 4UW3A 1H9WA 5E8AA 5LK5A 5CB7A 1LHOA 3U4XA 2C9AA 1SACA 4FQZA 1G9BA 3O5SA 4M3CA 3VKNA 1QDOA 1V00A 1V6JA 1W6PA 2I2SA 1LTEA 1RITA 5GALA 5JVVA 3C2UA 1B09A 1AX0A 4PCRA 2ZGUA 3D6EA 4LBMA 3A0NA 2B7YA 2ENRA 4M3CF 4Q1RA 4LBQB 1JBCA 1CIWA 1UZYA 4L8QA 2ZGTA 4Q26A 4Y22B 4Y1VA 4ATEA 2YY1A 4YW2A 2VXRA 3ZXLA 1W0OA 1V6OA 2R0HA 2PHXA 1VAVA 2YXSA 4M3CB 2D6MA 2DU0A 4XYXA 2NP0A 1SLIA 3HN1A 4F83A 5IUQA 2NYYA 5EYYA 1MZ6A 2DYCA 3WG2A 4BPZA 2C5DA 2A3YA 2UWCA 3WUDA 2W08A 2OVUA 3O12A 3OY8A 3I8TA 2E53A 4K1ZA 2EF6A 1LODA 1APNA 1N1SA 3HR9A 3R4UA 5HCFA 5HCAA 1DYKA 3IM0A 3WZ1A 5JOXA 4P9WA 4ZXKA 3TB0A 4XHBA 1S0CA 1FV3A 2CTVA 2GNTA 2ZHKA 3ZXEA 1DLLA 2DWRA 1IKPA 4AGGA 1MS5A 3WLUA 2W52A 2SBAA 3RMYA 1DYPA 1LGNA 1F5FA 2PHFA 3JUUA 4YG3A 1OQ1A 1MS9A 5IK8A 2D6NA 1JUIA 3L2YA 1F9KA 1ZM1A 2EXHA 4ZKTB 4GKXA 1HQLA 1LEMA 1YRZA 4C1WA 2D6LX 1MACA 1MS0A 4GXLA 3IN9A 4XJ8A 1AXZA 3W58A 1J1TA 4DRRA 1ENSA 1LHWA 2WT1A 3ASIA 4UW5A 2JDZA 4M3CE 1N1YA 4FQ4A 4XMIA 4BMBA 2E6VA 2CWMA 2VW0A 2FHRA 4ASMB 1DQ1A 1CN1A 1Q8OA 2PHWA 1GZWB 5JOWA 1LOFC 1W6MA 1VALA 1PZ9A 1GZCA 1AVBA 1FYUA 4WVWA 2A70A 5GJ6A 3M3CA 4XMAA 5DUVA 4FPEA 4NOTA 5H9SA 5E89A 2AGSA 2ES3A 5GLVA 1GICA 1MR5A 2BQPA 1A3KA 4MYEA 1PZ8A 4XOGA 5CAZA 2D3PA 1JOJA 1S0FA 4Q1PA 1LOCA 5DZFA 3ZVXA 4AVVA 2ZMKA 3N36A 3AJZA 3PMEA 5BYNA 3PVEA 3FUOA 1UMZA 3FBYA 1ULDA 2XB6C 3W59A 3UJQA 3QCWA 4P9XA 1YXWA 4XZPA 3AYDA 5GLTA 3AX4A 1ZA4A 4GKYA 4DPNA 1FX5A 3AP4A 3WCRA 1GNZA 1JXNA 1QDCA 4YW1A 4K21A 1SBDA 4AVSA 4R9AA 1H30A 1AZDA 3USUA 1LECA 3OPZA 3BTAA 5DG1A 3RRDA 5KXCA 2CWSA 4GA9A 4XJUA 3V0AA 1GSLA 4YFWA 1DIWA 1KRIA 4LBNA 3OBRA 3SH4A 1LCLA 2ZHNA 2DVDA 1WW5A 1N3OA 2YV8A 2ZA9A 1XQNA 5JOZA 1C4RA 3AZVA 4XJAA 2A6WA 4H55A 4YG6A 5JDBA 4Y1ZA 4FPGA 3O0VA 3POWA 1JW6A 4CZSA 5DG2A 1SBFA 2JE7A 3WV6A 1N1TA 2VU9A 3N7KA 2WQZC 2SLIA 2DV9A 4XIKA 1FNYA 2GDFA 3ZSLA 4CTEA 4K20A 1C57A 1VAMA 1ULGA 3T2TA 4PBPA 2NMOA 1IS5A 2A75A 4WVVA 1LULA 1LOAA 1SLBA 1O4ZA 1WW4A 1MS1A 2E51A 3WNXA 1SLLA 1LOFA 4FOWA 3IPVA 2D6OX 3V0BB 5DUWA 2WKKA 1IS4A 4YGCA 4XXPA 3SH3A 1LHUA 2E7QA 3D4KA 4Y1YA 1QMJA 4DFSA 4FOQA 1IS6A 1I3HA 4XILA 3AP5A 3FFZA 4FP3A 3VV1A 4Q8KA 5T5PA 3TAYA 3A0KA 3POSA 2WSVA 4RA0A 3VKFC 4P9YA 4FPFA 4LBOA 1DQ4A 4PBOA 2VUAA 1UPSA 1WW7A 3MEPA 5GZEA 4YZ1A 1GLHA 3OYWB 2UU8A 3BIWE 3B9CA 1UKGA 4BLJA 3I4IA 3LSDA 4JCKA 2ZGKA 3AP6A 2R0FA 4FPYA 1SCRA 4Y24A 5IK4A 5H9RA 1LOGA 1W0PA 3IKWA 1GV9A 3MPPG 4YGEA 2A6YA 2NM1A 3RMXA 5GZFA 1KJRA 2DVAA 4Y20B 1PZ7A 1DBNA 1LHVA 2ZGNA 2V73A 1FATA 1FV2A 4XTPA 3WHTA 4AGRA 4HL0A 1R1ZA 4BLIA 1WLCA 1UZZA 3AFKA 4GWMA 3VKLA 3WDUA 1W6PB 4FPHA 5T50A 4Q27A 1ONAA 3WDVA 1YI7A 1V6NA 3SNMA 4ATFA 3UL2A 5IK5A 3INAA 2GMEA 5GM0A 2VY0A 1LESA 1ULEA 3VKOA 2KM2A 1GBGA 1IOAA 3ZXKA 2Z42A 2R16A 3SLIA 1LOBA 1O4YA 2A5ZA 4FPCA 2ZGQA 2ZACA 1UL9A 2DVGA 4NO4A 3M1HA 5T5JA 3AYAA 1G9AA 1WBLA 1FNZA 3OY8B 3POYA 2WSUA 1CJPA 3BODA 1Q8SA 1Z0HA 1D2SA 4DS0A 1Z78A 1W6QA 2AREA 4FVVA 1RINA 1CESA 1LHNA 5IT6A 1N3QA 4Q2FA 4DRVA 5GZCA 2ZHMA 4XHXA 1V6LA 1BQPA 3QLQA 4TYSA 2D43A 2FMDA 1Y7BA 1DZQA 4YM3A 2ZGSA 3N7LA 1G8WA 2D3SA 2ZGMA 3ATGA 2JE9A 4GALA 4HANA 2P3KA 3FLTA 2H0BA 4TZDA 4Z8BA 1W6OA 3AZZA 1DQ5A 1S1AA 3NV3A 1QOSA 2G4IA 1JN2P 4IQPA 3Q9OA 3WDXA 1X50A 1W6MB 2YMZA 3M3QA 4YLZA 1DQ0A 3AJYA 1SCSA 4Q8LA 4PF5A 2AR6A 1N3PA 3APBA 5T54A 2WNEA 5FREA 3RSJA 1N47A 1SFYA 1V6MA 3AP9A 1UX6A 3M3EA 4ISRA 3ZXFA 1MS4A 1C1LA 4FOVA 3MW3A 1Q56A 1QNWA 5GLWA 4YM2A 3PJQA 2ZZJA 3UJOA 3GNEA 3OGGA 5T52A 4LBLA 2A6ZA 4XBLA 2CYFA 1AJOA 2ZGOA 3ILNA 4P14A 3AZYA 1YIFA 3V64A 3WDWA 1JYIA 1KQRA 5T5LA 1MZ5A 1JHNA 3FLPA 2EXIA 4FPOB 4R9CA 2GN7A 1BYHA 3NV1A 4YM0A 2D6KA 1CQ9A 3M2MA 1V6KA 1YO8A 1QKQA 1G9FA 1U0AA 1AX2A 2GNBA 3NV2A 4FP2A 1Q8QA 3DUIA 1MS8A 2EXJA 5EYXA 3ZSKA 2JKBA 3V0AB 1DHKB 2P3IA 3ILRA 4FPJA 1DQ6A 5F5QA 2A6VA 1MVQA 2W68A 2W39A 1G9CA 2R1BA 2RHPA 4JC1A 2GALA 2DU1A 2DUPA 3MW2A 5GLZA 1CPMA 2P2KA 4I30A 2EAKA 2ZGPA 3N35A 2GNMA 3ZSJA 2NN8A 1S0GA 2JECA 1G9DA 3FUQA 3AXDA 1MS3A 5H9PA 2ZABA 4BM8A 3M3OA 3N7JA 2ZAAA 2UWAA 1S0EA 4FOYA 1QGLA 1BZWA 2A3WA 3MW4A 5E88A 4ISQA 1ENQA 1AX1A 1BKZA 3PVNA 4AGVA 3IPVB 1KJLA 4U2AA 1GZ9A 2ARXA 4YZ4A 1C1FA 4RL7A 2ZHLA 2DTYA 2WT0A 1UAIA 4LBKA 1VLNA 2E7TA 2DUOA 2D3RA 2DVBA 2CNAA 3AZWA 4YFZA 1BXHA 2R49A 1LGBA 2UWBA 3B01A 3LSEA 2CY6A 4Y22A 3UK9A 4BQ1A 4YZ5A 1LENA 1WD3A 3N3HA 4BOWA 4XJ9A 2YZ4A 3VKMA 2A7AA 2A6XA 5DUUA 1KDMA 3IMNA 5T55A 2VW1A 4M00A 3ZSMA 1H9PA 1ENRA 2P3JA 3JU9A 3B69A 5HCBA 1D0HA 2OUHA 4YW4A 5KXBA 3A4UA 5F9TA 1UN1A 3SISA 1LOEA 1OFSA 2WLQA 5DUXA 1AJKA 2P37A 3T1MA 1Q8PA 5SV8A 3DGTA 2AENA 5JMCA 2OW4A 2XG3A 4D69A 2ZBJA 4W65A 3PVOA 4AYUA 5AVAA 1VIWB 1ULFA 3ENRA 3WVJA 1G7YA 1AF9A 2ZGRA 3CNAA 3AK0A 4FPLA 3B00A 1DFQA 1HLCA 2TEPA 2PHUA 2DURA 3WOGA 5GLUA 3T1LA 2DTWA 3GALA 4YG0A 2Q5TA 4LBJA 3R05A 3H0OA 4XIOA 1GZWA 2PHRA 1HDKA 2DUQA 2JD4A 2ZMLA 3WG1A 5CBLA 1W6QB 1KDKA 3ZXJA 1IKQA 3WCSA 4YGDA 3ILFA 1GKBA 2A3XA 3WHUA 4SLIA 1LEDA 1QNYA 2ZGLA 4C1XA 4WV8A 5T5OA 4Y1XA 5CNAA 1GNHA 1LU1A 3SITA 3WDTA 3USUB 4JRAA 4XBQA 1S0BA 1QF3A 3R4SA 4YZ3A 2CL2A 2EIGA 1CVNA 3D5OA 4Y26A 4R9BA 1AXKA 1SLCA 3RQ0A 4AVTA 1LU2A 4R9DA 3FLRA 4XTMA 2PHTA 4CRQA 4PQ9A 1YYNA 4ITCA 1SBEA 1A78A 2EXKA 4K1YA 1W6NA 4U36A 1HKDA 3AZXA 2JJ6A 5FRAA 2GMPA 2VW2A 1W6OB 2HYKA 1QOOA 4OZXA 4XBNA 5GZDA 3WUCA 1I1EA 3KM5A 2VH9A 2D7FA 2GNDA 4XDQA 2ZKNA 1SLAA 4M01A 3RS6A 4AWDA 1GANA 1BJQA 1N1VA 5JLVA 4YM1A 4XJWA 4XJZA 1OKQA 2ARBA 4UW4A 1MVEA 1LGCA 2NMNA 1W6NB 3ZPYA 1S0DA 2ZMNA 3WG3A 2A71A 3NWKA 2D44A 1FAYA 3WDYA 2V5YA 4XXAA 5EXOA 1CR7A 5H9QA 5DZGA 5L73A 2GMMA 2R1DA 3O0WA 1IS3A 3AXEA 4FPKA 4YZ2A 1WBFA 2YROA
chains in the Genus database with same CATH superfamily
3I49A 1RUJ3 2EICA 3LCPA 3FJSA 2JICA 5A6XA 3E6DA 2HBTA 2PQSA 3T4VA 4YW5A 1Y9QA 5EWSA 3LEMA 4RN5A 3WY6A 1WW6A 1ZRRA 3ZFFA 5C7GA 3LEGA 5IK7A 3MF6A 1SLTA 3S0MA 1O3TA 3ZYPA 1GOHA 5C8CB 1UMIA 2C24A 4IV3A 1E5SA 5DZEA 5F3EA 3OJBA 4C8DA 1NQJA 1HW5A 4TSVA 2AUYA 1CONA 3BUCA 4WM8A 5DXDA 2DBNA 3V0BA 2WNUC 1A6CA 1AYN1 5FPAA 3HQRA 3UKVA 4JQRA 1NLSA 3VBHA 3WG4A 1DGLA 3EJKA 2RS32 5FYMA 2VZOA 1BEV3 4CU9A 5FKCA 1WMXA 2XVGA 1QJZA 4LHNA 5J37A 3WP3A 1A8DA 1D4M1 4JGZA 2P17A 2HWB3 1F31A 2PELA 1CAXA 3KQRA 4PT6A 2A73B 3LA7A 3HMYA 4E8CA 5K4LA 1C5HA 1VBB2 4V2VA 1EV13 2VMCA 2R062 4DNYA 2J1EA 4LBQA 4PLOA 4QX5A 1PMHX 3NV4A 5JOYA 1AXYA 1HQWA 1RGSA 4MVTA 3NO8A 2Y0OA 4PHZA 5FAXA 3VD4A 1PO11 3N9MA 1REFA 2RS11 3AL5A 4MLOA 3TN93 4M3CA 1ASJ3 1TVGA 1OOPB 3Q8AA 3OGSA 4ARXA 1QDOA 1BK1A 3N9OA 1V00A 4JDMA 1W6PA 4H2AA 5GALA 5SV5A 4MHUA 2XKPA 1AX0A 4PCRA 3D6EA 2VMGA 3A0NA 2B7YA 2JG8A 4M3CF 1EP0A 4Q1RA 2Q8CA 1PGW1 3O1VA 4Y1VA 2RDSA 4NE9A 3RZJA 2JDKA 4XAAA 3MYXA 4IERA 4B8EA 4NHXA 1BLZA 2ZXQA 2NP0A 3VBRA 4D7TA 2WZR2 3RZGA 1HRI2 4AF9A 5BY5A 4Q5OA 1MZ6A 4MHRA 4BXFA 4CDUB 1YFYA 2DYCA 3O12A 5FR3A 4K1ZA 2JG9B 5HCAA 3HR9A 1VBA1 5HCFA 3R4UA 3PU8A 4UFJA 4YPJA 1DYKA 4COVA 2VTFA 1H2KA 1WMFA 4ZXKA 4XHBA 2GNTA 2ZHKA 4LO8A 3PTYA 1K42A 1MS5A 2VCAA 4XFGA 2PAMA 5DAVA 3RMYA 4BE3A 4HKOA 2QQVA 3ZMNA 3KVBA 1MS9A 1EAH1 2F6BA 1JUIA 3L2YA 1ZM1A 1HRV3 2XJQA 5A7PA 4C1WA 2EIBA 3R0RA 3POIA 4CCEA 4DRRA 1PIV2 4OHXA 3NQHA 4Q4X2 2IXKA 4QB2A 1N1YA 2B46X 3ROUA 4I0WB 4QDQA 5FY9A 2CWMA 1CAUB 3M7AA 2FHRA 4RS5C 2PN5A 4P9IA 2XHKA 1AVBA 3LE0A 4NHYA 3SHRA 1GWMA 3ETPA 3VLBB 5DDJ2 3OB8A 5GJ6A 4LPLA 5DUVA 5FZBA 3MLJA 4NOTA 4D7YA 2BV4A 5E89A 2BQPA 3RZMA 2RG4A 1PZ8A 2BOJA 3S5QA 5CAZA 1GOGA 4ES8A 3GZTB 2ZMKA 4IEZA 4C90A 4P02B 1E5RA 3FBYA 2CAUA 4LITA 4BQ4A 1Q43A 1XYOA 2Z5WA 3AX4A 3LEIA 2QCSB 3AP4A 1I5PA 2HWD1 5A7WA 4DEQA 5D21A 1W8NA 5ABJC 1QDCA 1QJX1 2B4KA 5K9YA 1SBDA 4R9AA 3P3NA 4BXSV 2YBSA 1R093 5DG1A 3EMRA 3PMSA 2W95A 5J3UA 1GSLA 1TE1B 2BOIA 4RHV3 5A3NA 5FYVA 2Z4FA 1W8TA 3OBRA 4LBNA 2WNVB 1RMU3 3C3VA 2YV8A 4YVSA 3KCXA 2C1FA 1F4AA 1XNTA 1YQ6A 4EJRA 1Y3TA 5CYYA 1JODA 5FOBB 5C9AC 4LQRA 4FPGA 1RUC1 4QB1A 4OVEA 3WV6A 4UF0B 3WNNA 5JAXA 1FNYA 3POBA 3ZSLA 4K20A 1VE0A 1RUI3 1GZTA 4PBPA 1JZ8A 1UIJA 4WVVA 3T2OA 1JZ6A 1LOAA 1SLBA 1O4ZA 1GU3A 1O8PA 2E51A 2W1SA 3BN6A 1RUE3 4RFT0 2PA7A 1O5UA 2E7QA 3OEAA 1W8FA 2OQ6A 1WGPA 5A33A 1MEC3 1IS6A 1I3HA 3AP5A 4FP3A 4QAWA 3VV1A 3VZOA 3MHZA 3WQBA 5T5PA 3TAYA 5FWJA 4RA0A 4LIUA 3VKFC 5IVCA 2VCBA 4FPFA 3RI9A 1DQ4A 3AM2A 3GZUC 2ID4A 1Q3EA 1YI9A 3OTFA 2WFF3 2WS92 3BIWE 4BLJA 2EAAA 2VQAA 2ZGKA 2R0FA 3I2JA 1SCRA 3MPPG 3IKWA 1GV9A 4E4DX 4OFGA 4XDPA 4XURA 1KJRA 4Y20B 1RUH1 5GZFA 3ZFGB 1U5IA 3ORJA 4W6WA 1UW8A 1ZVFA 2V73A 2VOXA 3K4ZA 1FV2A 1SFPA 4FFFA 5BNNA 1RUOA 4HL0A 3WDUA 3ZYBA 3OUIA 2FCUA 3VBFC 1E57A 2XUEA 5JXJA 4EN6B 1O3SA 1H6YA 2HWC1 2JB8A 3IDEA 2HKXA 1ONAA 1ZBA1 4XABA 1XSQA 1BBT2 1DGRA 5L9BA 1BVVA 1H1IA 1QEXA 2VY0A 1LESA 2VCMA 3VKOA 2KM2A 1PK6B 4XCBA 5LBEA 5AC91 4LT5A 5TSWA 1XNBA 4CDWA 1L7QA 1ODMA 4E8DA 3SLIA 5FZ9A 5IFPA 2ADEA 3IB3A 2XHNA 2ZGQA 2P6HA 1UL9A 2DVGA 5B4NA 4XC9A 3MIBA 1UYXA 3AYAA 3U11A 1D4M3 3OY8B 1J1LA 4NHLA 2WSUA 1CJPA 3BODA 3VHRA 2Y33A 4JKLA 3NNMA 5FZIA 1LAJA 1ZZBA 4GIQA 4DS0A 2DFCA 1E5HA 1Z78A 4QGMA 1IZ3A 4FVVA 2VNOA 2Q30A 3MFAA 5K0UA 1LHNA 4HSJA 3DYPA 4Q2FA 1GR3A 1ZZ8A 4DRVA 5GZCA 4Q4W3 4QPIA 4IEXA 1V6LA 2J1RA 4W6YA 4TN7A 5CKNA 2D43A 2VTXJ 2ZGSA 3N7LA 4YW7A 1W2NA 1PO13 1WCKA 1BEV2 2XJUA 2RS13 3HBZA 3S6PA 3HNBM 3ATGA 5JSOA 2WN2A 4GWIA 2OT7A 4GALA 4AK3A 2HWB2 3FLTA 2H0BA 2OPWA 5FLJA 4TZDA 1SDWA 1YEWA 3VGIA 1DQ5A 3NV3A 3QH6A 4Y4RA 1JN2P 3UT0A 4KU8A 2XPJA 5FY5A 1XJAA 3Q9OA 2VXJA 2YG0A 3M3QA 3Q8CA 5LA2A 3BU7A 3HIFA 1DQ0A 2OZJA 2HWE1 3V56A 2BVVA 2VE1A 3AJYA 1SCSA 2EIDA 2ZEWA 4AI9A 4LE4A 5C3PA 4PF5A 4CP9B 4NHKA 1CZVA 1F15A 2VTXA 4YVWA 3TN92 2ADDA 1UMHA 2ATFA 4AHXA 3UKTA 5FY4A 5BNOA 5KHKA 2WNEA 1EUTA 1FXZA 3KWVA 4GQ7A 1V6MA 4MXVA 4ISRA 1D0GA 1OBNA 2FDJA 2VULA 3PJQA 4Y4YA 1BVP1 3OGGA 3CMGA 2A6ZA 4XBLA 4OQ8A 3HEIA 5T5LA 3T09A 1MZ5A 4FPOB 2GN7A 4XACA 1BYHA 5FJHA 1AL21 4P9LA 2YBPA 3M2MA 4JTOA 1V6KA 3LB9A 1QKQA 2ZX1A 3MDPA 3NV2A 2JX9A 4FP2A 4PDWC 3TNPB 3USUB 1EAH3 5LBFA 2D97A 3UGHA 2A6VA 3B7MA 5F32A 2V09A 2BJSA 2XBO1 2CGNA 1JZ4A 4Q4Y1 1WA6X 3ZSEA 2R1BA 3DV8A 4JC1A 4JAAA 5FUPA 3J9SA 3OGJA 3MW2A 2C4XA 1HB4A 2P2KA 2YC0A 3MV11 4I30A 2BNNA 3KV6A 5IVYA 2FD8A 4BWOA 4OHYA 5I93A 4G4FA 3WW3A 4B1MA 2JECA 4D6RA 3FUQA 1JZ5A 1MS3A 5H9PA 2X5IC 5FYIA 1HRV2 5BNQA 2UWAA 1QGLA 4IV1B 4XF0A 2PQQA 2RR13 1COV1 3HVDA 4RS5B 1B35C 1NCRC 5CFDC 4CPBA 1AX1A 1VBC1 4S2FA 1ZZCA 2B39A 1GP5A 3H3ZA 5FZ0A 2W92A 4GD4A 2RJLA 4JDNA 4N53C 4RL7A 5CFCA 2DTYA 2XL7A 4MGIE 5EP9A 1X33A 2HWD3 2DUOA 1O6UA 1VRH2 1REDA 1XOYA 3U10A 4QB6A 4AI3A 2CNAA 5C71A 3B01A 4Q0VA 3N9LA 3LSEA 2CY6A 5FZ4A 2I07B 3C7GA 2YYOA 3C8XA 3I2HA 2VZPA 4QHOA 2AACA 5L7OA 2VC9A 5FO7B 3ZXGA 1YNAA 1AR73 5F3IA 5FMOL 5DUUA 4KG8A 4Q29A 1W2OA 2UY8A 5FYTA 3JD73 4LEJA 4CDQC 3U14A 3ZSMA 1GQGA 2P3JA 2PXJA 3E97A 3B69A 1T6BX 1QJY1 2Q8EA 2OUHA 4CEYC 3A4UA 1RXGA 3MLLA 5DUXA 5FZKA 1XXNA 3ZIWA 1R092 1PVC2 3T1MA 3THCA 4A7ZA 5JUVA 3DGTA 4FTEA 1FPN2 4KQ7A 3KLSA 2RMU1 2ZBJA 3POJA 1ULFA 3ENRA 1BK0A 3RNSA 5C9AB 2ZZQA 3WQ0A 1G7YA 3GBWA 5FPLA 2QKDA 1I6XA 2VZTA 4QGNA 3PUQA 1FOD2 2C26A 1DGWA 2VZQA 4Q0SA 5IHRA 1JZ3A 3WP6A 4IEOA 2WNUA 5CEHA 5GLUA 4N9IA 4CXYA 2DTWA 3Q8BA 4UFLA 3P6BA 5F39A 3BTYA 1O3RA 3M70A 3PLQA 3OD4A 4YG0A 3S5AA 2BPA2 5A7SA 2JIGA 3R05A 4S2HA 2WN3A 2XUMA 3WR0A 1GZWA 2ZMLA 2JD4A 4XUNA 3I59B 1AR81 1L7RA 1CAVA 1ND3A 2WO3A 1L7LA 3LDBA 3ILFA 1GKBA 4QQ2A 1W8HA 4SLIA 5FP9A 1TNFA 1QNYA 2DCTA 3VBOB 1UPIA 4WV8A 4C1XA 1DU3D 1GNHA 3WDTA 3B94A 1Y4WA 4LIVA 1UQXA 3LDKA 4XBQA 4AI0A 3R4SA 1RUNA 1RUH3 3D0JA 1HXS1 1PO22 3KB5A 4LOTA 2BZDA 2PHTA 4LK6A 3VDDA 4EE2A 5FDBA 1OOPC 1OVPA 1W6NA 4U36A 4LO7A 3ZYJB 5FP4A 3T08A 3KT1A 2VW2A 4NIIA 5ACA1 4MX3A 5FZHA 2HWC3 4OZXA 2CU5A 2WFF2 4IGOA 4O61A 1ZBA3 3KM5A 2GNDA 4XDQA 2ZKNA 4NWVA 2W3JA 4M01A 2F4LA 3GM8A 4YWAA 3J4UH 1RUD1 5AC93 4XJZA 4LLFA 1JOPA 2ARBA 5LA0A 2WZ8A 2NMNA 2O8QA 5FMDA 1W8WA 3NMBA 1CIYA 1K5MB 4XXAA 1H8VA 1YCIA 5L9RA 5L73A 1X9TA 2R1DA 4S2GA 4CDUC 4E2SA 4GMP1 1KFUL 2DCKA 2X29A 3O1PA 1ZYBA 5HV4A 2IXJA 3VD7A 3ZKYA 1RUF1 4B7KA 5FQ0A 1XC6A 1LB2A 5C5TA 3H50A 2RS51 2D6PA 2GN3A 4FXGB 3RDIA 1QJEA 4K8FA 2RJKA 3JB8A 3EYPA 4JTNA 3B3QE 2VECA 4BISA 4XE9A 2WQ8A 1RUG2 5FTTC 4W6XA 4P5YA 1WD4A 3OSDA 4GJZA 3LFMA 2WT2A 5EPAA 4MUVA 3LEKA 2EALA 3WNPA 4QKNA 4DOUA 1NXD1 2CV6A 1CX1A 2WWSA 3ZFFB 5JI9A 3CZUA 5FZDA 5G04L 1ZX5A 1GYKA 1KITA 2VUDA 3W5MA 4Q4W2 3ZN6B 1WUVA 4Y1UA 3AP7A 1OKOA 2RJ2A 2RE9A 3USSA 2RVAA 4K9SA 3UYJA 2ZS6B 5CA6A 3PUSA 2WWUA 4URAA 5FZ7A 3OYWA 1I9RA 5F5AA 1WLWA 3OD0A 3OG2A 3SQOA 4AI8A 1ULCA 4RFRB 4OYUA 5JR7B 1LJ7A 4NPLA 4LBQD 4XF1A 3VBUC 5DABA 2WJSA 3O1TA 1GNYA 1OUXA 1H9WA 2C0ZA 5E8AA 5DAWA 1LHOA 2VOVA 5I8SA 4XF9A 3WSOA 3U4XA 4Q4V1 3O5SA 4LKFA 3EB7A 4OCTA 1SZBA 3WF0A 3MUY1 1DDLA 3S57A 1OD3A 1V6JA 5JVVA 2DCJA 2VQUA 2VOWA 2ZGUA 2BU9A 4X8PA 4LBMA 5CKQA 2XJTA 3OPWA 2ENRA 3GGLA 1AL23 1AYM3 4LBQB 5FY7A 5FZGA 1UZYA 2VD7A 2VM9A 4Y22B 5ABJA 4NIHA 3ZXLA 1W0OA 3LAGA 1XSRA 3HT1A 2R0HA 4IUGA 3RWKX 3TYJA 4XAEA 4I02A 2FDFA 4M3CB 4ZU7A 2D6MA 2DU0A 4CCLA 2WNVC 2XBO3 3NSTA 1SLIA 4QM8A 1UXZA 4GULA 4Q4Y3 1POV3 1ND2A 3WG2A 4BPZA 4IEUA 2BDRA 2C5DA 4IGQA 4PDWB 2UWCA 5A1FA 4NWWA 1SPPA 2EF6A 4R52A 1POQA 1H2MA 3IM0A 4LA3A 2O1QA 5IJRA 1JTZX 1S0CA 2HEYF 3ZXEA 4QKDA 3BVCA 1DLLA 4AGGA 1IKPA 4DMIA 2ORZA 4WM7A 1XRUA 4H7MA 4OLLA 2GU9A 3BYWA 5FXXA 1F5FA 2PHFA 2BW8A 3JUUA 3AC0A 5IK8A 2IUWA 2VBBA 4N7IA 2CSGA 5KWRA 4GKXA 2IXHA 1LEMA 1NX9A 3MIGA 2OS2A 3IDAA 3DKWA 1MACA 5FLIA 4J1WA 1AXZA 1J1TA 5IVVA 3BTXA 5FYZA 1ENSA 1LHWA 2WYSA 4J25A 4BMBA 3LOBA 4FQ4A 4I0BA 4WBBA 4DXTA 1B35B 1VPHA 4HN0A 5CFDB 1UZWA 5LEJA 1H1AA 4PJYA 1QXJA 3VZKA 2FDKA 4KGQA 1GZCA 1VB2A 2RR12 1FYUA 1JYVA 3PUHA 2A70A 4WVWA 1PX3A 4UOJA 3SEEA 4XMAA 5I8TA 5JZGA 3LGRA 5KHGA 2NPIA 5H9SA 4KU7A 3I3QA 1R082 2V4AA 4MYEA 4QXKA 1X8MA 2H6CA 2CDPA 2MHFA 2D3PA 3PUIA 1S0FA 5FBJA 4AVVA 4LO4B 3VBSA 3AJZA 4LHSA 5BYNA 3PVEA 1UMZA 1IQDC 3W59A 1NZCA 1QH6A 4XZPA 1YXWA 5FXVA 4IETA 5GLTA 4HOOA 4MGZE 3X29B 3SCHA 1ALYA 3WCRA 1JZ7A 2VMHA 1GNZA 2P1BA 1JXNA 2C6SA 4E2QA 3DN7A 1AR72 1OLMA 4AVSA 1NLQA 2VAUA 3A22A 1AZDA 1PK6C 1LECA 3JD72 2XVLA 3BIEA 4CEYB 1TMF1 2CWSA 4XJUA 3V0AA 4HONA 1V70A 1JZ2A 1KD7A 1ZRCA 2B45X 4N9HA 1CAWA 2MEV2 3DYOA 1V9U3 2O8OA 3K51A 1KFXL 1MZEA 1C4RA 1H8TB 1S2BA 3AZVA 2V72A 2YU2A 1SG3A 4A6OA 5F8PA 4NRQA 5DUWA 2GSYA 3H42B 1YUDA 3O0VA 5F5IA 1JW6A 4CZSA 1RVF1 1N1TA 4GB31 2WDBA 4CEWC 2BRTA 5FPBA 1C57A 2JE8A 1OA4A 5C4WB 2W5FA 4RGGA 2A75A 2XKOA 1HB1A 2XVKA 1HXS3 1LULA 4QM9A 5E16A 1J58A 1NG0A 4MXWA 2R071 1ST8A 1VBD2 2WLPA 3WNXA 2W47A 1LOFA 4AI2A 1H2LA 2RM22 3ZYGA 1Y43B 3IPVA 3KGZA 4LLOA 2YC4A 4XXPA 1ZBE1 1A34A 3D4KA 2J1TA 4Y1YA 3K48A 1QMJA 5ACA3 2QZ2A 1XB9A 1NA1A 1OLRA 2IZWA 1IG0A 5KC5A 5BNPA 1F2NA 1Q5OA 2FDGA 5FZ3A 3M4FA 3D3AA 4MGQA 5I0RA 3IDCB 4OI0A 1TME2 4MOAA 1RUD3 2R042 4LBOA 3KF3A 5A6QA 4PBOA 5LRRA 5GZEA 3WQ1A 4I09A 1UKGA 2PLV2 3IIIA 4JGYC 5D8AC 2Q8DA 4Y24A 3AP6A 4CA9A 1VP6A 3NNLA 4E4SA 5IK4A 5H9RA 2GP5A 3B5LB 3NKGA 4OMCA 1FMD3 2JDAA 4QX1A 1NCQA 2ORXA 4GMP3 3JZVA 4JDOA 3WW1A 1PZ7A 4COUA 3O1OA 2JKXA 5DAPA 4E27A 4BIFA 5A6ZA 2EVXA 4XTPA 5JIAA 2VR4A 5F2WA 1WLCA 1UZZA 1X9PA 3AFKA 1H0BA 2OXBA 4RQPA 1POV0 5FV3A 2W91A 4EV0A 1C8M1 5EIYB 2RS53 5FZOB 2FDHA 2TNFA 5IK5A 2GMEA 4RSUA 3U78A 3ZR6A 1AR91 4IEVA 1GBGA 4BJ0A 1IOAA 1KXGA 2LRPA 5L19A 4B29A 3VL8A 3ZXKA 5BNNB 5FZLA 1F5JA 2PTMA 4HXCA 4AEDB 3ZFEC 1LOBA 1O4YA 3I2GA 5F1RA 2VGDA 4IEPA 4L97A 4EWDA 4QQPA 2PYTA 4N8MA 4NO4A 1LRHA 3M1HA 5T5JA 3ACLA 3E5XA 1DYOA 1IPKA 5FXZA 4P9GA 4FXKB 1FNZA 1WCQA 1MQTB 1SHWB 1YQ2A 4CUAA 1GUIA 2G9FA 1Z0HA 2JDHA 3K4AA 4QDSA 3WT3A 1RINA 1UY2A 1T2XA 2WZEA 4B4PA 1RTVA 4QX0A 4XHXA 1QJU1 5FZMA 4UT5A 4ZS2A 4IV1C 4B4QA 4BQ2A 4N43C 1PGL2 2JDMA 2B5HA 1Y7BA 4LTAA 3AMNA 1DZQA 4YM3A 2J7MA 3VZMA 4AVAA 4MG2A 2B9UA 1NCRA 3E5UA 1JHJA 4Q4V3 3O14A 3DKQA 1QQP3 2JE9A 2HWF2 4XFAA 2WWJA 2PHLA 4N53A 5FZ8A 4UBHA 4CCMA 1RXFA 2G4IA 3TOJA 3VBUB 5KR7A 1US2A 4ZZ8A 2WBKA 4DY5A 1X50A 1W6MB 2WQ4A 1ZA7A 1AR63 3R6SA 3PNAA 2QQJA 5A32A 3VD9A 4L9BA 4NMIA 5FREA 1N47A 3KZ4C 1Z7S2 3HNMA 1SFYA 4NJ4A 2GC2A 1US3A 1UX6A 2WINB 2Z69A 1MS4A 3AP9A 1JU4A 1OD5A 1AYM2 1G6NA 4AHZA 1VAKA 4EWAA 5F3CA 1TQ5A 3ES4A 3GNEA 5T52A 2Q8OA 2ZGOA 3ILNA 5BXXA 1YIFA 3UESA 2DF7A 3V64A 4D0QA 1GQHA 1RHI2 1JHNA 1A8MA 2QQKA 1BMV1 4XW3A 4AQ2A 4F8AA 3K46A 3MIDA 3NV1A 3DPRA 1O3QA 1UY1A 2F4PA 2W9XA 2Y60A 1QJFA 3AKRA 2QZ3A 3GXUA 1YO8A 5BNOB 1U0AA 5C8CA 1OH4A 4E4HA 4AVCA 3DUIA 3ZSKA 2XR4A 4IL7A 2P3IA 4FPJA 1DQ6A 5FWEA 4JVAA 1D7PM 4GWJA 1MVQA 1GP6A 2D98A 2PAEA 3E6BA 2W68A 2W39A 1EYBA 2Y6HA 2LW8A 2RHPA 1VBE3 3JBG2 5DPNA 2DUPA 5HCHA 4CP0A 1W9YA 1J3RA 2EAKA 3CJIA 1NLRA 3ZDVA 3DXUA 1YJLA 4IE6A 1G9DA 3EXUA 3AXDA 5FP8A 4MV2A 3VBOC 4BM8A 3BPZA 4CE8A 3PVBB 5HXMA 2MEV1 1P8JA 1K3IA 1Y9GA 1BZWA 4FCAA 3I2OA 5FUIA 4AE2A 4LHLA 4JQTA 3T2QA 1ZZ6A 4XUOA 3J8F3 5A3WA 3THPA 4CUCA 3RJ2X 1BKZA 1OLME 4LKDA 1KJLA 4JHZA 4QPGB 4AHYA 1OOPA 4YZ4A 2BWAA 4AFDA 3JCIA 1R1A3 3O1SA 1JI6A 1XE8A 2BVBA 2RS31 4GMP0 3CF6E 4JRLA 1PX4A 4HSLA 3KV9A 5LA1A 4NHMA 2DVBA 3AZWA 1BXHA 1LGBA 5K7PA 2GP3A 3MLKA 1O8SA 4QT6A 4UI9L 3THTA 3KMHA 4B3NA 2RM21 4KNCA 4COYA 4CSWA 1VBB1 5C33A 3N3HA 2VNVA 1W39A 2R061 3AMMA 1K5MC 1JOBA 2GH2A 4GH4C 2A7AA 3PDQA 1W28A 1FT9A 2EIEA 2KD7A 2QUOA 3CJXA 1NT0A 4P9JA 5BPXA 2VW1A 2L9LA 1ACCA 5T55A 1UYZA 5LZ6A 2KXLA 1UO9A 1TME1 3JU9A 3E1F1 1RUJ2 3LA3A 4E2GA 3KSCA 2JG9A 1D0HA 4EN9B 1AYN3 5KXBA 5F9TA 1RVF3 1U5ZA 4GB33 3SISA 2ET7A 5L7OB 2WA4A 2H6BA 2P37A 4KWJA 3PHMA 4OI2A 4CP2A 2AENA 1C28A 5E6HA 5JMCA 2OW4A 2FQPA 1KS4A 2XG3A 5FZAA 4JKKA 4D69A 3T0DA 5AVAA 3D82A 3GJAA 5C8WA 5I0SA 5L9VA 2XMLA 3NAPB 1V9U2 2GC1A 1AF9A 2OX0A 3H1YA 2ZGRA 2ZX2A 5FYUA 3RGBA 5LASA 5FY8A 4CEWB 1DFQA 2WZR1 1ZBE3 2TEPA 1HRI1 3ZFFC 2DURA 1GMMA 2P5BA 4META 3AL6A 3WEZA 5FYHA 3VN4A 2K46A 4AI1A 2Q5TA 1CAUA 4EZHA 1W8UA 1OH3A 4WVZA 4XIOA 3RZKA 4WM8C 2DUQA 1XYPA 4XUPA 3WG1A 5CBLA 1W6QB 1KDKA 3C7OA 2IVIB 1IKQA 3Q8EA 2VNGA 1XE7A 4OHVA 1T6GC 3ZXJA 1QWRA 4MGSA 4EYUA 3IAQA 4HK8A 4GAZA 5T5OA 4D6QA 4Y1XA 5FPVA 5CNAA 5A1LA 3MIFA 5FXWA 3NNJA 3VD5A 1EV12 3MUZ1 2G9GA 2HEVF 4XQDA 4YZ3A 3OEBA 1AXKA 1SLCA 4FI9A 3O1UA 1LU2A 3I2FA 2ZX4A 4JGZC 4HBNA 3Q8FA 5DQ0A 4CCOA 1MPXA 2VZUA 3A23A 3VZJA 4IDZA 3OBAA 1ND3B 1PIV1 2JJ6A 4JGYB 5D8AB 4DINB 1ASJ2 2GMPA 2PFWA 3B9IA 1W6OB 4Q4X1 1C8M3 1YWKA 2RDNA 1S2KA 3OUHA 4FFHA 4XBNA 1NKGA 1OI6A 5D1IA 1SQ4A 2W87A 2VH9A 3SKJE 1UD1A 2WUHA 3POEA 3K4DA 3N9PA 4TXWA 4YRDA 5LY1A 1BJQA 1AR93 1FMD2 1VBA3 4OUSA 5KHHA 5DDJ1 5ERLA 4C0HA 4XJWA 4CDXB 1OKQA 3MI8A 4QXHA 1MVEA 4XUQA 5LBBA 1JYXA 1W6NB 2J22A 4LO5B 3ZPYA 2XXZA 4CYDA 2A71A 3NWKA 2D44A 2YB7A 2V5YA 5H9QA 4AQ6A 1IGOA 5DZGA 2WNVA 2GMMA 5FYBA 1IS3A 2YDEA 3N9NA 4CCNA 3P3PA 2R7EB 2YROA 3N7MA 2XL9A 2BERA 3WQ7A 3VHNA 5KXEA 2P34A 4FTBA 3SKVA 1OT5A 2XLAA 3WP5A 1JYCA 5KXDA 3ZFEB 3VBRC 5F2SA 5FMBA 1QJU3 3L2HA 4IEWA 4CVUA 3CEWA 3ZYRA 1DZTA 1WCSA 1AUYA 3FHAA 3FMGA 3CIHA 2Y6KA 3VUOA 2ERFA 5B4XA 1UU4A 5CKMA 1Q8VA 1WLDA 3BOPA 3OBTA 5JI7A 1X36A 1DCSA 4BMEA 4WVMB 1EUUA 1UOFA 4N43B 3RYPA 1S0IA 1BHGA 5LB6A 3H3UA 4NROA 4EZ4A 1S0JA 3AYCA 3BCWA 2I74A 2VJXA 4BYYA 3GJBA 4RR3B 3AYEA 1XU1A 2QQLA 1CPNA 5GZGA 2AH2A 4AFCA 1WKYA 2J42A 4AW7A 3URFA 1HN0A 1DF0A 2XJSA 4QXBA 1NE6A 1CD3G 1QQP2 2LTNA 1WCUA 1QJX3 1NUKA 1ZRIA 3I3BA 3OGVA 1U5XA 5ANNA 4COWA 2VG9A 4YW3A 3WNOA 4Y20A 2ZOEB 3ZFGA 2NZ9A 3ZLIA 3BPSA 3J7HA 4Y5SA 5CB7A 4AFBA 3ZXAC 1SACA 4FQZA 1G9BA 1NYWA 2DFBA 2JDPA 3MPBA 4IW3A 5FOJB 2W46A 3C2UA 5HXVA 2X53S 1B09A 3IDBB 2XOMA 2AZ5A 1AR62 4AQSA 3TEYA 1JBCA 1OSGA 3ETQA 4Q26A 2HLEA 2ZGTA 3LKJA 3JB4C 2YY1A 1RUC3 2VXRA 1PK6A 2QDNA 2PHXA 1ULPA 2WS91 2YXSA 2FMYA 5FK7A 2YGMA 1UX7A 2ZEZA 4XYXA 3HN1A 4RHV2 3ZR5A 5IUQA 5LATA 2VMFA 5EYYA 3FWEA 5M0TA 1H8TC 1VMJA 1RMU2 4E4ZA 2A3YA 3ZYHA 3LDRA 1AHSA 1IHMA 1W9WA 4W8JA 1V0AA 3OY8A 4HPKB 3I8TA 2E53A 3TEZA 3IMMA 4XCAA 3WZ1A 3FX3A 3TB0A 3MV01 2OA2A 1WMEA 4FSJA 1BBT1 1DG6A 5A3MA 4HFSA 2SBAA 4EN7B 5C4WC 2K9ZA 1DYPA 1VMFA 1RUI2 2IC1A 1QXRA 2QQWA 3I97A 4IE7A 4A45A 2B42B 1PM7A 2QQPA 3BOWA 3J7NA 2MPFA 5ISLA 1VBE2 1F9KA 4F3JA 1HQLA 3CL1A 1RUE2 1W8OA 2D6LX 2WO1A 4XJ8A 4LNVA 3WX5A 2Q1MA 2WT1A 2QTWB 2JDZA 5IVBA 1JYTA 2WFPA 3O7OA 2E6VA 3I2DA 1UY3A 4KG0A 1MEC2 2VW0A 4KL1A 3MO4A 5CU1A 2N7GA 5FMCA 2E26A 2ILMA 1CN1A 2D5HA 2PHWA 1NQDA 2VQ0A 4BK4A 1VALA 3RZHA 5IATA 4Y3OA 1OPOA 1CZTA 2XJPA 4QU2A 3H8XA 1NOVA 3J8F2 2R063 4X8NA 1XU2A 3BU0A 1M06G 4CP9A 3H9AA 3VZNA 1GICA 4LOSA 3WD5A 4DB5A 1NY72 2VQTA 5F6KA 1PNGA 3GHMA 3O1RA 1R1A2 4Q1PA 5E1RA 1LOCA 5DZFA 5A3LA 1BEV1 3DECA 3KS7A 3MF9A 3N36A 3PMEA 4NUBA 1X7NA 5F5CA 3T30A 4CUBA 4IEQA 3THDA 2BWCA 1ULDA 2JENA 3TRSB 1PMIA 2HWB1 2VMIA 3UV9A 2B9VA 1W8ZA 3AYDA 4GH4B 5FZ1A 3S7IA 5CVRA 5JZGB 1ZA4A 1FX5A 4UFKA 1OUSA 2P4EA 1GOFA 4YW1A 4K21A 2XQRA 5FP3A 3USUA 3OPZA 3RRDA 3LPGA 1UZ0A 4B1LA 5BNNC 5JMOA 1Y9MA 4QDRA 3VHOA 4NR1A 3TN91 4AEDC 2WZR3 1PHMA 2QQMA 3DL3A 1DIWA 2AEYA 1UXXX 3SH4A 1AYN2 2ZHNA 4LORA 4NRPA 4ET7A 1XQNA 5FY1A 3SEPA 4XJAA 4H55A 1F4HA 4YARA 3VB9A 4UAPA 3J7LA 1MQTC 2XQXA 2PMWB 1UCXA 4FFIA 3SCFA 1HV0A 3POWA 3VD3A 1D4M2 5DG2A 3E5QA 1ZRFA 3N7KA 2WQZC 4XIKA 5JOWA 2OQ7A 5A3OA 4CTEA 2HYXA 3KCCA 1ULGA 3RZLA 2NMOA 4IV3B 2WR9A 3LPFA 1U12A 1RL3A 3FL7A 1WW4A 4RS5A 1DGWX 1SLLA 2HWE3 3PURA 4WM8B 3ALQA 1PO12 3V0BB 2RS12 3AKPA 2WKKA 1IS4A 2PAKA 1PIV3 2UY9A 1LHUA 4RYDA 4XFHA 4YGCA 1RJ7A 4Q4X3 3VBHB 5C3QA 5HPOA 3RYKA 1RYYA 2ZX0A 4BQXA 2ET1A 4DFSA 2NQYA 1JH5A 4AFAA 3LF7A 5IW0A 4Q8KA 2VVDA 1HJGA 4JGZB 4O9EA 5IYYA 1OQEA 1PGW2 2G19A 1LKNA 1UU6A 4P9YA 1CAXB 5DDJ3 2WRAA 3MEPA 1UPSA 3W20A 4ZY9A 2UU8A 4K8RB 3B9CA 1HRV1 4D7SA 3I4IA 3LSDA 5JR2A 4JCKA 4FPYA 2WNOA 3LQCA 4ZU4A 4A42A 4FT8A 4YGEA 3NNFA 2VOTA 1C8NA 1C5IA 3AVRA 1YFWA 2DVAA 2ZPXA 3CO2A 4A3XA 1TG7A 3NJXA 1NE4A 2I45A 2ZGNA 1FATA 4QQOA 3WHTA 2QQIA 2DBIA 5HV0A 2E9QA 1R1ZA 4BLIA 3VKLA 2E32A 3HOBA 4GWMA 1HJFA 1UY4A 1VBA2 1W6PB 2FCVA 3POGA 4I0AA 2VCCA 1VRH1 5T50A 4Z1VA 3BALA 4Q27A 2JG8B 1QY4A 1GP4A 1RJ8A 4XF4A 5BNOC 4ATFA 3SNMA 3RWNA 3UL2A 3INAA 5FZFA 5GM0A 5FPZA 5JWPA 1ULEA 4K7JA 4QXCA 5C9AA 1UWWA 5DAXA 2Z42A 1EAH2 2R16A 3B93A 4M4PA 3ZMOA 4RGKA 5FLHA 4DZGA 3VBRB 2BFUS 3NRUA 1OFNA 3T4HB 4FAHA 2A5ZA 4FPCA 1JUHA 1NAEA 2QQNA 2Y6GA 3GCWA 4I3PA 4SBVA 1COV3 2XLFA 4BHPA 5FO8B 1LNSA 4LXLA 1VBC3 3QBQA 1WBLA 4AAXA 4FBFA 2XWBB 1Q8SA 2Z79A 4YW6A 4W50A 1R091 1D2SA 1PVC1 3I59A 3PIGA 1W3XA 4AHWA 4LO6B 5IT6A 1ZREA 3DF0A 5JXIA 1FPN1 3OPTA 3VBOA 1OMIA 4DXZA 4DO0A 2Y6LA 4L11A 4KBZA 2J1UA 2Y6FA 2QJVA 3QLQA 4TYSA 5C6CA 1DZRA 4HLTA 4K6BA 1UF2C 4ZONA 4EROA 5L36A 3POFA 5FYSA 3MGUA 4KMQA 4QPWA 1FOD1 5AVPA 3U75A 2D3SA 2YUEA 4QPGC 2QNKA 2ZCWA 3NVCA 4HANA 2WAOA 4XFIA 4XFFA 5CZKA 2YFUA 4MO3M 2WC2A 4Z8BA 3AZZA 3VDCA 2ETEA 2XJRA 4O7XA 2HWD2 4IE4A 4AEKA 3WDXA 1QJY3 1QJX2 2YMZA 4YLZA 5A70A 3AMPA 5F37A 2WS93 3ZN5A 4PIZA 3EBRA 3C7EA 4Q8LA 3VBFA 5ANQA 2P3YA 1O91A 4OHWA 1HN1A 2RDQA 1N3PA 1F8VA 3APBA 3KV5A 1K5MA 2RMU3 2WA3A 3H7YA 1PO21 5EJ1B 5T54A 3RSJA 5A3TA 1MEC1 4IXLA 4ZPIA 3ZXFA 3JQXA 1OA2A 1C1LA 4NIAA 4DUXA 1Q56A 1QNWA 4YM2A 3I3MA 5G05L 3ACHA 1UZVA 1VB4A 3FN9A 5L7OC 2CYFA 1AJOA 1RUC2 4CU6A 1JYIA 3ACGA 2ZEXA 3AZYA 2WFF1 5J7MA 5A32B 3B02A 3FLPA 5A7WB 2EXIA 2VZVA 1BBT3 4ONUA 1UKRA 5I0UA 3P5BA 1G9FA 3LIHA 3NAPC 1Q8QA 2BYVE 2EXJA 1AR83 1IPSA 3G7DA 2JKBA 3MFCA 4MGYE 4UFHA 4W4ZA 4Z07A 3LA2A 3ILRA 1VR3A 4M4RA 1OXCA 2V5DA 3H8UA 4XDOA 1QH7A 1G9CA 2WAAA 4OMDA 4YVSB 3OGRA 3EQEA 5A7OA 4YYOA 3DPRB 2GALA 3LIGA 2BBVA 1QIQA 2DU1A 5GLZA 3ZN6A 2OPKA 3ECQA 1GFF2 1R64A 2ZGPA 4PIXA 2GNMA 4UFMA 1O5LA 3ZSJA 4CCDA 2NN8A 1S0GA 1OA3A 3AKSA 3I54A 3SXWA 2ZABA 1H4GA 3M3OA 3N7JA 2X05A 4EWEA 4DUWA 1S0EA 4FOYA 4LKEA 4ZHNA 3RI8A 2OKXA 5FZ6A 3MW4A 5E88A 1RUG1 2R6QA 4ISQA 5I8YA 1RUH2 4AFMA 5J1XA 4TTGA 3I3EA 3RFRA 4AGVA 4U2AA 3CJIB 1ND3C 2E7AA 1X8EA 5FY0A 1C1FA 3LD8A 2ZAHA 4Q0PA 2WT0A 1UAIA 4KWUA 2E7TA 4R4ZA 5A33B 3UKNA 4Q4W1 4XVHA 4ZZ5A 2XONA 2D3RA 2VNRA 2HWC2 4QQHA 2E33A 1ZBA2 4DY3A 1YLLA 4YFZA 2OYZA 2UWBA 2R49A 2VMDA 4Y22A 4YNIA 2QQUA 3RJRA 4Z2WA 1J3PA 4J6GA 1RUF3 4TWTA 3VDDC 4QHZA 4CDXC 4ASLA 1K5JA 4DUVA 5A3UA 1WD3A 4BOWA 5AC92 4K40A 1YHFA 4XJ9A 2IXLA 2BBAA 3VKMA 2Y26A 4QX3A 1KDMA 2JXAA 5CISA 4BQ5A 1SMVA 1BCXA 4M00A 3H1MA 3FHQA 3QH7A 4KWKA 4PDWA 2IVJA 2BEOA 3ZX7A 4YW4A 1UN1A 1C3HA 1OFSA 4LKSA 2WLQA 4MH0E 4P00B 4QMAA 5FZEA 1AJKA 4BCUA 2KA3A 5SV8A 3FE5A 2H0VA 3AB0A 4AAPA 3I7DA 3ZYIB 3IT8A 3WW4A 4PLMA 3WVJA 1H4HA 2VPVA 4BH9A 2OZ6A 1W05A 1UU5A 2UYAA 4HVRA 4PQQA 5J36A 3CNAA 3LZZA 4FPLA 3KQ4B 1OQDA 4IE0A 2OIIA 1OPMA 3B00A 4XQWA 3T2PA 4CDWB 1D2QA 1CWPA 3EO6A 4QKBA 2YHJA 3FHIB 2PHUA 2X5IA 4G3YC 2X10A 5A7NA 1PM4A 1SFNA 4BZ4A 4OUEA 1EY2A 2RV9A 2Y6JA 3GALA 3GCXA 3JXSA 4N7UA 5F6LB 5FO9B 4LBJA 1B35A 4KGGA 4RR3C 5CFDA 1M4WA 2GZWA 5J96B 1YQCA 4AVBA 1HDKA 1U5YA 4DEVA 5LCWL 3M8LA 4GZ9A 2CDOA 4UYBA 5K0UB 4YGDA 2A3XA 2HWE2 1LEDA 1QHDA 4QPIB 3T3YA 3ZOIA 1LU1A 2R30A 4XQ4A 3SITA 1L3JA 3GHNA 4ZS3A 3WF3A 4JRAA 1S0BA 1IG3A 1QF3A 3H3LA 3RQ0A 4YSFA 2EIGA 1CVNA 2YGLA 3T0AA 4AVTA 4HVOA 3OUJA 4XTMA 4R9DA 5FKBA 4PQ9A 1YYNA 4CRQA 1SBEA 2VUJA 1REEA 2PHDA 3ST7A 3HQXA 5B2GB 5C3SA 5K8SA 1VRH3 3NW4A 4D3WA 3O1MA 2HYKA 1QOOA 5GZDA 1I1EA 2X09A 4OHZA 4CDQA 3KHBA 3P1IA 2D7FA 1J84A 3ABZA 2Q0AA 3IWZA 4LMFA 1AL22 1SLAA 1GWKA 4AWDA 2RR11 1HX6A 1N1VA 5JLVA 3DCQA 1NZIA 3ES1A 2ARCA 3IAPA 1W2TA 4CEYA 1LGCA 3NL1A 1R081 3I3DA 1MZFA 1S0DA 2ZMNA 4PIYA 3UETA 1TNRA 4YVWB 3WG3A 5DMYA 1CGPA 5EXOA 4PF1A 1CR7A 3VDBA 3N9QA 5A7QA 2XBO2 3O0WA 1S55A 4V1PA 1K45A 4FPKA 4Q4Y2 4S2DA 4YZ2A 1H8TA 3AKTA 3GBFA 2LALA 2QVSB 5I91A 4I01A 5BUVA 2UURA 4A7YA 1TEIA 1QOTA 2XJVA 1RC6A 4YGBA 1CX4A 1PVC3 1JU3A 2Y34A 3D0SA 5A1AA 4GWNA 1RB8G 1VJ2A 5CG8A 1FPN3 4BIOA 5CADA 2OUJA 1W9SA 1UOGA 1J83A 1G86A 1AR71 4WZFA 5D2AA 4BB3A 2DVFA 1ND2C 5C4WA 5LY2A 3AKQA 3JD71 5A6YA 5JIUA 3BKZA 3M3IA 4TLGA 3TNQA 3ZXDA 5EQUA 1COV2 1FOD3 3A21A 3RG0A 4BQ3A 4AR2A 1VBC2 4L92A 1DQ2A 2JEMA 4AOCA 2Q4SA 2YFZA 3AFGA 4NPRA 4WM7C 2Y64A 4KBBA 4DQAA 3V65A 4HZFA 2QBXA 4MGKE 4COZA 4CU8A 4CPBD 4UW6A 1QU0A 1RIRA 2HH9A 5DAQA 1EPWA 5I0DA 2QDRA 2IXIA 4NAOA 4ZXEA 4H7LA 4PI2A 1QXPA 4RD7A 3SH5A 1PO23 4NIDA 2AYHA 2ZKLA 1VBD1 3RPQA 1URXA 1V6IA 5EV7A 3O0XA 5LK5A 3J7MA 4UW3A 4JX0A 1TMF3 5JSPA 1JYNA 2C9AA 5J09A 5J48A 1HB2A 2VUCA 3VKNA 1H2NA 4A44A 1QJY2 5JZGC 5GKAC 5CFCB 3N4MA 1XNCA 2I2SA 1GWLA 1LTEA 1RITA 5IFTA 4LR4A 1FI2A 4CDUA 5FZOA 5T3NA 4BDVB 3HQUA 1CIWA 4L8QA 2R041 3VBSC 5KHIA 2RMU2 4ATEA 4YW2A 4CCJA 1H6XA 1V6OA 3OBZA 4LHKA 2F17A 4LA2A 4XPVA 2PLV1 3ZIXA 3DYMA 1VAVA 2BNOA 5FP7A 4AEDA 4ES9A 2QQOA 3QOPA 1CJDA 4F83A 2NYYA 2GC3A 2QE3A 5IWFA 2B8MA 1PGSA 2R073 1UOBA 3WF1A 3WUDA 3CKHA 4TLFA 2W08A 2OVUA 4JKMA 3MBWA 4Z92B 2LUWA 3NJZA 1VMHA 4FO9A 4N90A 1MQTA 5AFBA 1LODA 1APNA 1N1SA 5JOXA 3VHPA 2A1XA 2BUKA 2J1VA 4NIGA 1S2EA 2IWGB 1WLTA 4P9WA 4LUMA 1AR82 4AXOA 1FV3A 1OVSA 1W99A 2CTVA 4Y5Z0 2DWRA 3F2ZA 5FK8A 4BA6A 1W2AX 3HD8B 4D6SA 3WLUA 2W52A 4IV3C 1HQNA 4F7ZA 4UFIA 1LGNA 5BV6A 1EPZA 3KD4A 1RUG3 4KWLA 4YG3A 5AFEA 1HXS2 3S7EA 1OQ1A 3U0ZA 3H7JA 2D6NA 5FFOC 4ZKTB 2EXHA 4Q0UA 3WW2A 4AQTA 2TUNA 3VBHC 2VVEA 1YRZA 2D93A 1O59A 2WNUB 1MS0A 4GXLA 3IN9A 3W58A 1UNBA 3ASIA 4UW5A 4M3CE 4XMIA 5ACA2 5LK7B 3FC0A 3GYDA 3VBUA 3MICA 1CZSA 1XYNA 1XE0A 3BTZA 4QQLA 4ASMB 1KEXA 1DQ1A 1Q8OA 2GC0A 2JDNA 1GZWB 4UWDA 1LOFC 1W6MA 2W0XA 1PZ9A 2C9KA 3ZPOA 1CAVB 2VL4A 2HBUA 1RUD2 2TBVA 3M3CA 1STMA 3G6JB 2DCYA 1GQPA 4FPEA 4H3WA 2AGSA 1PGL1 2ES3A 4BQYA 5GLVA 1MR5A 1UOJA 1A3KA 4XOGA 1NA1C 1JOJA 2JIJA 1HV1A 4QGLA 2D5FA 4QWNA 4C91A 4E9KA 4K3UA 3ZVXA 3CZJA 5BNPC 5KC6A 2VMEA 3VDDB 4D94A 3FUOA 2HWF1 2XB6C 1UIKA 3QD6A 3UJQA 4CXWA 3QCWA 5DN2A 4ORFA 4QU1A 4P9XA 3BB6A 1ZZ9A 1RUF2 4D8MA 3WNLA 1W06A 4GKYA 4DPNA 1YFXA 2JG8C 5EFUA 2J1AA 4FTSA 3ACFA 2RS52 3FZ3A 1NCQC 3GBGA 1ZNPA 1H30A 4PI0A 1DP0A 1TZOA 3BTAA 5KXCA 1ULOA 4GA9A 2W1QA 4UF0A 4R4XA 2W1UA 5IVJA 3KGLA 4YFWA 4HK9A 4RQPC 5LW9A 2O14A 1XNKA 2XLGA 4HKWA 1KRIA 4LK7A 1LCLA 2ARAA 2DVDA 5EJ3A 1WW5A 1N3OA 1Z7S1 5FJKA 2WABA 2ZA9A 5LRSA 1YJKA 5JOZA 3EHKA 5JPMB 2A6WA 3GDBA 4YG6A 2XDVA 1AYM1 4Y1ZA 5JDBA 4QX2A 5IAVA 1HIXA 3MIHA 1SBFA 2JE7A 4Z2AA 2VU9A 5FQ0B 1RHI1 2SLIA 2DV9A 2MNGA 2GDFA 4HVQA 2BGCA 1LR5A 5JCTA 2AC1A 1VAMA 3DXTA 3T2TA 3KF5A 3PIJA 1IS5A 3ZO0B 3FFQA 1POV1 2LS6A 4A7KA 1MS1A 1W2UA 3U4SA 3SMHA 1IPJA 4FOWA 3HPNA 4HMZA 2D6OX 1W3VA 4QPGA 5F3GA 4P5HA 3SH3A 4Q4V2 3SCGA 3KVAA 4OUMA 4BK5A 1ZRDA 3JBG1 2IXCA 3W21A 3C7HA 4FOQA 4L0PA 4XILA 3FFZA 5APAA 3K3OA 2LM3A 4WZCA 3A0KA 3GZEA 3POSA 2WSVA 1W9TA 3IBMA 4AZZA 3OOXA 1UYPA 3PJYA 4OI4A 4CU7A 5C70A 2VUAA 4YZ1A 1WW7A 1YQ8A 3MZHA 2G9ZA 1GLHA 1R083 3OYWB 4M0HA 4URTA 3WF2A 1HB3A 4HN1A 3ZKUA 4ASKA 4AG4A 5KBFA 1LOGA 1W0PA 3RMXA 3IIAA 2A6YA 2NM1A 3TBDA 3H1WA 4NVPA 5C3RA 2BGOA 1XNDA 1DBNA 1K12A 4P08A 1E5IA 1LHVA 4PLNA 3RVHA 2CGPA 5JSRA 3W9AA 4LJHA 2BFUL 4AGRA 5A80A 2CHHA 2WL1A 3KT4A 4IEYA 4OULA 4Y5TA 3SC7X 4ZU5A 3U07A 4MZUA 4FPHA 4L99A 2FZ2A 2YC2A 1W90A 4BU2A 3WDVA 1YI7A 1WCDJ 1V6NA 2ZX3A 1SEFA 5ABJB 3D8CA 3CHXA 1XBFA 1I5ZA 3AMHA 3NAPA 2BNMA 4JV4A 4B7EA 4X6QB 3KT7A 4JZRA 3WF4A 1DLCA 2Y0IA 5EZWA 3RYRA 4QD2A 3U1XA 4CEWA 3S30A 2E63A 3L9JT 2MEV3 4YVSC 3BGAA 1ENXA 5LBCA 2ZACA 2WO7A 1ND2B 3DPRC 3NJYA 1XPWA 5C8CC 3AMQA 5FIXA 1RUJ1 3WXPA 1G9AA 2ZEYA 3POYA 1SPPB 1X82A 1W04A 4L2NA 1W6QA 2AREA 2RS33 1CESA 2UYBA 4NRMA 4O65A 1N3QA 3HT2A 2ZHMA 4LE3A 1BQPA 4QHBA 4WM7B 4A6SA 5JXHA 3MIEA 5FCCA 1VBD3 2FMDA 3LWCA 1V9U1 2FZ1A 1OF4A 1OC1A 3ZM8A 5A3PA 2RM23 1DGRN 1G8WA 5J98B 1VBB3 4A4AA 4GJYA 4LUKA 4A2UA 4XFBA 3CJIC 2ZGMA 1WZXA 5HI0A 1IQAA 4BQWA 2P3KA 3WNMA 4JGYA 4XFCA 5D8AA 3ZN4A 2J1SA 4KI5M 2BTVC 1W6OA 2RDRA 3HAGA 4A41A 1S1AA 1W9FA 1QOSA 3I2KA 1TME3 4H14A 2R043 2XWJB 4IQPA 4LULA 4CXXA 1JS9A 2VBPA 2GH8A 3HBKA 3CLPA 4CDXA 1OHFA 2PLV3 3HWJA 5CIRA 3H8OA 1TMF2 2E31A 2AR6A 2AEZA 4HT1T 1EV11 1PNFA 3OCPA 5EJZB 2VZRA 4XUTA 3ZDSA 1AL0G 5JPNB 1D4VB 3DEMA 2WIIB 4DXRA 3VBSB 3M3EA 2R32A 4HETA 3JQWA 4A3ZA 4FOVA 2IFRA 3MW3A 5GLWA 2ZZJA 3UJOA 1ASJ1 1HRI3 4LBLA 4O9GA 3LOIA 4P14A 3ZFEA 3VBFB 1RVF2 3WDWA 2VZ3A 1OLQA 1KQRA 4GB32 4CP1A 5FYYA 4R9CA 4YM0A 3U37A 4XETA 2D6KA 1CQ9A 2HJIA 3IZOA 1FMD1 2GNBA 1AX2A 1WMDA 5EYXA 4HKLA 1MS8A 1O4TA 2P6CA 5LA9A 3I2IA 3V0AB 2R072 1DHKB 5FUNA 2JG9C 4CDWC 2DDUA 5CG9A 5LEKA 1S4CA 5F5QA 4QKFA 2FBEA 4OQ9A 1CAWB 2GAUA 5IVEA 2FDIA 1ZBE2 2VO5A 4WVMA 4IV1A 4N43A 3VZLA 5HBAA 3ME2A 4EN0A 3HN3A 5C3OA 1CPMA 1YIPA 4IGPA 3PU3A 1WWYA 4FFGA 2VVFA 4RR3A 3ZYFA 4EN8B 4XEZA 4B4RA 3N35A 5K0UC 2W2IA 3TWIA 1XNAA 4QPIC 1W0NA 3UNPA 2ZAAA 3GZAA 3PL0A 2FCTA 2DCZA 3CDZB 2A3WA 4MXWB 4QX8A 2Y8KA 1ENQA 3ELNA 4NN0A 5FPXA 4UXAA 1OF3A 4I3GA 2HWF3 4IE5A 5FYCA 3PVNA 4CCKA 3IPVB 2XGXA 1GZ9A 2XH6A 4OZOA 3T0BA 2ARXA 2O0OA 1PMJX 1UYYA 3GF6A 4KH9A 2ZHLA 2D40A 4AEJA 1NA1B 2Q1FA 4LBKA 1VLNA 3TEWA 2JD9A 1C8M2 5BNPB 1PVXA 1ZZ7A 2BP6A 3J26N 4EQVA 5EHDA 4NPMA 3UGFA 3TEXA 3UK9A 4BQ1A 4YZ5A 3K3NA 1LENA 1AR92 3PTRB 2JDUA 1QQP1 4RGAA 4YVWC 4Z82A 2YU1A 4MGTA 2IFWA 2YZ4A 5FZCA 3WP4A 3AVSA 2A6XA 4QX7A 5I0TA 4I2OA 3IMNA 1Z7S3 1NCQB 3OF1A 4NAMA 1H9PA 2W94A 1WA4A 1ENRA 5JXGA 2YPJA 3HNYM 4V2WA 2X8KA 4G9SB 4HPKA 2CGOA 5HCBA 2W1WA 2KR2A 2VZSA 4RQPB 1LOEA 1RHI3 1JYWA 3WNKA 1Q8PA 4J1XA 1AR61 4OI1A 3C7FA 1F35A 2CAVA 3PUAA 4W65A 5IAXA 3PVOA 1QJU2 2Y38A 4AYUA 5FMOS 1VIWB 5KHJA 3K2OA 3NNGA 1YC61 3VL9A 2JB4A 1W03A 3AK0A 2WO2A 1JMUB 3K75B 1HLCA 4XF3A 4RHV1 4DXSA 2VZ1A 3WOGA 5C5UA 3T1LA 1RMU1 4DIQA 3JBG3 2EA7A 2G1MA 2Z2SB 4M0NA 4FAGA 1UY0A 3R4DB 3ON7A 4C0BA 2YBKA 3CU7A 1O7FA 3H0OA 4Y33A 1NXMA 3KHCA 3QACA 3NKTA 2PHRA 1J3QA 3A7QA 2BGPA 5FPUA 1KS5A 3WCSA 4CCCA 3WHUA 3KCYA 2ZGLA 2NLRA 3KV4A 4JHTA 3CQOA 2X5IB 1RUI1 1VRBA 3VDAA 2Q1ZB 2JWPA 3LFIA 3NJVA 4IESA 1J59A 2CL2A 4Y26A 3RZZA 3D5OA 1H1MA 2LROA 3ACIA 3K77A 4R9BA 1VBE1 4AEMA 3FLRA 1SDDB 1NCRB 2HEWF 4QPYA 1KGYA 4ITCA 2EXKA 1A78A 1RUE1 2ZJCA 2K0GA 4K1YA 3HJRA 1YQ5A 4AL9A 1HKDA 3AZXA 5CFCC 5FRAA 4HG6B 3UGGA 4N53B 5F7UA 3H8RA 4GH4A 2JDYA 4UBGA 1YFUA 3WUCA 4ARYA 3F95A 1BMV2 4MADA 1OURA 3FBMA 3ITQA 3ZFGC 3RS6A 1GANA 3CBNA 2VOKA 4INDA 4Q0QA 4MSVA 4YM1A 4X6RB 2V4VA 3J8F1 4CUGA 4UW4A 3E6CC 1ODNA 2K2SA 2VBDA 2YPDA 2WZPP 2QFEA 2WYFA 4R8HA 3W5NA 3BI3A 3WDYA 1NY71 1FAYA 2ZTNA 1R1A1 3WINE 5IVFA 4XZUG 5FBZA 3AXEA 5LWBA 4CDQB 1WBFA
chains in the Genus database with same CATH topology
1RUJ3 3LCPA 3FJSA 2JICA 3E6DA 4YW5A 1Y9QA 5EWSA 3WY6A 1WW6A 1ZRRA 3ZFFA 5IK7A 3MF6A 1SLTA 3S0MA 1O3TA 3ZYPA 5C8CB 4IV3A 5DZEA 3OJBA 1NQJA 1HW5A 4TSVA 2AUYA 1CONA 4WM8A 5DXDA 3V0BA 2WNUC 1A6CA 1AYN1 3UKVA 4JQRA 1NLSA 3VBHA 3WG4A 1DGLA 3EJKA 2RS32 1BEV3 2XVGA 1QJZA 4LHNA 5J37A 3WP3A 1A8DA 1D4M1 4JGZA 2P17A 2HWB3 1F31A 2PELA 1CAXA 3KQRA 2A73B 3LA7A 3HMYA 1C5HA 1VBB2 1EV13 2R062 4DNYA 4LBQA 4PLOA 4QX5A 3NV4A 5JOYA 1AXYA 1HQWA 1RGSA 4MVTA 3NO8A 2Y0OA 5FAXA 1PO11 1REFA 2RS11 4MLOA 3TN93 4M3CA 1ASJ3 1OOPB 1QDOA 1BK1A 1V00A 4JDMA 1W6PA 5GALA 5SV5A 2XKPA 1AX0A 4PCRA 3D6EA 2VMGA 3A0NA 2B7YA 2JG8A 4M3CF 1EP0A 4Q1RA 1PGW1 4Y1VA 3MYXA 4IERA 4B8EA 2NP0A 3VBRA 4D7TA 2WZR2 1HRI2 4AF9A 5BY5A 1MZ6A 4CDUB 1YFYA 2DYCA 3O12A 4K1ZA 2JG9B 5HCAA 3HR9A 1VBA1 5HCFA 3R4UA 4COVA 1DYKA 1H2KA 1WMFA 4ZXKA 4XHBA 2GNTA 2ZHKA 4LO8A 3PTYA 1MS5A 4XFGA 2PAMA 3RMYA 4BE3A 4HKOA 3ZMNA 1MS9A 1EAH1 2F6BA 1JUIA 3L2YA 1ZM1A 1HRV3 2XJQA 4C1WA 3R0RA 4DRRA 1PIV2 4OHXA 4Q4X2 2IXKA 1N1YA 2B46X 3ROUA 4I0WB 2CWMA 1CAUB 3M7AA 2FHRA 4RS5C 2PN5A 4P9IA 2XHKA 1AVBA 3VLBB 3SHRA 5DDJ2 5GJ6A 5DUVA 3MLJA 4NOTA 4D7YA 5E89A 2BQPA 1PZ8A 5CAZA 4ES8A 3GZTB 2ZMKA 4IEZA 4C90A 3FBYA 2CAUA 1Q43A 1XYOA 2Z5WA 3AX4A 2QCSB 3AP4A 2HWD1 5ABJC 1QDCA 1QJX1 5K9YA 1SBDA 4R9AA 3P3NA 1R093 5DG1A 3PMSA 5J3UA 1GSLA 1TE1B 4RHV3 4LBNA 3OBRA 2WNVB 1RMU3 3C3VA 2YV8A 4YVSA 3KCXA 2C1FA 4EJRA 1Y3TA 5FOBB 5C9AC 4FPGA 1RUC1 4OVEA 3WV6A 5JAXA 1FNYA 3ZSLA 4K20A 1RUI3 4PBPA 1UIJA 4WVVA 1LOAA 1SLBA 1O4ZA 2E51A 1RUE3 4RFT0 2PA7A 1O5UA 2E7QA 1WGPA 5A33A 1MEC3 1IS6A 1I3HA 3AP5A 4FP3A 3VV1A 3VZOA 5T5PA 3TAYA 4RA0A 3VKFC 4FPFA 3RI9A 1DQ4A 3AM2A 3GZUC 1Q3EA 1YI9A 3OTFA 2WFF3 2WS92 3BIWE 4BLJA 2EAAA 2VQAA 2ZGKA 2R0FA 1SCRA 3MPPG 3IKWA 1GV9A 4E4DX 4OFGA 5GZFA 1KJRA 4Y20B 1RUH1 3ZFGB 1U5IA 4W6WA 1UW8A 1ZVFA 2V73A 2VOXA 1FV2A 5BNNA 1RUOA 4HL0A 3WDUA 3VBFC 1E57A 4EN6B 1O3SA 2HWC1 3IDEA 2HKXA 1ONAA 1ZBA1 1BBT2 1DGRA 1BVVA 1H1IA 2VY0A 1LESA 3VKOA 2KM2A 1PK6B 5AC91 4LT5A 5TSWA 1XNBA 4CDWA 3SLIA 2ZGQA 1UL9A 2DVGA 3MIBA 3AYAA 3U11A 1D4M3 3OY8B 1J1LA 4NHLA 2WSUA 1CJPA 3BODA 3VHRA 1ZZBA 4GIQA 4DS0A 2DFCA 4QGMA 1Z78A 1IZ3A 4FVVA 2VNOA 2Q30A 3MFAA 5K0UA 1LHNA 4HSJA 4Q2FA 1GR3A 1ZZ8A 4DRVA 5GZCA 4Q4W3 4QPIA 4IEXA 1V6LA 4W6YA 2D43A 2ZGSA 3N7LA 1PO13 1WCKA 1BEV2 2XJUA 2RS13 3HBZA 3S6PA 3ATGA 5JSOA 4GALA 4AK3A 2HWB2 3FLTA 2H0BA 5FLJA 4TZDA 1SDWA 3VGIA 1DQ5A 3NV3A 3QH6A 1JN2P 4KU8A 2XPJA 3Q9OA 3M3QA 3BU7A 3HIFA 1DQ0A 2OZJA 2HWE1 3V56A 2BVVA 3AJYA 1SCSA 4LE4A 4PF5A 4NHKA 3TN92 4YVWA 2ATFA 4AHXA 3UKTA 5KHKA 5BNOA 2WNEA 1FXZA 4GQ7A 1V6MA 4MXVA 4ISRA 1D0GA 2VULA 3PJQA 4Y4YA 1BVP1 3OGGA 2A6ZA 4XBLA 5T5LA 1MZ5A 4FPOB 2GN7A 1BYHA 1AL21 4P9LA 3M2MA 4JTOA 1V6KA 3LB9A 1QKQA 2ZX1A 3MDPA 3NV2A 2JX9A 4FP2A 4PDWC 3TNPB 3USUB 1EAH3 2D97A 2A6VA 3B7MA 2V09A 2XBO1 2CGNA 4Q4Y1 3ZSEA 2R1BA 3DV8A 4JC1A 4JAAA 3J9SA 3OGJA 3MW2A 2P2KA 4I30A 2YC0A 2BNNA 4OHYA 4BWOA 5I93A 4G4FA 3WW3A 2JECA 3FUQA 1MS3A 5H9PA 2X5IC 1HRV2 5BNQA 2UWAA 1QGLA 4IV1B 4XF0A 2PQQA 2RR13 1COV1 4RS5B 1B35C 1NCRC 5CFDC 1AX1A 1VBC1 4S2FA 1ZZCA 2B39A 3H3ZA 4N53C 2RJLA 4JDNA 4RL7A 5CFCA 2DTYA 2XL7A 4MGIE 1X33A 2HWD3 2DUOA 1VRH2 1REDA 3U10A 4AI3A 2CNAA 3B01A 4Q0VA 3LSEA 2CY6A 2I07B 2YYOA 5L7OA 5FO7B 3ZXGA 1YNAA 1AR73 5FMOL 5DUUA 4KG8A 4Q29A 2UY8A 3JD73 4LEJA 4CDQC 3ZSMA 1GQGA 2P3JA 3E97A 3B69A 1QJY1 2OUHA 4CEYC 3A4UA 3MLLA 5DUXA 1XXNA 3ZIWA 1R092 1PVC2 3T1MA 4A7ZA 3DGTA 4FTEA 1FPN2 4KQ7A 3KLSA 2RMU1 2ZBJA 1ULFA 3ENRA 3RNSA 5C9AB 2ZZQA 3WQ0A 1G7YA 3GBWA 2QKDA 1I6XA 4QGNA 1FOD2 1DGWA 4Q0SA 3WP6A 4IEOA 2WNUA 5GLUA 4N9IA 2DTWA 1O3RA 3M70A 3PLQA 3OD4A 4YG0A 2BPA2 3R05A 4S2HA 2XUMA 3WR0A 1GZWA 2ZMLA 2JD4A 3I59B 1AR81 1CAVA 1ND3A 4QQ2A 3ILFA 1GKBA 4SLIA 1TNFA 1QNYA 2DCTA 3VBOB 1UPIA 4WV8A 4C1XA 1DU3D 1GNHA 3WDTA 3B94A 4AI0A 1RUNA 4XBQA 3R4SA 1RUH3 3D0JA 1HXS1 1PO22 3KB5A 2PHTA 3VDDA 5FDBA 1OOPC 4U36A 1W6NA 3ZYJB 4LO7A 3KT1A 2VW2A 5ACA1 4MX3A 2HWC3 4OZXA 2WFF2 1ZBA3 3KM5A 2GNDA 4XDQA 2ZKNA 4NWVA 4M01A 3J4UH 1RUD1 5AC93 4XJZA 4LLFA 2ARBA 2NMNA 2O8QA 1K5MB 4XXAA 1H8VA 1YCIA 5L73A 4S2GA 2R1DA 4CDUC 4E2SA 4GMP1 1KFUL 2DCKA 2X29A 1ZYBA 2IXJA 1RUF1 4B7KA 5FQ0A 1LB2A 3H50A 2RS51 2D6PA 2GN3A 4FXGB 3RDIA 4K8FA 2RJKA 3JB8A 4JTNA 3B3QE 2VECA 4XE9A 1RUG2 5FTTC 4W6XA 1WD4A 2WT2A 4MUVA 2EALA 4DOUA 1NXD1 2CV6A 2WWSA 3ZFFB 5JI9A 1ZX5A 1GYKA 1KITA 4Q4W2 3ZN6B 1WUVA 4Y1UA 3AP7A 2RE9A 3USSA 4K9SA 2ZS6B 5CA6A 3OYWA 1I9RA 1WLWA 3OD0A 4AI8A 1ULCA 5JR7B 1LJ7A 4LBQD 4XF1A 3VBUC 2WJSA 5E8AA 1H9WA 2C0ZA 3U4XA 1LHOA 2VOVA 5I8SA 4XF9A 4Q4V1 3O5SA 1DDLA 1V6JA 5JVVA 2DCJA 2VOWA 2ZGUA 4X8PA 4LBMA 2XJTA 2ENRA 1AL23 1AYM3 4LBQB 1UZYA 5ABJA 4Y22B 3ZXLA 1W0OA 3LAGA 3TYJA 3HT1A 2R0HA 4I02A 4M3CB 4ZU7A 2D6MA 2DU0A 2WNVC 2XBO3 3NSTA 1SLIA 4QM8A 4GULA 4Q4Y3 1POV3 1ND2A 3WG2A 4BPZA 4IEUA 2C5DA 4PDWB 2UWCA 4NWWA 2EF6A 4R52A 1H2MA 3IM0A 4LA3A 2O1QA 1JTZX 1S0CA 2HEYF 3ZXEA 4AGGA 1DLLA 1IKPA 4DMIA 4WM7A 1XRUA 4H7MA 4OLLA 2GU9A 1F5FA 2PHFA 2BW8A 3JUUA 5IK8A 4N7IA 5KWRA 4GKXA 2IXHA 1LEMA 3MIGA 5FLIA 3DKWA 1MACA 4J1WA 1AXZA 1J1TA 1ENSA 1LHWA 4BMBA 3LOBA 4FQ4A 4I0BA 4WBBA 1B35B 4HN0A 5CFDB 5LEJA 1H1AA 4PJYA 1QXJA 3VZKA 4KGQA 1GZCA 1VB2A 2RR12 1FYUA 4WVWA 2A70A 5KHGA 4XMAA 5I8TA 5JZGA 3LGRA 2NPIA 5H9SA 4KU7A 1R082 4MYEA 4QXKA 1X8MA 2H6CA 2MHFA 2D3PA 1S0FA 4AVVA 4LO4B 3VBSA 3AJZA 5BYNA 3PVEA 1UMZA 3W59A 1NZCA 1QH6A 4XZPA 1YXWA 4IETA 5GLTA 4MGZE 3X29B 3SCHA 1ALYA 3WCRA 2VMHA 1GNZA 1JXNA 4E2QA 3DN7A 1AR72 4AVSA 1AZDA 1PK6C 1LECA 3JD72 2XVLA 4CEYB 1TMF1 2CWSA 4XJUA 3V0AA 1V70A 1ZRCA 1KD7A 2B45X 4N9HA 1CAWA 2MEV2 1V9U3 2O8OA 3K51A 1KFXL 1MZEA 1C4RA 1H8TB 1S2BA 3AZVA 5DUWA 2GSYA 1YUDA 3O0VA 1JW6A 4CZSA 1RVF1 1N1TA 4GB31 4CEWC 1C57A 1OA4A 5C4WB 4RGGA 2A75A 2XKOA 2XVKA 4QM9A 1HXS3 1LULA 5E16A 1J58A 1NG0A 4MXWA 2WLPA 1VBD2 2R071 3WNXA 1LOFA 4AI2A 1H2LA 2RM22 3ZYGA 1Y43B 3IPVA 3KGZA 4LLOA 4XXPA 1ZBE1 3D4KA 4Y1YA 3K48A 1QMJA 5ACA3 2QZ2A 1NA1A 1OLRA 2IZWA 5KC5A 5BNPA 1F2NA 1Q5OA 5I0RA 3M4FA 3IDCB 4OI0A 1TME2 1RUD3 2R042 4LBOA 4PBOA 5LRRA 5GZEA 3WQ1A 4I09A 1UKGA 2PLV2 4JGYC 5D8AC 4Y24A 3AP6A 1VP6A 5IK4A 4E4SA 5H9RA 3NKGA 3B5LB 1FMD3 1NCQA 4GMP3 3JZVA 4JDOA 3WW1A 1PZ7A 4COUA 4E27A 4BIFA 2EVXA 4XTPA 5JIAA 1WLCA 1UZZA 3AFKA 1H0BA 4RQPA 1POV0 4EV0A 1C8M1 2RS53 2TNFA 5IK5A 2GMEA 4RSUA 1AR91 4IEVA 1GBGA 5L19A 1IOAA 1KXGA 4B29A 3VL8A 3ZXKA 5BNNB 1F5JA 2PTMA 4AEDB 3ZFEC 1LOBA 1O4YA 2VGDA 4IEPA 4L97A 4EWDA 4QQPA 2PYTA 4NO4A 1LRHA 3M1HA 5T5JA 3ACLA 3E5XA 1IPKA 4P9GA 4FXKB 1FNZA 1MQTB 2G9FA 1Z0HA 3WT3A 1RINA 4B4PA 1RTVA 4XHXA 1QJU1 4B4QA 4IV1C 1PGL2 4N43C 2B5HA 1Y7BA 4LTAA 3AMNA 1DZQA 4YM3A 3VZMA 4AVAA 2B9UA 1NCRA 3E5UA 4Q4V3 3O14A 1QQP3 2JE9A 2HWF2 4XFAA 2PHLA 4N53A 4UBHA 2G4IA 3VBUB 3TOJA 4DY5A 1X50A 1W6MB 2WQ4A 1AR63 3R6SA 3PNAA 5A32A 4L9BA 5FREA 1N47A 3KZ4C 1Z7S2 1SFYA 2GC2A 1UX6A 2WINB 2Z69A 3AP9A 1MS4A 1OD5A 1AYM2 1G6NA 4AHZA 1VAKA 4EWAA 1TQ5A 3ES4A 3GNEA 5T52A 2Q8OA 2ZGOA 3ILNA 5BXXA 1YIFA 3V64A 2DF7A 1GQHA 1RHI2 1JHNA 1A8MA 1BMV1 4XW3A 4AQ2A 4F8AA 1O3QA 3MIDA 3NV1A 3DPRA 2F4PA 3AKRA 5BNOB 5C8CA 2QZ3A 1YO8A 1U0AA 4AVCA 3DUIA 3ZSKA 4IL7A 2P3IA 4FPJA 1DQ6A 4JVAA 1MVQA 2D98A 2PAEA 3E6BA 2W68A 2W39A 1EYBA 2RHPA 1VBE3 3JBG2 2DUPA 4CP0A 1J3RA 2EAKA 3CJIA 1NLRA 1YJLA 1G9DA 3EXUA 3AXDA 3VBOC 4MV2A 4BM8A 3BPZA 3PVBB 2MEV1 1BZWA 4FCAA 4LHLA 1ZZ6A 3J8F3 3THPA 3RJ2X 1BKZA 1KJLA 4QPGB 4AHYA 1OOPA 4YZ4A 2BWAA 4AFDA 3JCIA 1R1A3 1XE8A 2BVBA 2RS31 4GMP0 3CF6E 4JRLA 4HSLA 4NHMA 2DVBA 3AZWA 1BXHA 1LGBA 5K7PA 4QT6A 3MLKA 4B3NA 3THTA 3KMHA 4COYA 2RM21 4KNCA 5C33A 1VBB1 3N3HA 1W39A 2R061 3AMMA 1K5MC 2GH2A 4GH4C 2A7AA 1FT9A 2QUOA 3CJXA 4P9JA 5BPXA 2VW1A 5T55A 2KXLA 1TME1 3JU9A 1RUJ2 3LA3A 4E2GA 3KSCA 2JG9A 1D0HA 4EN9B 1AYN3 5KXBA 5F9TA