3AYCA

Crystal structure of galectin-3 crd domian complexed with gm1 pentasaccharide
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
135
structure length
135
Chain Sequence
MPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for distinct binding properties of the human galectins to thomsen-friedenreich antigen
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-3
total genus 33
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aycA00
2ZGMA 1KDKA 4FPGA 3RMXA 1PZ9A 1JXNA 2CNAA 1UN1A 2OW4A 2R0HA 4XXPA 3USUA 2YZ4A 3O12A 2C5DA 1LU1A 2WT2A 5IK4A 3V0AB 1GBGA 5T55A 4FPEA 1OKQA 1JOJA 2ZGOA 4GA9A 5DG2A 3AFKA 2YROA 2A75A 5GZFA 1Q8PA 2CYFA 2WT1A 1WBLA 1DQ2A 4LBKA 3U4XA 1IS6A 1Q56A 4CRQA 4BOWA 1DIWA 3A4UA 4Q26A 2GNBA 1YI7A 4GKXA 2ZACA 4BLJA 3GALA 3UJQA 1GSLA 2OUHA 1SCSA 1S0CA 3AZYA 3N3HA 4JRAA 4UW4A 2D3PA 4GXLA 1FYUA 3SITA 2EXKA 3JU9A 2R0FA 2PELA 2VW1A 1BYHA 1SLAA 1W6QA 3IM0A 1GICA 3NV4A 4XJZA 2DVDA 1URXA 4YZ2A 3O0XA 4PF5A 1LU2A 4Q2FA 5F5QA 4FPYA 3WDYA 2R1BA 4XJWA 4XXAA 2NN8A 1G9CA 3WCRA 1MS3A 1Q8VA 2ZKNA 3SH3A 1S0DA 1LEMA 4XDQA 1GKBA 1GLHA 2VW2A 1OQ1A 4BPZA 4ZKTB 3AP7A 4PBOA 1MVEA 1A8DA 4MYEA 3AZXA 3NV1A 2ES3A 5JVVA 2YXSA 5JDBA 2GMEA 2CY6A 1QOTA 1DQ0A 1QF3A 1SBFA 3FUOA 2PHFA 4DPNA 2OVUA 1YXWA 4K1ZA 2WNEA 3BTAA 3HN1A 4RA0A 5KXBA 1N3OA 1SLLA 1IS4A 3ZXJA 1G9FA 2GNTA 3HR9A 2EAKA 4LBLA 1G8WA 5JLVA 5DUVA 2DTWA 1VAMA 1WW7A 1V6NA 3HMYA 4DQAA 5JOXA 1DBNA 1CN1A 2VY0A 1IKPA 4XZPA 4Y26A 2XG3A 3AYAA 1YO8A 5AVAA 1KRIA 1DQ4A 1RIRA 1WLDA 2D6MA 4XOGA 1WW5A 2ZGQA 4DRRA 2UU8A 5DUXA 3LSDA 1SLBA 1B09A 3JUUA 4PBPA 5H9SA 5DUUA 4LBMA 1AX0A 2NMNA 4AVSA 1WW4A 1NXD1 3WCSA 4AVVA 4Q1PA 2VW0A 1U0AA 3B3QE 3KM5A 3WG2A 2DWRA 5E88A 2E7TA 2CL2A 1FX5A 3VV1A 1KJRA 3V0AA 1SBDA 1CR7A 3WDWA 1ULDA 2ZMNA 5KXCA 4AGVA 2Z42A 3O5SA 1V6KA 1W6MA 1QNYA 3AP6A 1JYIA 3CNAA 3WDTA 1WUVA 2UWCA 5DZEA 1FNYA 1QOSA 1VIWB 4U2AA 3FBYA 4XJUA 4Y1UA 1BKZA 1A3KA 1LOGA 4YGBA 1MS1A 1CONA 1HKDA 4L8QA 4PQ9A 3ZSMA 1GZ9A 3AJYA 4BMBA 4Y1YA 4YFZA 1S1AA 2CWMA 3AYCA 4Q8LA 4XTMA 1CPNA 3AYDA 3WHUA 4IQPA 2P3IA 2A3WA 3POYA 4Y1XA 2NYYA 1VALA 1ULCA 2DVBA 2E7QA 1LTEA 1ENRA 1ZM1A 3AYEA 3WNXA 1W6NB 5JOWA 4FP3A 4YW4A 5GZEA 5CA6A 3PVOA 1ENSA 3VKMA 1MS9A 1IS5A 3V0BB 2P2KA 2JECA 4FPLA 4WZFA 2W39A 5DUWA 1FV3A 5GLUA 1Y7BA 3ZXKA 2ZGLA 1G7YA 1N1YA 3ILNA 2CWSA 1W0PA 1ZA4A 3PVNA 4YW3A 5KXEA 3BOPA 1UL9A 5E89A 3ZVXA 1S0GA 2EXIA 4XHBA 5FREA 4YGDA 1GV9A 4M3CE 4K1YA 2DV9A 4LBNA 3MEPA 3ZXFA 2D43A 2V5YA 1W6OA 3M1HA 1S0EA 2KM2A 1LENA 1O4YA 1LECA 3M3QA 4M01A 1APNA 5GM0A 1W6NA 3M2MA 1GNZA 2ZABA 1FNZA 2E53A 3V64A 2WSUA 2RHPA 1C57A 1Q8QA 2R49A 4DS0A 1HDKA 1JYCA 4P9YA 2D6LX 4YFWA 1W6MB 1UKGA 3A0KA 3N7JA 4YG3A 3PJQA 4XYXA 2JDZA 3WDVA 1LOBA 2GALA 1IS3A 4ISRA 4YM2A 4GWNA 3WUCA 1LOCA 4TZDA 4H55A 4R9CA 1GYKA 1LJ7A 5KXDA 1CVNA 1AJOA 1QDCA 1V6MA 1VAVA 1JHNA 4Y1ZA 1LHOA 3W58A 1BQPA 4XTPA 5JMCA 4YW1A 5T5PA 4Q27A 2A3YA 1YRZA 2P3JA 1FV2A 3AX4A 3OYWA 4K21A 5GLVA 1G9DA 1F9KA 2ZGNA 3B01A 3QLQA 1C4RA 3T1MA 1QU0A 5EWSA 2ZGRA 3LSEA 4YGCA 4ASMB 3R4SA 1LOFC 1GZWA 2GN3A 1DYPA 3WG1A 5DXDA 2OUJA 3WUDA 4NOTA 2P3KA 3IMNA 1FAYA 5GZDA 2SBAA 5T5OA 2UURA 3WDUA 3APBA 1S0FA 2TEPA 5IK7A 3V0BA 2JKBA 5IT6A 3AK0A 1N47A 4YG6A 2ZGPA 3SLIA 4FOVA 1XQNA 1HLCA 3ZSJA 2W68A 1CIWA 1MS0A 2D44A 2DUQA 2EXHA 1DQ5A 1R1ZA 3O0WA 4XMIA 1V6LA 2G4IA 3AXEA 5IK5A 1C1FA 3MW4A 1DGLA 3POWA 2E51A 1AXKA 1W6QB 1A78A 1ENQA 2DURA 4XILA 2HYKA 5HCBA 4CTEA 1BXHA 3C2UA 3IPVB 4R9AA 4GALA 2WLQA 4GWMA 1TEIA 4DRVA 1N1VA 3ILFA 4Y22A 1PZ8A 5IUQA 4AVTA 2PHRA 1G86A 3O0VA 4FPCA 4P14A 4XJ8A 1LULA 5DZGA 3T1LA 3OPZA 3ENRA 3L2YA 4Y20B 3WV6A 3R05A 1LODA 2W08A 4C1WA 4Q1RA 1LHUA 1ONAA 4LBQB 3AZWA 4XJ9A 4Y20A 4XBQA 3I8TA 2DUPA 3M3EA 1KQRA 1CPMA 4FOYA 2DVAA 1MS5A 3WG3A 1KITA 3N36A 1LGCA 1PZ7A 1UZYA 1LGNA 3V65A 3UK9A 2ZGKA 1GANA 2PHXA 3AZVA 4FVVA 3RS6A 1I3HA 5CBLA 3AP9A 4P9WA 4AGRA 2D3RA 1SCRA 2SLIA 3NWKA 1WLCA 2NP0A 1CESA 4XJAA 5GZGA 1N3QA 3AJZA 4FP2A 1Z78A 4XIOA 5H9PA 5GLTA 4M00A 2ZHNA 4RL7A 5EXOA 2GNDA 4LBQA 5JOYA 4M3CF 2JE7A 3VKFC 3WG4A 2GDFA 2R1DA 3B69A 1J1TA 1AX1A 2ENRA 3IN9A 2FHRA 3LCPA 3ZXEA 2D7FA 2AUYA 2GMMA 1MVQA 3WHTA 4I30A 3Q9OA 2A70A 1HQWA 5T5LA 2V73A 3NV3A 1SBEA 1DQ1A 4UW6A 4YZ5A 5GALA 1WD4A 1Q8SA 1UPSA 4PCRA 1LHWA 1WCSA 2EF6A 4LBOA 1OFSA 2UWBA 4KBBA 2ZGTA 2ARXA 3ATGA 5T5JA 4XMAA 5BYNA 4Y1VA 1SFYA 2PHWA 4ATEA 5EYXA 1LOEA 1RINA 1CJPA 3INAA 4AWDA 2UWAA 4YZ1A 5HCAA 1C1LA 2A71A 2DYCA 5H9QA 2ZMKA 3WLUA 1AX2A 2W52A 2D3SA 1LCLA 1QMJA 1JUIA 2JD4A 5H9RA 2A6YA 1AXYA 2C9AA 4R9BA 1W0OA 2ZHMA 1SLCA 5EYYA 4BQ1A 4FOQA 1GNHA 5FRAA 5T50A 3MW3A 1AJKA 3FLTA 4FQZA 2D6PA 4YW2A 3VKNA 1DFQA 1EPWA 2PHUA 2VH9A 1F31A 4ZXKA 2B7YA 2WKKA 2DVFA 1SLTA 1X50A 2ARBA 2ZHLA 4ATFA 2YY1A 2PHTA 4FPFA 4HL0A 4ISQA 3D5OA 5GLWA 4FQ4A 1AXZA 1I1EA 1BZWA 4YM1A 3ZSLA 2AR6A 2A6VA 4BMEA 1QNWA 2LALA 2A6ZA 2ERFA 3N35A 5GZCA 1O4ZA 1QDOA 1SLIA 3I4IA 4D69A 4FOWA 2D6NA 3SH5A 1AF9A 4AGGA 4YM3A 1UMZA 1H9WA 4YM0A 3N7MA 2ZZJA 2A7AA 2LTNA 2A6WA 1WLWA 1LESA 1WD3A 3A0NA 2ZMLA 3R4UA 3AXDA 5HCFA 2GN7A 1SACA 2VUAA 2EXJA 3B9CA 4XBLA 2DTYA 2ZBJA 3DUIA 4LBJA 2E6VA 4NO4A 2AH2A 2D6KA 2NZ9A 1V6IA 2GMPA 2WJSA 1UZZA 3UL2A 1NLSA 1KJLA 4W65A 4SLIA 1QKQA 3TB0A 4M3CB 3N7KA 3ZXLA 2VU9A 4XIKA 2H0BA 4FPJA 1DQ6A 2P37A 1LHNA 3RG0A 2EALA 1DLLA 3RMYA 4UW5A 4GKYA 1H9PA 2EIGA 3T2TA 2DVGA 3WVJA 1WBFA 2ZGSA 1GZCA 4AYUA 3UJOA 3SISA 1N1SA 3AP4A 3DGTA 1AVBA 1FATA 2CTVA 3D4KA 4JCKA 1LHVA 1CQ9A 3ILRA 1QOOA 1ULFA 4YZ4A 2A3XA 3WOGA 3B00A 5T54A 1YYNA 4R9DA 5GJ6A 4BLIA 4XHXA 1BJQA 5CB7A 1W6OB 3GNEA 3IKWA 1S0BA 2AREA 3VKOA 1S0IA 2DU0A 4TYSA 1W6PB 5CAZA 2ZHKA 3FLPA 2YMZA 3RQ0A 3M3OA 3W59A 2GNMA 2A6XA 3AZZA 3SNMA 1KDMA 5F9TA 1JN2P 2VXRA 4DFSA 3FUQA 1Z0HA 4HANA 5LK5A 3USUB 1G9AA 3D6EA 2JE9A 2NMOA 1MZ5A 1JBCA 3OY8B 4Y22B 2WT0A 1ULEA 4U36A 2AYHA 4FPKA 1LOFA 1V6OA 1AZDA 4JC1A 3VKLA 4WVWA 4CZSA 1H30A 4FPOB 2YV8A 3MW2A 1QGLA 5E8AA 1LEDA 3FFZA 1D2SA 4YZ3A 4UW3A 3ZPYA 1ULGA 3BIWE 4WVVA 2P34A 1DYKA 2BQPA 3POSA 1W6PA 4BM8A 4XBNA 4Y24A 5SV8A 2XB6C 1N3PA 1Q8OA 4LBQD 2DU1A 1MR5A 3RRDA 4C1XA 4WV8A 5IK8A 5T52A 3RSJA 4Z8BA 3SH4A 4OZXA 3ZYRA 3OYWB 5DG1A 1N1TA 2AGSA 2ZAAA 1MS8A 1V6JA 1JW6A 3OY8A 1IOAA 2FMDA 2ZA9A 3BODA 3WZ1A 4YW5A 4M3CA 3N7LA 1WW6A 1YIFA 3AP5A 5JOZA 3H0OA 2AENA 1DHKB 1VLNA 3OGGA 3WDXA 3ZSKA 4P9XA 3TAYA 2DUOA 4XE9A 1V00A 3QCWA 3KQRA 4F83A 1MS4A 3OBRA 2R16A 3NV2A 1HQLA 2WQZC 1MZ6A 2D6OX 1LGBA 1LOAA 1UX6A 4ITCA 3FLRA 3ZYPA 4Q8KA 1S0JA 3PVEA 4YGEA 1GZWB 1RITA 2I2SA 5DZFA 3OJBA 3VUOA 1MACA 2ZGUA 4YG0A 3OBTA 3PMEA 2A5ZA 1UAIA 3IPVA 3M3CA 2JJ6A 4K20A 2NM1A 5GLZA 1G9BA 1D0HA 1DZQA 4FPHA 1IKQA 2Q5TA 2WSVA 5CNAA 4YLZA 5L73A 1F5FA 3MPPG 3ASIA
chains in the Genus database with same CATH superfamily
5A1FA 4JTNA 3EMRA 5A7WB 3RMXA 3TN92 1PZ9A 4LKEA 4G9SB 4JVAA 3USUA 2OPWA 4CDWC 2NQYA 2DCTA 4BYYA 2WT2A 3KLSA 1MPXA 1AL0G 1ZBE3 4M4PA 3VDAA 2VOTA 3HQXA 1JOJA 4IE7A 4GA9A 5DG2A 2YROA 5HBAA 1WBLA 3LDKA 3OOXA 1VR3A 5FPBA 2EIEA 2FDJA 1ASJ2 4N8MA 1HN0A 4OMCA 4CRQA 2JIJA 1DIWA 1VRBA 1ZBA3 1COV3 1RUE2 4UFJA 2GP5A 4NRQA 1OD3A 2BBAA 3KD4A 4L97A 3GALA 1OOPB 2OUHA 3RJRA 4QQOA 4N90A 4QDQA 3N3HA 3AZYA 4JRAA 4OULA 4UW4A 4GXLA 4DEQA 4QMAA 2RMU2 4IEWA 1REEA 1FYUA 4AEDA 1TQ5A 3ZN4A 5FXVA 4EN6B 4QM8A 1FMD3 4A3XA 1Z7S2 5FO9B 1JYVA 4ZHNA 1RJ7A 1UCXA 3MGUA 1E5RA 2X10A 4NMIA 4KMQA 5FZBA 1SLAA 1W6QA 2HWC2 2WNVC 1GICA 2R7EB 3NV4A 1CGPA 2DVDA 5A7PA 1VB2A 4UWDA 4YZ2A 2VBPA 4IV1A 3S7EA 1W06A 2OPKA 4FFHA 4CUCA 3ST7A 5LEJA 3KCXA 1QQP1 3ZR5A 5F5CA 4CEWB 1LEMA 3ZYGA 1GLHA 2VW2A 1H2NA 2WFPA 5FMOL 3KF3A 5JDBA 1NXMA 2GC3A 3BPZA 3NV1A 3DECA 2YXSA 5DDJ1 5F5AA 4MG2A 1VRH1 4RQPC 3CKHA 1SBFA 1JZ3A 4O9EA 5FP9A 2VD7A 4DPNA 2XGXA 2I07B 5KXBA 1HJFA 1UOGA 3RI8A 1MZFA 1G9FA 3HR9A 3K48A 4JRLA 4Q4X1 1BK0A 4EN7B 1WW7A 2DTWA 2OQ7A 4TLGA 4DQAA 2B45X 5JOXA 2TNFA 1XYNA 3K4AA 3PUSA 2LROA 2XG3A 1YO8A 4S2DA 3WNNA 1KGYA 1ND2A 1UY0A 4HSJA 4BB3A 1YQ5A 3POJA 3I3DA 1F4HA 1J3QA 3V56A 4NIGA 2NMNA 3U10A 3OEAA 2O0OA 4LMFA 2HWD3 3I54A 3O1TA 2VW0A 4OI0A 4BZ4A 2R073 2K46A 3KM5A 4MADA 4N53A 1AR92 2DWRA 5JSPA 2CL2A 2VQUA 4WZCA 2DCKA 2VCBA 4QGMA 3DYMA 3OUHA 1CR7A 2VECA 2XJTA 3T30A 1PMJX 2ZMNA 5JSOA 2RJKA 1OUXA 2ZTNA 2PTMA 1W6MA 1QNYA 1RXGA 2Q4SA 2VC9A 3AP6A 3CNAA 3IIAA 3WDTA 4AXOA 1JYIA 3AKSA 3VBRC 1H8TC 4FAGA 3FBYA 1BKZA 1LOGA 1PMIA 5ERLA 4COVA 1RB8G 1UY2A 3OB8A 2P3YA 2RG4A 5A7SA 2ZX1A 2WQ8A 4QHZA 5C8CC 2HH9A 5JUVA 4RGAA 5FZ4A 1H8TB 3ZN6A 4QKDA 3O1OA 2CWMA 4XEZA 4Q8LA 4KWLA 4QX7A 4XTMA 5F32A 2RM22 2WINB 3WHUA 2P3IA 3K77A 1ND3A 5C8CB 1TG7A 4I02A 3J7LA 4JQTA 3VBSC 3E6BA 1ENRA 3LF7A 3WNXA 2J22A 1VBE3 4DXRA 3AFGA 1QJY2 1ENSA 2WZR1 4AG4A 4XDOA 3IWZA 1OKOA 3THPA 2OXBA 3MPBA 5FY9A 5DUWA 4P08A 1N1YA 2CWSA 1F15A 4LO6B 3BOPA 1HW5A 1UL9A 4QKNA 5E89A 3JCIA 2YU1A 3ZVXA 4CXXA 3AL6A 5F2WA 3VHOA 5KHGA 4YGDA 1FXZA 4M3CE 3PMSA 5A33B 2XR4A 2DV9A 2R071 1JODA 3K3OA 4LBNA 4UAPA 1W9WA 3MEPA 3LD8A 2V5YA 3BTXA 3M1HA 1IZ3A 1S0EA 2WNUB 5IHRA 5D8AC 3VBUB 4M01A 4XPVA 5TSWA 3BTYA 1W6NA 3M2MA 4GULA 4AL9A 2PAKA 4N7UA 2E53A 3B7MA 5APAA 4AE2A 4EE2A 4YARA 1NG0A 1XU2A 3UT0A 1RVF1 4QHBA 1HDKA 1RHI2 4P9YA 4YG3A 4E2SA 2ZEXA 2JDZA 3CHXA 4LE3A 5KC5A 1C5IA 4GWNA 4KGQA 1LOCA 2W3JA 4H55A 2Q1ZB 1LJ7A 2XVKA 1CVNA 2Y26A 4BE3A 5C5UA 4A42A 4CPBA 2UY9A 5DAVA 1GQGA 3MHZA 4UF0A 1Z7S3 5K0UA 2W94A 1YRZA 1H4GA 1C5HA 1W8NA 3HN3A 1FV2A 4UYBA 5J09A 2EA7A 2D93A 3H1YA 3ZYHA 4UBHA 3PDQA 2VTXA 3LSEA 1K5MB 2WQ4A 4Z07A 1LOFC 2GN3A 4RN5A 3WG1A 5FFOC 3WUDA 5FUPA 4CDUB 2P3KA 5GZDA 1GWKA 1UW8A 1FOD2 2W1WA 3MZHA 4LO8A 4XCBA 2VMDA 3V0BA 2XOMA 3E6DA 2JKBA 5A3UA 5IT6A 4QPWA 3AK0A 5L36A 1MQTB 4OLLA 4YG6A 1VJ2A 2YBSA 3GGLA 4FOVA 1XQNA 1HLCA 2LRPA 1H2LA 2W68A 3EHKA 3QBQA 4JTOA 2BVBA 5A3WA 4LO7A 1VBA2 3VBFB 2DUQA 3GZEA 5LEKA 1DQ5A 1OPMA 2TUNA 4K7JA 4OHYA 4XMIA 3MIFA 1CX4A 2Y0IA 3NJVA 3VBFC 1LKNA 1ZZ9A 1O8PA 4K8FA 4RHV2 5I8TA 2IZWA 3EBRA 4RQPB 4XILA 2LUWA 4CTEA 4DEVA 3UK9A 1COV1 4COWA 3VBUA 3P1IA 2IXCA 2WBKA 3LOBA 3ZN5A 1QJEA 1TMF2 4GALA 5L9VA 2C0ZA 1Q5OA 1F35A 2WLQA 4A44A 4AVAA 2D5FA 2A1XA 2RS52 3ILFA 5IUQA 3MFCA 3ETPA 1IHMA 4L11A 3ZO0B 5FZ6A 1WKYA 5C5TA 1G86A 4EZ4A 2JKXA 3ENRA 3G7DA 4CDQC 2XONA 5FAXA 1UZWA 2ZEYA 4WVMB 1QH6A 3MYXA 1GMMA 3FHIB 1LHUA 4OMDA 1Q3EA 3AZWA 1UMIA 2IXHA 4RGGA 1RVF3 4XBQA 3M3EA 1A8MA 4DY5A 2QQMA 5A7OA 1FPN3 1KQRA 4NPRA 2DVAA 3VDDA 1K5MA 2IVJA 1AL21 5EJZB 3N36A 1PZ7A 4IEOA 1NA1C 1UZYA 1Y9GA 2XHKA 3SHRA 5EIYB 5K7PA 2JB8A 4XQ4A 3RS6A 4TSVA 5A3LA 5T3NA 1W05A 2IFRA 3WW4A 4LUKA 2EVXA 2QQWA 4GH4B 2JEMA 1N3QA 2AZ5A 3AJZA 4FP2A 4NWWA 4Q4Y3 5LB6A 5JCTA 5H9PA 5GLTA 2DBNA 2ATFA 4RL7A 1X9PA 5FMBA 4X6QB 2GNDA 2VZVA 5JOYA 2VZ3A 4M3CF 1VBC2 3MFAA 4Q4X2 2BFUS 1J1TA 2GC1A 2WFF2 2PYTA 3IN9A 4MGSA 3LA2A 4PI0A 2HWB2 2XMLA 4CEYA 3RI9A 1DGWX 1D4M2 4I30A 4DUXA 5FIXA 4QAWA 2B5HA 3HPNA 3H9AA 1QJU1 1SBEA 3H8UA 4YZ5A 5GALA 4BQ2A 4PT6A 5DQ0A 4LPLA 1WCSA 3AMQA 3LOIA 4IXLA 5T5JA 5BYNA 1OA3A 1PM4A 5AC91 4Y1VA 1RJ8A 1K3IA 4L99A 2PHWA 4NIIA 4ATEA 5EYXA 4FTEA 1RINA 2R062 1MEC1 4YZ1A 1R093 2WN2A 3VD7A 5HCAA 4YNIA 1K5JA 1A6CA 2VMEA 4HK8A 3WLUA 2VPVA 1RUG2 4OVEA 3ZFFB 3CZJA 3N9NA 1US2A 1BVP1 1POV0 4BQ1A 3ZX7A 4HXCA 5EYYA 2ZHMA 1ND2B 2ZEZA 3RVHA 4D6SA 2WNUC 1GZTA 2EIBA 3QD6A 5FRAA 2VOKA 3SKJE 1AJKA 2VQTA 2RS33 4XF3A 2D6PA 3NNGA 1EY2A 3PIJA 4H7LA 4J25A 2PHUA 2FDKA 1F31A 4ZXKA 2B7YA 2RMU3 3H42B 3RYRA 4Q4Y1 3N9MA 4FPFA 2PHTA 2Q8DA 3HEIA 2C24A 4LQRA 1OOPA 4BK4A 3HQUA 1UMHA 4LITA 4NHKA 2EIDA 3S5QA 1NCQC 1QNWA 2LALA 3OGVA 5GZCA 1R083 4X8NA 4G4FA 4D69A 4YM3A 2Z4FA 4AGGA 2OZJA 5KWRA 4OHVA 4HBNA 1XOYA 3ZKYA 2A7AA 2VOWA 3USSA 1XYOA 2AEZA 4FT8A 5FZ9A 5CVRA 3PUIA 2WAAA 3IBMA 2D40A 2EXJA 4P9LA 3DUIA 1NUKA 4YVWB 4AW7A 2VZTA 4BQYA 2AH2A 4DXTA 4L0PA 3D3AA 3UL2A 4A2UA 2DFCA 4IL7A 4W65A 4AHXA 2YFUA 4SLIA 1UOFA 5DDJ2 3TB0A 4M3CB 4YVWA 3VZMA 4AEDB 4BXSV 3GBWA 4KBZA 3KV4A 4ZY9A 3KT7A 1OLMA 4HKLA 4W6WA 4UFHA 3UV9A 4AK3A 4PLNA 1LHNA 1CAUB 3ACIA 3GCWA 3BGAA 1DLLA 3RMYA 5KR7A 1NKGA 4AI1A 4GKYA 2PLV1 2QQKA 4LA2A 4IGOA 4LIVA 1RC6A 2RS53 3L2HA 3PVBB 4Q4V1 1N1SA 4CVUA 1V9U2 4Y33A 1FATA 4W4ZA 1VB4A 1V9U3 4M0HA 1LHVA 4K40A 5D8AA 1OC1A 3EXUA 3ILRA 1OF3A 1JH5A 1QOOA 1ULFA 1W2TA 5FMCA 5JXHA 2A3XA 2QDRA 3I59B 1HXS2 1XU1A 5BNNC 5T54A 1OI6A 1CWPA 1YJKA 2W1UA 2ZX4A 1BJQA 4BA6A 3IKWA 4W8JA 2FCUA 1S0IA 5EPAA 3ZPOA 2XJQA 5BNPB 4CDQB 4A3ZA 3RQ0A 3M3OA 4Y5Z0 2A6XA 1O3TA 1W9TA 2VXRA 3KV6A 3HAGA 4GAZA 4Y4RA 4MXVA 2Q0AA 1GP5A 4AVBA 3WF1A 1UOJA 4XF0A 2HYXA 2IWGB 5CG9A 1JBCA 3H7YA 4LA3A 4LK6A 5I0DA 2VBDA 1ULEA 5D8AB 3VBUC 3BB6A 4Q4W3 2BPA2 3MDPA 4XACA 5BPXA 4OCTA 4P00B 4NIAA 4FPOB 5IATA 5E8AA 4XFBA 3FFZA 4A4AA 1HQNA 3AKQA 4RS5A 4YZ3A 1XE8A 2CHHA 1ULGA 3GF6A 4WVVA 1IG0A 1VBE2 4HONA 5BNPA 1L7QA 1AR72 4COZA 2VZUA 4FAHA 4CXYA 4HLTA 1O3RA 4LBQD 4C1XA 2DU1A 3GZAA 3J4UH 5IK8A 3ZOIA 3ZYRA 3OYWB 1MQTA 5DG1A 4FFIA 5FPAA 5FYCA 2AGSA 2YPDA 1MS8A 2O8OA 3O1VA 1W3XA 1JW6A 1ZA7A 1NAEA 2XL9A 3VZOA 1JZ4A 3JBG2 1O5UA 1GFF2 4JGYC 5CFDC 1NCRA 2QQOA 4W6XA 4WBBA 1PX4A 2R063 1PO11 3N7LA 4OUEA 1OD5A 3I59A 4QXCA 2W46A 5I8SA 2D98A 4FBFA 3H0OA 4COYA 1B35A 1R081 2AENA 1DHKB 1VLNA 3RNSA 1H1IA 1ND3B 3J8F1 4IE5A 2PLV2 4P9XA 4D3WA 4XE9A 1V00A 3WP3A 4OI2A 4LHLA 4F83A 1V9U1 1RUNA 3OSDA 5F7UA 1MZ6A 1CZVA 3RZLA 2QQUA 2X09A 2RV9A 4Q8KA 3POIA 3VZKA 5BNOC 1PGW1 3AMHA 4C90A 3PVEA 1QJY1 1SPPB 1VMHA 1ZZ7A 5F8PA 1F4AA 4X6RB 4MHRA 3U07A 3VBHA 1UX7A 2PHDA 4F7ZA 3VUOA 5J37A 1HN1A 1OSGA 2BJSA 4YG0A 2XWBB 5FR3A 3M3CA 1W90A 4XF1A 2QQJA 2JJ6A 2YB7A 2NM1A 4PIXA 1YFUA 1BEV3 4OUSA 2EAAA 5FZOB 4B4QA 4XUPA 1BEV2 4FPHA 1BBT2 2WSVA 4MGYE 4QPGC 5CNAA 4AFAA 3IDEA 5A3MA 3ITQA 2VZQA 4MGQA 4MHUA 5K0UB 1YFWA 2XJSA 2WYSA 4I01A 4QQ2A 4Z92B 5LBEA 4XXPA 1ASJ1 1KD7A 2PQSA 4AF9A 1LU1A 4IEUA 4TN7A 2QVSB 1GBGA 2ZGOA 3VD4A 2QE3A 2VOVA 2VZPA 5GZFA 2WUHA 2WT1A 1NY71 1DQ2A 3DXUA 3B93A 1W2UA 5ACA3 1Q56A 5I8YA 4BDVB 2GNBA 4S2HA 5ACA2 1WMXA 3JD72 4IEXA 2HWD1 5BV6A 2LW8A 4Y5TA 3VBRB 5FZOA 1W8ZA 5C9AA 2P17A 2YUEA 4XURA 1RUE1 5FUNA 2HWF3 1TMF3 3JU9A 4XF9A 1Y9MA 3E97A 2R0FA 2F6BA 2VW1A 4DXSA 4E4HA 1PO13 5CFCC 4A7YA 1B35C 1PGL1 2DCJA 4D7TA 1RUD1 2HWE2 1LU2A 4TLFA 5C7GA 3KGZA 4Q2FA 4FPYA 4PDWC 5I93A 2ET1A 2VOXA 2ZKLA 4ARYA 2K0GA 2WWUA 3ES1A 4XXAA 5C71A 4HSLA 5CZKA 3MV01 1FPN1 1MS3A 1Q8VA 2ZKNA 1S0DA 3MLJA 3NSTA 4GIQA 1BK1A 2GSYA 4ZU4A 2XVGA 1ZRDA 4BK5A 1EUTA 4ZKTB 3H7JA 5FY5A 5JVVA 5K8SA 2RE9A 4B7EA 1QQP3 4BQ5A 2BUKA 1QOTA 2E32A 2ID4A 2UY8A 5BNNB 3DCQA 2OVUA 1YXWA 3HN1A 4RA0A 5LK7B 3TEWA 3RWNA 1IS4A 3WINE 3ZXJA 2B46X 3ZXAC 1DP0A 3DF0A 4LBLA 2JWPA 4HKWA 1AYN3 1VAMA 4OHZA 3M8LA 1CN1A 1IKPA 2VBBA 4UOJA 4Y26A 2BP6A 2WS92 3T4VA 4A7KA 3AYAA 4J1WA 4XUOA 3TEXA 2K2SA 3FHAA 1KRIA 4QWNA 1OH3A 1RUF2 1WW5A 2D6MA 1NT0A 3LSDA 1SLBA 1B09A 3ACGA 5DUUA 4LBMA 4AVSA 1NXD1 3WCSA 2VXJA 3BALA 4BXFA 1QY4A 1U0AA 3NJZA 5FZ1A 3S6PA 1NOVA 1W9YA 4MXWA 1RYYA 2XHNA 4UFKA 1AYM1 2EICA 3J8F3 5FPLA 3VV1A 1KJRA 3D0JA 1M4WA 1NY72 4LORA 5C70A 3V0AA 4TWTA 5A70A 5DMYA 3LPFA 1ULDA 3JBG3 2NPIA 1WGPA 1W99A 4IEYA 4XQWA 1V6KA 4B1MA 1QH7A 5C9AC 5LBBA 3KGLA 4HVOA 3H8XA 1I6XA 4XFAA 1WUVA 1TME2 1OOPC 2UWCA 5SV8A 2W2IA 1MS1A 2W91A 4FXKB 5FP7A 1CONA 5FKBA 3U78A 2OT7A 1YFXA 4Z2WA 1QXJA 4KG8A 2WWSA 4PQ9A 4FI9A 4PHZA 3VL9A 2VTFA 4Y1YA 4YFZA 3OUIA 4O9GA 2W87A 5AFBA 2WYFA 4NHLA 1RUH2 4XFHA 2G9ZA 3WF2A 5I0UA 2RJLA 5BNNA 3ZFEA 3POYA 3W21A 3KHCA 5FZ8A 1XNBA 2WN3A 1TNRA 2P6HA 3IZOA 3LEKA 3ZYIB 4C91A 5B4NA 4C0BA 3VBSA 4E27A 5JOWA 4URTA 3PL0A 1HRV1 4YW4A 5GZEA 4Q4W1 3PVOA 1MS9A 3V0BB 4OI4A 4FPLA 2HKXA 4Q0SA 3IIIA 3MI8A 2QJVA 3ILNA 1W0PA 4LHSA 2ZJCA 4JHZA 4YW3A 1S2KA 5FYMA 5KXEA 2W5FA 1ZZBA 4LT5A 1PVC2 5CKQA 5IW0A 3I3EA 2ADDA 3T08A 4O65A 5FK8A 1AYM3 1UZVA 1O3QA 2JDMA 3QH7A 4FXGB 4K1YA 3BCWA 4XC9A 1REDA 2WO2A 3I97A 5F5IA 4YSFA 5JXIA 4F3JA 3UNPA 2OIIA 4P9GA 1LENA 3ZSEA 1LECA 1T6GC 2ZABA 2B42B 5BNPC 2XJRA 2DDUA 2WSUA 3V64A 4IEVA 2R49A 2QNKA 4ZU7A 2XUMA 3N7JA 3A0KA 3CDZB 4XYXA 2IXKA 2GALA 2UYBA 1IS3A 5FXXA 4RS5B 4LULA 4YM2A 2RR11 3WUCA 3T0BA 2VMIA 4CP2A 4R9CA 4EN0A 1QJU2 1BVVA 4RSUA 2PMWB 2JDUA 3JB4C 3Q8FA 4XTPA 2QQVA 4CCLA 1W8FA 3I2FA 2PAEA 4Q27A 2P3JA 3LA3A 3OYWA 3AB0A 3B94A 5AC92 4PIZA 5JXJA 4K21A 2BOJA 2GZWA 1C4RA 3CBNA 3T1MA 1T6BX 1OBNA 5JWPA 2VM9A 1DYPA 3Q8AA 3PUQA 5I0SA 4NOTA 4QQPA 3W5NA 5EHDA 2SBAA 5T5OA 2UURA 3VZNA 3WDUA 1QJZA 2Q8OA 2YC4A 5IK7A 1PO21 4CSWA 4TTGA 3KCCA 3HBZA 3TN91 3I2OA 1QQP2 5FYVA 3ZSJA 3LKJA 3WNPA 2WABA 3NNFA 3ZKUA 4MZUA 4B4RA 5SV5A 5BXXA 1S2BA 1COV2 1RUE3 4N43A 4DUWA 4IEZA 1C1FA 3RJ2X 1NLRA 3GJAA 2XLAA 4CEYB 2DURA 2HYKA 3MF9A 4AI8A 3OG2A 4MO3M 4AEJA 3C2UA 1PVXA 4R9AA 5FLIA 2YC2A 3DKWA 4DRVA 4Y22A 2PHRA 5JZGC 3O0VA 4P14A 3WQ7A 5JZGA 1PIV3 5DZGA 2WFF3 2XQXA 3OPZA 3L2YA 1FOD3 1LODA 2WAOA 2ZX2A 5J96B 5FZCA 1VRH3 1ONAA 4LBQB 3T0AA 2JDAA 4XJ9A 2XKOA 3VD9A 3R4DB 1HB1A 2DUPA 1DG6A 3ACLA 1UF2C 3RYKA 3ZMNA 1CPMA 1RUD2 4LIUA 4RFT0 3LQCA 3K46A 5KHHA 1JTZX 4CUAA 3UETA 1AR81 3ZFGC 1OHFA 1LGCA 4DY3A 2ARAA 1SDDB 2OA2A 5JPMB 3K3NA 3OBAA 4FFGA 1GANA 1HB4A 1RMU2 2QDNA 2VMGA 1I3HA 3AZVA 3MBWA 4HOOA 4NHXA 5G05L 4B3NA 5C9AB 2V09A 4A6SA 2SLIA 2D97A 1RUH3 2RDSA 1WLCA 4PDWA 5FP4A 1U12A 2RS11 5GZGA 5HPOA 5ABJB 5FZEA 1Z78A 1W2AX 2NLRA 4KQ7A 1NQDA 3VKFC 2JICA 2YG0A 1VBB3 5FPVA 1AX1A 5FY0A 1JOBA 4N7IA 1PGSA 4JDMA 2D7FA 2G9GA 3RGBA 1MVQA 1ULPA 4CP1A 4PQQA 1HQWA 2CV6A 2F17A 1NCRB 4NN0A 1F5JA 3N4MA 1P8JA 1Q8SA 3DXTA 1BBT3 1G6NA 1KFUL 2Y8KA 5FYZA 2WZ8A 4LBOA 1OFSA 1AYM2 5IVYA 1X36A 4ZS2A 5F3GA 1WZXA 5EZWA 3OTFA 1IQDC 3BKZA 3INAA 2UYAA 4BIOA 2UWAA 4CDWA 2VMHA 3K4DA 1C1LA 1H0BA 3KF5A 5H9QA 1HXS1 2OZ6A 4GB31 4JX0A 3NRUA 3TNQA 4JQRA 4EWEA 2HEYF 2VTXJ 1SPPA 3ECQA 5FK7A 1YUDA 2G1MA 1LCLA 1QMJA 1ULOA 1LAJA 3CO2A 2A6YA 2C9AA 4ORFA 4A45A 2R6QA 1GOFA 1LRHA 5CADA 1HRV2 3DYOA 3VKNA 2OQ6A 3ZLIA 1C3HA 3I2IA 2WKKA 2DVFA 4QB2A 1SLTA 1O59A 1D4M3 1OT5A 2ZHLA 3ROUA 2YY1A 4ATFA 1NE4A 1H6XA 4HL0A 1OF4A 4LK7A 4ISQA 2E31A 3BPSA 1RUH1 4PLMA 5GLWA 3VBRA 4DB5A 2Y64A 5A7WA 1ZRFA 2ET7A 1UD1A 1AXZA 1M06G 4PF1A 4YWAA 4BMEA 2A6VA 1AR82 2A6ZA 2ERFA 4BHPA 1NCQA 2VZ1A 3I4IA 5FMOS 4IE6A 3MIGA 1SFPA 1HV1A 1OMIA 4XW3A 1S55A 3C7FA 3SH5A 4BU2A 1NA1B 4V2WA 3IAPA 3H8OA 4AFBA 2Z5WA 2LTNA 1YQ2A 3DYPA 3A0NA 5CYYA 2ZMLA 1JZ6A 1BCXA 2Y33A 3AXDA 4P9JA 2VUAA 3TYJA 4XBLA 2DTYA 4BISA 4LBJA 5JXGA 1W8WA 1QJFA 4OUMA 1V6IA 2QKDA 5FY8A 2FDIA 3DKQA 1UZZA 1WLTA 5B4XA 1QJX3 1RHI3 1KJLA 3I3QA 1W2OA 1QKQA 2WFF1 3POFA 4JGYB 1UYXA 1PM7A 1ZNPA 5L9BA 3N7KA 2YU2A 4XIKA 2JG8B 3I2JA 1AYN2 1DQ6A 4KWJA 2P37A 2VCMA 1RUI2 3NAPC 2OYZA 4ZZ5A 4HT1T 2E63A 1RUI3 4GB32 3H3LA 2JG9B 2EIGA 3T2TA 4O61A 4B4PA 1FT9A 1WBFA 1FI2A 2JG8C 3KCYA 5K9YA 3S5AA 2BGPA 3SISA 3K2OA 3AP4A 5LA2A 4E2GA 5IVVA 2WR9A 2CTVA 3D4KA 2V5DA 3GBFA 3GDBA 3CIHA 1EV12 4ASKA 1W3VA 2Y6JA 3RZJA 4QQLA 5IVEA 1O7FA 2CDOA 4CCCA 5FYUA 3B00A 3JQXA 4R9DA 3JQWA 2C1FA 2R043 2XWJB 1UOBA 2MPFA 1AHSA 4GMP0 5L7OC 3H1WA 3OPTA 2VNOA 3VKOA 5EV7A 2X5IA 2IXLA 2GAUA 2YMZA 4XUNA 1YC61 2HEVF 3W59A 4DUVA 3NNLA 3SNMA 3CJXA 1KDMA 2CAVA 1VBD2 4DFSA 2W47A 2E9QA 2RMU1 3NO8A 5LK5A 3USUB 3D6EA 3HJRA 2PN5A 5FOBB 4V1PA 3VN4A 1MZ5A 3T0DA 4BQ4A 2WZR3 2AYHA 1DZTA 4BCUA 1GOGA 5CIRA 4AVCA 4CA9A 2YV8A 4D8MA 2GH2A 4UFLA 5FQ0B 2RDNA 4YVSA 1UU5A 4UW3A 1JYWA 4RS5C 2X8KA 2BQPA 2X5IB 4LUMA 4EN9B 2KR2A 1XC6A 2QTWB 4KNCA 4BM8A 2HWD2 4Y24A 4KL1A 2WZPP 4CDQA 3O1RA 5CKMA 1N3PA 3ES4A 2GH8A 5G04L 5T52A 2IVIB 3HNMA 3LA7A 1UY4A 5I0TA 3SH4A 1IPKA 4YVWC 4ZU5A 3KHBA 2X05A 3VHRA 4LLFA 5FJKA 1IOAA 2FMDA 2ZA9A 3VDDC 3NAPA 4QXKA 4Q5OA 1JHJA 1RUJ1 4TXWA 1PX3A 4MGZE 4D94A 1C8M1 1YIFA 3AP5A 2GC2A 2R041 2RDQA 3M70A 5CFCA 5JOZA 3A23A 3ZSKA 1REFA 5CKNA 3CU7A 2JIGA 4I09A 3VHNA 2XJUA 5LY1A 3NV2A 1O3SA 5E1RA 1F8VA 2D6OX 4MGTA 1QEXA 3O1MA 1EV11 1LOAA 4NPLA 4EJRA 2VGDA 1PGL2 1HRV3 5JR7B 3NKGA 1S0JA 1OVPA 3G6JB 4LOSA 4PI2A 4QHOA 4YGEA 1ZBA1 4MVTA 4AI2A 2I2SA 3KV9A 4N9HA 5DZFA 2Q1MA 4UFIA 5A6QA 5A6ZA 3OJBA 2YPJA 2W92A 2ZGUA 4OZOA 4D0QA 3E6CC 2E7AA 3OBTA 1H2MA 3IPVA 1ZBE1 1KEXA 3RZMA 1CZSA 5FXWA 5GLZA 3WP4A 1A34A 5HV0A 3OEBA 5FZKA 3VBFA 3UGGA 1DZQA 1EYBA 2Q5TA 1VBD1 2C26A 3AKRA 2WL1A 2BBVA 1YJLA 3NWKA 3MPPG 4IESA 1JYTA 3OGJA 1X82A 2Z79A 3EJKA 3UGHA 1KDKA 2IXJA 4E8CA 2CNAA 2YFZA 2OW4A 2R0HA 2WA3A 2YZ4A 3O12A 4A41A 3HQRA 4FPEA 4L9BA 2DCYA 3AFKA 3EB7A 2AACA 2CYFA 2X53S 4J6GA 5LA1A 3U4XA 1H1MA 5FOJB 1QJX2 3POBA 2RR12 2J1EA 2KA3A 4HETA 2F4LA 3A4UA 1TE1B 4Q26A 3LIGA 4GKXA 4BLJA 1GSLA 2B8MA 3FL7A 4A6OA 4Q0UA 5CFCB 1S0CA 1JYNA 3I2DA 2D3PA 1CAXA 1SDWA 2H0VA 4R4ZA 1E5SA 5A7QA 1K5MC 2IFWA 3CF6E 4CDUA 4D6QA 3PTRB 4O7XA 1CIYA 1RUF3 1BYHA 1RUJ3 2BW8A 3HOBA 4EZHA 3IM0A 4DO0A 2RM21 1RUJ2 1URXA 2E33A 2E26A 5CFDB 3QACA 5FYIA 4EWDA 1I9RA 3E5QA 3UYJA 5KHKA 4E4ZA 4PLOA 4M4RA 5M0TA 2R1BA 4KU7A 5D1IA 5FZFA 1JZ2A 2NN8A 3NJYA 3WCRA 1F2NA 4XDQA 5A6XA 3LFMA 1NQJA 4YYOA 4BPZA 5FYTA 4AOCA 4BH9A 4RFRB 3AZXA 2ES3A 3VBHC 4JKMA 2GMEA 2CY6A 2Y6FA 2BWCA 1BBT1 1DQ0A 3OD4A 1QF3A 3FUOA 4WVMA 5FJHA 2PHFA 1VBD3 1YCIA 2WNEA 3CZUA 3BTAA 1NLQA 1N3OA 1PIV1 1G8WA 4ZS3A 3DV8A 5DUVA 1OLME 1V6NA 2WZR2 4RHV3 4HVQA 3MIBA 5KC6A 2VY0A 4IGQA 3OGRA 2AEYA 2XBO3 5AVAA 1ODNA 1D7PM 4XOGA 2HWB1 2ZGQA 4G3YC 2UU8A 3KZ4C 5DUXA 3C7HA 1OLRA 3S57A 1OUSA 2RS13 3JUUA 4HZFA 4JZRA 2JB4A 5H9SA 4CP9B 4CU7A 1WW4A 4AVVA 4Q1PA 3WQ1A 1XNKA 3KS7A 3U11A 4AEKA 3ZIWA 4N9IA 4RGKA 1XE7A 3WG2A 5E88A 1FX5A 2FZ1A 4Z2AA 3HNBM 5C3QA 1PNGA 1SBDA 1SG3A 2MEV2 4QX2A 2MEV3 4CCJA 4ZXEA 1JYXA 1RVF2 1WA4A 2Z42A 2WO3A 4KWKA 4SBVA 1PVC3 1ZZ6A 3D82A 4EN8B 5FZ3A 1JUHA 2W0XA 5CU1A 3FBMA 3SMHA 5DZEA 1FNYA 4U2AA 4KH9A 4XJUA 2OX0A 1A3KA 4YGBA 1OVSA 5IVJA 4E2QA 4CDXC 4L8QA 2BGOA 3ZSMA 3AJYA 3P3NA 1CAUA 2WS93 5DAQA 5JIUA 1GP6A 1S1AA 3AYCA 1JZ5A 4IQPA 2Y6LA 2A3WA 2BRTA 4Q4Y2 4QM9A 2NYYA 3KMHA 2IUWA 1E57A 2PHLA 4E8DA 3BN6A 3C8XA 1QJX1 2E7QA 3ORJA 4Z82A 5J48A 4LKSA 1R1A2 3AYEA 1QJY3 3GM8A 4IE0A 2JDPA 3LEIA 4LHKA 3T09A 1IS5A 1WCQA 2P2KA 2JECA 5FXZA 2FQPA 2Y38A 1OA4A 4WZFA 1X7NA 2ILMA 2VUJA 3J9SA 4LO5B 1QWRA 4Y5SA 5GLUA 1IQAA 1J3PA 1Y7BA 2ZGLA 5IJRA 5LBCA 4AI3A 1GR3A 2MNGA 1CAVA 4LO4B 2RVAA 1S0GA 3NNJA 3FC0A 1MEC2 5FREA 4MSVA 4UBGA 3TN93 5JZGB 2K9ZA 4QT6A 2WA4A 1W03A 5I91A 4UI9L 1OFNA 3WW1A 4R52A 1W6OA 2KM2A 3MV11 4XVHA 3M3QA 4RR3C 3WXPA 5GM0A 1APNA 2MHFA 3IT8A 3S0MA 3L9JT 1K42A 3H8RA 3SC7X 4C0HA 1ASJ3 2QQPA 3WT3A 4KGGA 2RHPA 1C57A 2VJXA 1ZBA2 5FZ7A 5FZHA 5LA9A 4DS0A 5BNOA 1JYCA 2KD7A 5JSRA 3TEZA 5J1XA 1UKGA 2I74A 1UY3A 3PJQA 1LOBA 3WF3A 4ISRA 1VPHA 1CAVB 1GYKA 3AMPA 2ZS6B 5HXMA 3ZYFA 1VAVA 4WVZA 1KFXL 3THDA 1LHOA 4ZZ8A 1PMHX 4GB33 3WW3A 5I0RA 1EP0A 4YW1A 2W1QA 3H1MA 4M0NA 2A3YA 5A80A 3AX4A 3CMGA 3HD8B 4MH0E 4BJ0A 1G9DA 1F9KA 1GP4A 2VNGA 3B01A 5FTTC 3DPRB 5EWSA 2ZGRA 4AAPA 4YGCA 4ASMB 3W5MA 3R4SA 5LBFA 1GZWA 3R6SA 4LE4A 4GD4A 3IMNA 4QKFA 1FAYA 4CUGA 2FCVA 1EAH1 2J42A 4YPJA 2Q8EA 3UGFA 4HK9A 1UY1A 3APBA 2J1VA 1K12A 2Z69A 2TEPA 1HRI1 4W50A 5JI9A 4XABA 2DBIA 1AR91 1SHWB 2WNOA 3Q8EA 4CXWA 2B9VA 3I2GA 2VMCA 3LGRA 2Y6KA 3GXUA 3T2QA 2RDRA 2EXHA 1H4HA 3A21A 2XQRA 1R1ZA 3AVRA 4WM8A 3CJIB 1V6LA 3AXEA 2XVLA 3MW4A 3TWIA 3RZKA 3POWA 3FMGA 5HCBA 1U5YA 2RS51 1D4M1 3DPRA 1YI9A 1BXHA 3CJIC 1W39A 2CDPA 3IPVB 1H1AA 4YRDA 3S30A 1GU3A 4META 1V0AA 4DINB 4URAA 4GWMA 2LS6A 1W8TA 3J7HA 4QGNA 2WNVA 3IDAA 3KQ4B 1N1VA 2BEOA 4NAOA 3HVDA 1PZ8A 1GNYA 2ZPXA 4AVTA 1BHGA 4FPCA 2VR4A 1OQDA 2JE8A 3LIHA 4K3UA 3WV6A 2KXLA 3R05A 1UO9A 2BNMA 2YHJA 4COUA 2BTVC 4C1WA 1HXS3 3LAGA 5A7NA 5C6CA 3H3ZA 3I8TA 1W9FA 2VQ0A 1J59A 5C4WB 2XPJA 2BWAA 4RYDA 2ORZA 2XKPA 3E1F1 5DAPA 1FPN2 1PK6C 3WG3A 3X29B 4S2FA 1PK6A 4IV1B 3Q8CA 3B9IA 2ZGKA 1NX9A 4NAMA 1W28A 1OURA 4OHWA 3AP9A 5CEHA 1PK6B 2OS2A 4CEWA 4ES8A 3NW4A 1VBC1 4IV1C 2L9LA 2ZCWA 3NVCA 2NP0A 4XJAA 4JKKA 4QGLA 2FDHA 4XIOA 4QX1A 5JPNB 2J1AA 1WMEA 4IE4A 3HBKA 5C3SA 5EXOA 2P5BA 4K6BA 4LBQA 1W8OA 4CCMA 2JE7A 3WG4A 4AFMA 4GH4C 1PIV2 2R1DA 4K9SA 3CL1A 1XE0A 4E4DX 3P6BA 5IAVA 3ZXEA 4AI9A 2AUYA 2BGCA 2GMMA 3I7DA 5FYBA 5A3TA 2JG9A 2HLEA 3Q9OA 2FCTA 2ADEA 3BU7A 4UW6A 1DQ1A 2Y34A 2ZOEB 1BMV1 1L7LA 5C3OA 1UPSA 4MUVA 4PCRA 2WNVB 4IDZA 1LHWA 1CD3G 1MEC3 1TME1 2EF6A 4DZGA 5C3RA 4QDRA 2UWBA 5A32A 2ZGTA 3ATGA 4OFGA 2OKXA 2VMFA 3WP6A 4BWOA 3RPQA 1GUIA 1XRUA 5HV4A 4OHXA 2Q30A 1CJPA 4AWDA 5CG8A 2J7MA 1RMU3 3ZDSA 1K45A 3WNOA 3C7EA 2A71A 5C8CA 1JZ7A 5FMDA 3VBOC 5LW9A 4AHYA 1FOD1 4S2GA 1RL3A 5IWFA 3VBHB 2JD4A 1Y4WA 5EJ3A 2RR13 1AXYA 1KXGA 1W0OA 1SLCA 2IC1A 1JMUB 2WNUA 4FOQA 4YW7A 1GNHA 3FFQA 5T50A 3MW3A 1R64A 3PU8A 2BYVE 3FLTA 1YWKA 3IAQA 1VBB2 4YW2A 1EPWA 2N7GA 2VVFA 3N9PA 2HWC1 1QHDA 1X50A 3TEYA 2FD8A 1DU3D 3ABZA 4FTSA 3OPWA 1HV0A 5ANQA 2BERA 1FMD2 3TBDA 1DGWA 3T2PA 5FKCA 1GQPA 2VVDA 3GYDA 5A33A 2Q8CA 2G19A 2HWC3 4OQ8A 1I1EA 3RZGA 4YM1A 4DXZA 3ZSLA 4FSJA 3KB5A 4YVSB 1JZ8A 2RS31 1O4ZA 1C8M2 1QDOA 1SLIA 3P5BA 3POEA 2BNNA 3HT1A 1GWMA 4FOWA 4IGPA 4PIYA 3SEEA 3ZFGB 5LZ6A 4YM0A 2CU5A 1JU4A 3N7MA 2ZZJA 5L9RA 1J3RA 3SXWA 3U37A 1NCQB 2A6WA 5F37A 1LESA 1WD3A 3ZXDA 3RZHA 2VULA 1WCUA 1SACA 2GN7A 3B9CA 3MIEA 2ZBJA 5DABA 3VDBA 1BMV2 2D6KA 4IETA 5DDJ3 2GMPA 4EQVA 5DN2A 2O8QA 5EJ1B 1L7RA 3CLPA 3HWJA 4NHMA 5L19A 2Y0OA 1HB3A 3JD73 2VU9A 2CGNA 2H0BA 2H6CA 4FPJA 2B9UA 1QJU3 2EALA 1YLLA 4AQ6A 1C8NA 2XBO2 2Y6HA 2YDEA 2DVGA 1NE6A 5E16A 3I2HA 3DGTA 3ZXGA 1WWYA 2QBXA 1O4TA 4JCKA 2BV4A 4RR3A 1CQ9A 4J1XA 4MGIE 1JOPA 1PO22 2PFWA 2LM3A 4I0WB 5KHIA 3ZYJB 1YYNA 3R0RA 2QQLA 3BU0A 5IFPA 1Y3TA 4CP9A 3BYWA 4HN1A 4BLIA 5L7OA 2XXZA 4XHXA 5CB7A 1W6OB 5FPXA 1S0BA 2JDHA 5FO8B 1W2NA 1W6PB 4TYSA 5CAZA 4XCAA 1HRI3 1XB9A 4AEMA 4XFGA 5A3NA 1PHMA 1UYZA 2GNMA 5F9TA 1HRI2 2D5HA 1EAH3 1JN2P 5FLJA 4Q0QA 4ET7A 1AUYA 1EAH2 2X29A 1Z0HA 1ZX5A 3SCGA 2IXIA 2JE9A 4QPGA 3WD5A 5CISA 4XDPA 2VE1A 2NMOA 4IW3A 4Q4W2 3OY8B 5C4WC 2JXAA 1XNDA 3JB8A 4LKFA 4RR3B 1AZDA 3VKLA 3U14A 1YHFA 3VGIA 4QU1A 1QGLA 2Z2SB 1LEDA 3UESA 1D2SA 2O1QA 3FE5A 2VZOA 3ZPYA 3NKTA 1VMJA 3BIWE 1W8UA 2P34A 1DYKA 2PQQA 4R8HA 3POSA 5FYSA 1W6PA 3OF1A 3JD71 4XBNA 1UNBA 4B29A 4E9KA 5FQ0A 1D0GA 3F2ZA 4UF0B 1Q8OA 3RRDA 2XLGA 1MR5A 2R30A 3WF0A 4WV8A 5A6YA 5JR2A 1VRH2 4AQSA 3RZZA 1JI6A 1BLZA 2ZAAA 1V6JA 1HB2A 3M4FA 4BIFA 4QXHA 3DPRC 3WW2A 5CFDA 3BODA 1RUD3 5F3EA 4CDUC 4YW5A 1W0NA 1ZZCA 4M3CA 4QPIB 4GMP3 4I0BA 4MGKE 2DF7A 1XSQA 4CU8A 4Q0PA 3BUCA 4UFMA 3NAPB 1WMFA 1ZRIA 2HWF1 2ZX0A 3C7OA 4QX0A 5JIAA 3TAYA 2WZEA 2H6BA 3WDXA 4CEWC 5A1AA 3GJBA 3OBRA 3PU3A 4NJ4A 1MZEA 1NZCA 5GKAC 1DF0A 3PUAA 1HQLA 4IV3B 1DGRA 1POV1 4Y4YA 2R32A 1LGBA 4ITCA 3ZYPA 1DCSA 3H50A 4WM7C 3F95A 3U1XA 3VLBB 5FYYA 1ACCA 3ZFFC 2QQIA 3PLQA 1QIQA 5BNOB 4OI1A 1UIKA 3PMEA 2A5ZA 1UAIA 1HX6A 1AYN1 2C9KA 3OCPA 2CGPA 4AQ2A 4QPIA 1Y43B 3HNYM 3WX5A 3POGA 2J1RA 4XQDA 1ALYA 5FZLA 1UWWA 4LHNA 4YLZA 4JGZB 1TZOA 5IVCA 3LZZA 4N43B 1F5FA 4AGVA 4QXBA 2WWJA 2ZGMA 3A22A 3URFA 4FPGA 3SQOA 1SMVA 1C28A 1JXNA 2XH6A 1CZTA 1UN1A 3I3BA 5FP3A 4AQTA 4EROA 1BEV1 3HIFA 5EQUA 2C5DA 4JGZC 5J7MA 5IK4A 4H7MA 3AMMA 3V0AB 4MOAA 1UKRA 2WIIB 1OXCA 1OKQA 3FZ3A 3KSCA 3MLLA 4FFFA 4NUBA 5T55A 2A75A 1Q8PA 1YEWA 4LBKA 3ON7A 1IS6A 4HMZA 1LR5A 2QUOA 5ABJC 4BOWA 5ABJA 2JENA 1IPJA 1T2XA 1YI7A 4P02B 2B4KA 1OPOA 1XYPA 2ZACA 4I0AA 4WM8C 5A3OA 3UJQA 3KVAA 1SCSA 1O5LA 1SZBA 1UXXX 4GWIA 2HWF2 4AAXA 4WM8B 3NL1A 5F1RA 4QX8A 3SITA 3CJIA 2EXKA 4AEDC 1NCRC 3KVBA 2PELA 2WO7A 5F2SA 1UXZA 5JMOA 4LXLA 3SEPA 4XJZA 1PO12 2VUDA 4XFCA 1H6YA 3O0XA 3VBSB 4PF5A 3AKTA 3O1PA 1PO23 5LY2A 5F5QA 4F8AA 3WDYA 1KS5A 1I5PA 4HVRA 2YYOA 2O14A 3T2OA 4RD7A 4XJWA 1ZZ8A 3N9OA 1RMU1 1B35B 3DL3A 4GQ7A 1G9CA 2J1SA 3K75B 3SH3A 1ZBE2 1DLCA 2HWE1 1GKBA 1AR61 4GH4A 5LATA 1OQ1A 1RHI1 3I3MA 5ANNA 3AP7A 4BQWA 1MVEA 1A8DA 4MYEA 2VG9A 1YQ6A 5J98B 4CEYC 3WNMA 2VZRA 3EQEA 4LTAA 4I3GA 4K1ZA 3VD3A 2HBTA 5EP9A 1SLLA 1PVC1 3GBGA 2PAMA 5FZ0A 2GNTA 1NA1A 2W9XA 4MX3A 2EAKA 3TNPB 5JLVA 3PHMA 3C3VA 5FWJA 3HMYA 2BDRA 4CUBA 2GU9A 2QZ3A 1DBNA 4XZPA 3WSOA 1HIXA 2BVVA 1DQ4A 1RIRA 1WLDA 4XF4A 4AHWA 4CP0A 4DRRA 4P5YA 1ND2C 5C8WA 3OD0A 4CPBD 1IPSA 3VBOA 4MLOA 4PBPA 3PURA 1AX0A 5FBJA 1VBC3 3MIHA 3WNKA 1POV3 3NNMA 3U4SA 2VZSA 2ORXA 4XUQA 3B3QE 4DOUA 2HWB3 4CDWB 4CE8A 2B39A 2CAUA 2E7TA 5A3PA 1NYWA 2XBO1 1LNSA 4NVPA 3SKVA 4LR4A 2XDVA 4KI5M 3CQOA 3N9QA 2R061 3O7OA 5DAWA 3WDWA 1WMDA 5KXCA 4NHYA 3O5SA 4EV0A 3UKNA 2I45A 1XSRA 4MV2A 3VZJA 1QOSA 1VIWB 4Y1UA 2ZEWA 1H8TA 3ZN6B 1HKDA 2PLV3 4HN0A 2ZX3A 3K51A 1GZ9A 1O8SA 3MF6A 5FUIA 5A32B 5LRRA 4BMBA 4NIDA 2XLFA 4QKBA 4AI0A 2J1UA 4NPMA 2QQNA 2WLPA 1CPNA 3AYDA 5IVFA 4Y1XA 4NWVA 1ND3C 1VALA 1ULCA 2DVBA 2RS32 1LTEA 2VUCA 1ZM1A 3FJSA 1W6NB 4IV3C 4FP3A 1POQA 4Q0VA 2FZ2A 4I2OA 5CA6A 3OGSA 3VKMA 1VBB1 1US3A 1DYOA 2C4XA 4WM7B 2W39A 5HI0A 1FV3A 4CU9A 5L7OB 3ZXKA 3ZR6A 3JBG1 1G7YA 3W20A 3PVNA 1ZA4A 3H3UA 1AL22 2YGLA 1C8M3 2EXIA 4XHBA 4ZONA 2ARCA 4NRPA 1GV9A 3BOWA 4H3WA 3PNAA 4P9IA 5FY7A 4N53B 3NQHA 3ZXFA 2D43A 4JHTA 2JDNA 3TRSB 4PJYA 1O4YA 3NJXA 4ES9A 4JDNA 3KT4A 1GNZA 1FNZA 4OYUA 3LEGA 1Q8QA 1UYYA 1SFNA 2ZAHA 4Q4V2 2D6LX 4HFSA 1W6MB 1XNTA 4YFWA 2YBKA 4YW6A 2GC0A 3WY6A 3WDVA 4Q4V3 4NRMA 1R1A3 4QU2A 2X5IC 3WQ0A 5B2GB 1XNAA 4TZDA 5KXDA 3LDRA 2FDGA 1AJOA 1QDCA 1RUC3 2V4VA 3C7GA 1V6MA 1JHNA 2XJPA 2WC2A 4Y1ZA 4Z1VA 3W58A 1BQPA 1RUC2 5JMCA 2YBPA 5T5PA 5F39A 3VL8A 4JKLA 2JG8A 2WS91 3GCXA 5GLVA 2ZGNA 5C4WA 3QLQA 2HWE3 5AC93 1QU0A 1X9TA 5F3IA 3EO6A 2VNVA 2JX9A 2OUJA 5DXDA 3ZYBA 3O1UA 2WDBA 2HJIA 3ME2A 1UPIA 1JS9A 1VP6A 3N9LA 1VBA1 2JDKA 1S0FA 5F6KA 1QXPA 4HG6B 1SQ4A 2XL7A 4BQ3A 1X8EA 4WM7A 5FDBA 1N47A 4QDSA 2ZGPA 4XZUG 3SLIA 5F6LB 4NROA 3U0ZA 1CIWA 3WQBA 4UXAA 5HCHA 1MS0A 2D44A 2JDYA 3O0WA 4NR1A 1ZYBA 1Q43A 1SEFA 1V70A 2G4IA 4W6YA 5IK5A 1XBFA 4QPIC 3PIGA 1DGLA 1S4CA 1CAWB 1AXKA 1W6QB 1A78A 1ENQA 2E51A 3FX3A 4JDOA 1IG3A 1H2KA 4EWAA 1U5XA 2TBVA 1CAWA 3QOPA 2WO1A 4QX5A 1TEIA 2VO5A 4CU6A 4XAEA 4QPYA 5FY4A 1D2QA 3PUHA 1RUOA 4ONUA 3WNLA 1O6UA 3FHQA 5JAXA 3WP5A 3VB9A 2AC1A 4Q4X3 4XJ8A 1LULA 3RYPA 3T1LA 4XFIA 1J1LA 3I49A 5DAXA 1ST8A 3K4ZA 4Y20B 2W08A 3ZDVA 1R1A1 4Q1RA 2VL4A 1L3JA 3AL5A 1UU6A 3THCA 4DIQA 5LA0A 2VAUA 4Y20A 5BNQA 3RFRA 3UKTA 2BNOA 3J26N 3BVCA 4QPGB 1S2EA 5JI7A 4DNYA 4FOYA 5AFEA 5BY5A 5C3PA 2MEV1 1MS5A 1TME3 3AM2A 1J83A 1EPZA 3ZM8A 3ZFGA 1TNFA 2V72A 1YQ8A 1KITA 3U75A 4EYUA 3KT1A 1LGNA 3V65A 5LRSA 5CBLA 2PHXA 4FVVA 1PGW2 1ENXA 1NZIA 1U5ZA 4XUTA 3THTA 1CAXB 3JXSA 4P9WA 3W9AA 1RUF1 1SCRA 1ODMA 2C6SA 2D3RA 1XJAA 1RUG3 4NE9A 4AFCA 2GP3A 2CSGA 1CESA 4KG0A 4K8RB 4QB1A 5AVPA 4LKDA 4M00A 2ZHNA 5FPZA 3VD5A 1YFYA 4D7SA 1OLQA 3NMBA 2ZXQA 4AR2A 2GDFA 3B69A 1ZVFA 3DN7A 4ASLA 2ENRA 4GMP1 2FHRA 2G9FA 2VQAA 3LCPA 4RHV1 4RQPA 3ZIXA 4DMIA 1AR93 2HEWF 1CJDA 3WHTA 5J3UA 1UU4A 3WF4A 4BQXA 1E5IA 3CEWA 4GZ9A 1RUI1 2A70A 4ARXA 3RDIA 5T5LA 2V73A 1XNCA 3NV3A 2V4AA 1UIJA 4QB6A 4CCOA 1AL23 1WD4A 3OUJA 4KBBA 4H14A 2ARXA 4LJHA 1R082 4XMAA 1X33A 1SFYA 2XJVA 1O91A 3M3IA 4IUGA 4D7YA 1LB2A 1RGSA 1LOEA 5LWBA 3JZVA 5D21A 4X8PA 1I5ZA 3ALQA 4JGZA 2DYCA 1GWLA 5FWEA 2ZMKA 3E5UA 1WCDJ 3UKVA 1Y9QA 1AX2A 3B5LB 2W52A 1QXRA 2D3SA 5FPUA 1JUIA 2JD9A 2Y6GA 2RM23 4QD2A 4LNVA 4R9BA 4N53C 5DPNA 2BOIA 2F4PA 5H9RA 1IGOA 5FV3A 1STMA 3MIDA 5FZAA 1AR71 1FMD1 2HBUA 2FBEA 3ACFA 4FQZA 4JV4A 3BI3A 1DFQA 2VH9A 5K4LA 3AKPA 1TVGA 2ARBA 5FZMA 4D6RA 3D8CA 1J84A 5FLHA 2VNRA 3D5OA 1E5HA 3B02A 5E6HA 3GZUC 4FQ4A 4LEJA 5FP8A 1ZRRA 1BZWA 1DGRN 1GOHA 3GZTB 2AR6A 3O14A 4KWUA 2QZ2A 3PJYA 3LE0A 3N35A 3QH6A 3RWKX 5LCWL 4FTBA 2D6NA 1AR83 1AF9A 3LFIA 3ETQA 4AGRA 1UMZA 1H9WA 5C33A 2FDFA 4L92A 2VCAA 1R092 2WRAA 4FCAA 3D0SA 1WLWA 4IERA 4IEPA 2P6CA 3R4UA 5HCFA 1ZRCA 1EUUA 3ACHA 4L2NA 2E6VA 5IYYA 3WEZA 4NO4A 2A73B 2Y60A 2NZ9A 5EFUA 1AR62 1YQCA 2WJSA 3VZLA 1JU3A 1NLSA 3O1SA 1AR63 2ETEA 4E4SA 5KHJA 3IB3A 1U5IA 4CCEA 2JG9C 5KBFA 3ZXLA 5HXVA 4V2VA 1H8VA 1X8MA 4MXWB 1W9SA 3E5XA 1Z7S1 2CGOA 3RG0A 5FY1A 2VCCA 1DDLA 4UW5A 4XFFA 1KS4A 1OH4A 3S7IA 4INDA 2VVEA 1H9PA 3WVJA 2ZGSA 1GZCA 4AYUA 3UJOA 5D2AA 1J58A 1EV13 1AVBA 1XPWA 5F3CA 4B8EA 3PTYA 1TMF1 5J36A 1D4VB 1GQHA 3MUY1 2QCSB 3LPGA 4YZ4A 3VDCA 2R042 3WOGA 4HPKA 3ZFEC 5GJ6A 3J8F2 5FCCA 1RUG1 4XETA 3VBOB 4AZZA 4CCKA 1ZREA 3GNEA 3MO4A 2YC0A 5A1LA 2AREA 2DU0A 2QFEA 3P3PA 4IV3A 1OQEA 3ZMOA 5ACA1 2ZHKA 3FLPA 4LOTA 4R4XA 3SCFA 1DZRA 4Y3OA 3ZFEB 1VBA3 3AZZA 3LDBA 4N43C 3TOJA 5K0UC 2PA7A 3FUQA 5FZGA 3IDCB 1W8HA 4HANA 1CX1A 3IMMA 1G9AA 3AVSA 3T3YA 4CDXA 4C8DA 4Y22B 2WT0A 5FZDA 4ZPIA 3MUZ1 2FMYA 2BFUL 4FPKA 4U36A 1LOFA 1V6OA 4JC1A 1VBE1 4WVWA 3A7QA 5FZIA 4CZSA 1H30A 3EYPA 1VAKA 5BUVA 4B1LA 4HPKB 1WCKA 4CYDA 4CCDA 3MW2A 4A7ZA 4YVSC 5ISLA 4QQHA 1YIPA 2RS12 2DFBA 1R091 4Q29A 2Q1FA 5LASA 3VHPA 3FN9A 4UT5A 1YNAA 2XB6C 1WA6X 1HJGA 1RXFA 2R072 3I2KA 3MLKA 1VE0A 3KWVA 3VDDB 2RJ2A 2PXJA 3RSJA 1MQTC 4Z8BA 1UYPA 4OZXA 4QX3A 1N1TA 5IVBA 3AMNA 4JAAA 2BU9A 4I3PA 2W1SA 1UQXA 4GJZA 4CDXB 4OQ9A 3OY8A 4CCNA 3WZ1A 3SCHA 4P5HA 2XUEA 1XXNA 4B7KA 4JGYA 1UZ0A 4NIHA 1PNFA 2ZZQA 1RTVA 1WW6A 3GHNA 3ELNA 4PDWB 3J7NA 3T4HB 4HKOA 3OGGA 3MICA 3OBZA 2DUOA 3QCWA 3KQRA 4FO9A 1MS4A 3DEMA 4GJYA 2R16A 2WQZC 2J1TA 4GWJA 3IDBB 2P1BA 1W04A 1UX6A 2DCZA 3LWCA 2BZDA 3FLRA 3LEMA 3GHMA 4AFDA 5IFTA 3LB9A 1GZWB 3M7AA 1VMFA 1RITA 3BTZA 3WR0A 3ZFFA 3J7MA 4AHZA 3AC0A 3KV5A 5FBZA 1AR73 5FO7B 1MACA 4IEQA 1OA2A 4LLOA 5FYHA 4K20A 2YGMA 2W95A 1G9BA 1D0HA 3FWEA 1RUC1 4H2AA 2P4EA 3Q8BA 4XAAA 1IKQA 4KU8A 5IAXA 5L73A 3BIEA 3HT2A 4PBOA 3ASIA
chains in the Genus database with same CATH topology
4JTNA 3TN92 3RMXA 1PZ9A 4G9SB 4JVAA 3USUA 4CDWC 2NQYA 2DCTA 4BYYA 2WT2A 3KLSA 1AL0G 1ZBE3 3HQXA 1JOJA 5DG2A 4GA9A 2YROA 5HBAA 1WBLA 1VR3A 1ASJ2 4CRQA 1DIWA 1ZBA3 1COV3 1RUE2 4L97A 3KD4A 3GALA 1OOPB 2OUHA 3RJRA 4QQOA 4N90A 3N3HA 3AZYA 4JRAA 4OULA 4UW4A 4GXLA 4QMAA 2RMU2 4IEWA 1REEA 1FYUA 4AEDA 1TQ5A 4EN6B 4QM8A 1FMD3 4A3XA 1Z7S2 5FO9B 1RJ7A 1UCXA 3MGUA 1SLAA 1W6QA 2HWC2 2WNVC 1GICA 3NV4A 1CGPA 2DVDA 4YZ2A 1VB2A 4IV1A 3S7EA 2OPKA 5LEJA 3ST7A 3KCXA 1QQP1 4CEWB 1LEMA 3ZYGA 1GLHA 2VW2A 1H2NA 2WFPA 5FMOL 5JDBA 1NXMA 2GC3A 3BPZA 3NV1A 5DDJ1 2YXSA 1VRH1 4RQPC 1SBFA 4O9EA 4DPNA 2XGXA 2I07B 5KXBA 3RI8A 1MZFA 1G9FA 3HR9A 3K48A 4JRLA 4Q4X1 4EN7B 1WW7A 2DTWA 4DQAA 2B45X 5JOXA 2TNFA 1XYNA 2XG3A 1YO8A 4S2DA 1ND2A 4HSJA 1J3QA 3V56A 2NMNA 3U10A 2O0OA 2HWD3 3I54A 4OI0A 2VW0A 4BZ4A 2R073 3KM5A 4N53A 1AR92 2DWRA 5JSPA 2CL2A 4WZCA 2DCKA 4QGMA 1CR7A 2VECA 2XJTA 2ZMNA 5JSOA 2RJKA 2ZTNA 2PTMA 1W6MA 1QNYA 2Q4SA 3AP6A 3IIAA 3CNAA 3ZN4A 4AXOA 3WDTA 1JYIA 3AKSA 3VBRC 1H8TC 4FAGA 3FBYA 1BKZA 1LOGA 1PMIA 4COVA 1RB8G 2ZX1A 5C8CC 4RGAA 1H8TB 3ZN6A 2CWMA 4XEZA 4Q8LA 4KWLA 4XTMA 2RM22 2WINB 3WHUA 2P3IA 1ND3A 5C8CB 4I02A 3VBSC 3E6BA 1ENRA 3WNXA 1VBE3 3AFGA 1QJY2 1ENSA 2WZR1 4AG4A 3IWZA 3THPA 3MPBA 5DUWA 1N1YA 2CWSA 4LO6B 3BOPA 1HW5A 1UL9A 5E89A 3JCIA 3ZVXA 3VHOA 4YGDA 1FXZA 4M3CE 3PMSA 5A33B 2DV9A 2R071 4LBNA 3MEPA 2V5YA 3M1HA 1IZ3A 1S0EA 2WNUB 5D8AC 3VBUB 4M01A 4XPVA 5TSWA 1W6NA 3M2MA 4GULA 2PAKA 4N7UA 2E53A 3B7MA 4AE2A 4YARA 1NG0A 1XU2A 1RVF1 4QHBA 1HDKA 1RHI2 4P9YA 4YG3A 4E2SA 2JDZA 4LE3A 5KC5A 1C5IA 4GWNA 4KGQA 1LOCA 4H55A 2Q1ZB 1LJ7A 2XVKA 1CVNA 2Y26A 4BE3A 2UY9A 1GQGA 1Z7S3 5K0UA 1YRZA 1H4GA 1C5HA 1FV2A 5J09A 2EA7A 2D93A 3H1YA 4UBHA 3LSEA 1K5MB 2WQ4A 4Z07A 1LOFC 2GN3A 3WG1A 4CDUB 5FFOC 3WUDA 2P3KA 5GZDA 1UW8A 1FOD2 3MZHA 4LO8A 3V0BA 3E6DA 2JKBA 5IT6A 5L36A 3AK0A 1MQTB 4OLLA 4YG6A 1VJ2A 4FOVA 1XQNA 1HLCA 3EHKA 1H2LA 2W68A 3QBQA 4JTOA 3VBFB 2BVBA 4LO7A 1VBA2 2DUQA 5LEKA 1DQ5A 1OPMA 2TUNA 4K7JA 4OHYA 4XMIA 3MIFA 1CX4A 2Y0IA 3VBFC 1LKNA 1ZZ9A 4RHV2 4K8FA 5I8TA 2IZWA 3EBRA 4RQPB 4XILA 2LUWA 4CTEA 1COV1 4COWA 3VBUA 3LOBA 2IXCA 3ZN5A 1TMF2 4GALA 2C0ZA 1Q5OA 2WLQA 4AVAA 2D5FA 2RS52 3ILFA 5IUQA 3MFCA 3ZO0B 1IHMA 4L11A 1G86A 3ENRA 3G7DA 4CDQC 5FAXA 4WVMB 1QH6A 3MYXA 3FHIB 1LHUA 1Q3EA 3AZWA 2IXHA 4RGGA 1RVF3 4XBQA 3M3EA 1A8MA 4DY5A 1FPN3 1KQRA 4NPRA 2DVAA 3VDDA 1K5MA 1AL21 3N36A 1PZ7A 4IEOA 1NA1C 1UZYA 2XHKA 3SHRA 5K7PA 4XQ4A 3RS6A 4TSVA 5A3LA 5T3NA 2IFRA 3WW4A 4LUKA 2EVXA 4GH4B 2JEMA 1N3QA 2AZ5A 3AJZA 4FP2A 4NWWA 4Q4Y3 5JCTA 5H9PA 5GLTA 2ATFA 4RL7A 4X6QB 2GNDA 5JOYA 4M3CF 1VBC2 3MFAA 4Q4X2 2BFUS 1J1TA 2GC1A 2WFF2 2PYTA 3IN9A 3LA2A 2HWB2 4CEYA 3RI9A 1DGWX 1D4M2 4I30A 2B5HA 3H9AA 1QJU1 1SBEA 3H8UA 4YZ5A 5GALA 1WCSA 3AMQA 3LOIA 4IXLA 5T5JA 5BYNA 1OA3A 5AC91 4Y1VA 1RJ8A 4L99A 2PHWA 4ATEA 5EYXA 4FTEA 1RINA 2R062 1MEC1 4YZ1A 1R093 5HCAA 4YNIA 1A6CA 4HK8A 3WLUA 2VPVA 1RUG2 4OVEA 3ZFFB 1BVP1 1POV0 4BQ1A 3ZX7A 5EYYA 2ZHMA 1ND2B 2WNUC 3QD6A 5FRAA 2VOKA 1AJKA 2RS33 4XF3A 2D6PA 1EY2A 4H7LA 2PHUA 1F31A 4ZXKA 2B7YA 2RMU3 3RYRA 4Q4Y1 4FPFA 2PHTA 1OOPA 4NHKA 1NCQC 1QNWA 2LALA 5GZCA 1R083 4X8NA 4G4FA 4D69A 4YM3A 4AGGA 2OZJA 5KWRA 4OHVA 4HBNA 2A7AA 2VOWA 3USSA 1XYOA 4FT8A 5CVRA 3IBMA 2D40A 2EXJA 4P9LA 3DUIA 4YVWB 4AW7A 2AH2A 3UL2A 4A2UA 2DFCA 4IL7A 4W65A 4AHXA 4SLIA 5DDJ2 3TB0A 4M3CB 4YVWA 3VZMA 4AEDB 3GBWA 3KT7A 4HKLA 4W6WA 4AK3A 3UV9A 4PLNA 1LHNA 1CAUB 1DLLA 3RMYA 4AI1A 4GKYA 2PLV1 4LA2A 1RC6A 2RS53 3L2HA 3PVBB 4Q4V1 1N1SA 1V9U2 1FATA 1VB4A 1V9U3 4M0HA 1LHVA 4K40A 5D8AA 3ILRA 3EXUA 1QOOA 1JH5A 1ULFA 2A3XA 2QDRA 3I59B 1HXS2 1XU1A 5BNNC 5T54A 1OI6A 1YJKA 2ZX4A 1BJQA 4BA6A 3IKWA 1S0IA 2XJQA 5BNPB 4CDQB 3RQ0A 3M3OA 4Y5Z0 2A6XA 1O3TA 2VXRA 3HAGA 4MXVA 2Q0AA 4AVBA 4XF0A 2IWGB 5CG9A 1JBCA 3H7YA 4LA3A 1ULEA 5D8AB 3VBUC 3BB6A 4Q4W3 2BPA2 3MDPA 5BPXA 4FPOB 5E8AA 4XFBA 3FFZA 1HQNA 3AKQA 4RS5A 4YZ3A 1XE8A 3GF6A 1ULGA 4WVVA 1VBE2 5BNPA 1AR72 4COZA 4FAHA 4HLTA 1O3RA 4LBQD 4C1XA 2DU1A 3GZAA 3J4UH 5IK8A 3ZYRA 3OYWB 1MQTA 5DG1A 2AGSA 1MS8A 2O8OA 1JW6A 2XL9A 3VZOA 3JBG2 1O5UA 1GFF2 4JGYC 5CFDC 1NCRA 4W6XA 4WBBA 2R063 1PO11 3N7LA 1OD5A 3I59A 5I8SA 4FBFA 2D98A 3H0OA 4COYA 1B35A 1R081 2AENA 1DHKB 1VLNA 3RNSA 1H1IA 1ND3B 3J8F1 4D3WA 2PLV2 4P9XA 4XE9A 1V00A 3WP3A 4OI2A 4LHLA 4F83A 1V9U1 1RUNA 1MZ6A 4Q8KA 5BNOC 3VZKA 1PGW1 3AMHA 4C90A 3PVEA 1QJY1 1ZZ7A 3U07A 4X6RB 3VBHA 2PHDA 4F7ZA 3VUOA 5J37A 1OSGA 4YG0A 2XWBB 3M3CA 4XF1A 2JJ6A 2NM1A 4PIXA 1YFUA 1BEV3 4OUSA 2EAAA 4B4QA 1BEV2 4FPHA 1BBT2 2WSVA 4MGYE 4QPGC 5CNAA 4AFAA 3IDEA 5A3MA 5K0UB 1YFWA 2XJSA 4I01A 4QQ2A 4Z92B 4XXPA 1ASJ1 1KD7A 4AF9A 1LU1A 4IEUA 2QVSB 1GBGA 2ZGOA 2QE3A 2VOVA 5GZFA 2WT1A 1NY71 1DQ2A 3B93A 1W2UA 5ACA3 1Q56A 5I8YA 2GNBA 4S2HA 5ACA2 3JD72 4IEXA 2HWD1 5BV6A 3VBRB 5C9AA 2P17A 2YUEA 1RUE1 2HWF3 1TMF3 3JU9A 4XF9A 3E97A 2R0FA 2F6BA 2VW1A 1PO13 4A7YA 1B35C 1PGL1 2DCJA 4D7TA 1RUD1 2HWE2 1LU2A 4TLFA 3KGZA 4Q2FA 4FPYA 4PDWC 5I93A 2ET1A 2VOXA 2ZKLA 2K0GA 4XXAA 3ES1A 4HSLA 1FPN1 1MS3A 1Q8VA 2ZKNA 1S0DA 3MLJA 3NSTA 4GIQA 1BK1A 2GSYA 4ZU4A 2XVGA 1ZRDA 4ZKTB 3H7JA 5JVVA 5K8SA 2RE9A 4B7EA 1QQP3 5BNNB 2BUKA 1QOTA 2UY8A 2OVUA 1YXWA 3HN1A 4RA0A 5LK7B 3RWNA 1IS4A 3WINE 3ZXJA 2B46X 3ZXAC 3DF0A 4LBLA 4HKWA 1AYN3 1VAMA 4OHZA 3M8LA 1CN1A 1IKPA 4Y26A 4A7KA 2WS92 3AYAA 4J1WA 2K2SA 1KRIA 2D6MA 1RUF2 1WW5A 3LSDA 1SLBA 1B09A 5DUUA 4LBMA 4AVSA 1NXD1 3WCSA 3BALA 1QY4A 1U0AA 3NJZA 3S6PA 1NOVA 4MXWA 1AYM1 3J8F3 3VV1A 1KJRA 3D0JA 1M4WA 1NY72 3V0AA 4TWTA 1ULDA 3JBG3 2NPIA 1WGPA 4XQWA 4IEYA 1V6KA 5C9AC 1QH7A 3KGLA 4HVOA 1I6XA 4XFAA 1WUVA 1TME2 1OOPC 2UWCA 5SV8A 1MS1A 4FXKB 1CONA 4Z2WA 1YFXA 1QXJA 4KG8A 2WWSA 4PQ9A 3VL9A 4Y1YA 4YFZA 4O9GA 5AFBA 4NHLA 1RUH2 4XFHA 5I0UA 2RJLA 5BNNA 3ZFEA 3POYA 1XNBA 4C91A 1TNRA 3ZYIB 4C0BA 3VBSA 4E27A 5JOWA 4URTA 1HRV1 4YW4A 5GZEA 4Q4W1 3PVOA 1MS9A 3V0BB 4OI4A 4FPLA 2HKXA 4Q0SA 3MI8A 2QJVA 3ILNA 1W0PA 5KXEA 2ZJCA 4YW3A 1S2KA 1ZZBA 4LT5A 1PVC2 1AYM3 1O3QA 3QH7A 4FXGB 4K1YA 3BCWA 1REDA 4YSFA 4F3JA 2OIIA 4P9GA 1LENA 3ZSEA 1LECA 1T6GC 2ZABA 2B42B 5BNPC 2XJRA 3V64A 2WSUA 4IEVA 2R49A 2QNKA 4ZU7A 2XUMA 3N7JA 3A0KA 4XYXA 2IXKA 2GALA 2UYBA 1IS3A 4RS5B 4LULA 4YM2A 2RR11 3WUCA 2VMIA 4CP2A 4R9CA 4EN0A 1QJU2 1BVVA 4RSUA 3JB4C 4XTPA 4Q27A 2PAEA 2P3JA 3LA3A 3OYWA 3AB0A 3B94A 5AC92 4PIZA 4K21A 2GZWA 1C4RA 3T1MA 5JWPA 1DYPA 5I0SA 4NOTA 4QQPA 3VZNA 2SBAA 5T5OA 2UURA 3WDUA 1QJZA 2Q8OA 5IK7A 1PO21 3KCCA 3HBZA 3TN91 1QQP2 3ZSJA 3LKJA 4MZUA 4B4RA 5SV5A 5BXXA 1S2BA 1COV2 1RUE3 4N43A 4IEZA 1C1FA 3RJ2X 1NLRA 2XLAA 4CEYB 2DURA 2HYKA 3MF9A 4AI8A 4AEJA 3C2UA 1PVXA 4R9AA 5FLIA 3DKWA 4DRVA 4Y22A 2PHRA 5JZGC 3O0VA 4P14A 3WQ7A 5JZGA 1PIV3 5DZGA 2WFF3 3OPZA 3L2YA 1FOD3 1LODA 2ZX2A 5J96B 1VRH3 1ONAA 4LBQB 4XJ9A 2XKOA 3R4DB 3ACLA 2DUPA 1DG6A 3RYKA 1UF2C 3ZMNA 1CPMA 1RUD2 4RFT0 5KHHA 1JTZX 1AR81 3ZFGC 1OHFA 1LGCA 4DY3A 2OA2A 5JPMB 5CFCC 3UK9A 1GANA 1RMU2 2VMGA 2QDNA 3AZVA 1I3HA 4EWAA 5C9AB 4B3NA 2V09A 2SLIA 2D97A 1RUH3 1WLCA 4PDWA 1U12A 2RS11 5GZGA 5ABJB 1Z78A 2NLRA 4KQ7A 1NQDA 3VKFC 2JICA 1VBB3 1AX1A 4N7IA 1PGSA 4JDMA 2D7FA 2G9GA 1MVQA 4CP1A 1HQWA 2CV6A 1NCRB 4NN0A 1F5JA 3N4MA 1Q8SA 1BBT3 1G6NA 1KFUL 4LBOA 1OFSA 1AYM2 1X36A 5EZWA 3OTFA 3INAA 2UYAA 4BIOA 2UWAA 4CDWA 2VMHA 1C1LA 1H0BA 5H9QA 1HXS1 2OZ6A 4GB31 3TNQA 4JQRA 4EWEA 2HEYF 3ECQA 1YUDA 1LCLA 1QMJA 3CO2A 2A6YA 2C9AA 4ORFA 2R6QA 1LRHA 5CADA 1HRV2 3VKNA 1C3HA 2WKKA 2DVFA 1SLTA 1D4M3 2ZHLA 3ROUA 2YY1A 4ATFA 1NE4A 4HL0A 4PLMA 4ISQA 1RUH1 3VBRA 5GLWA 4DB5A 1ZRFA 2ET7A 1UD1A 1AXZA 1M06G 4BMEA 2A6VA 1AR82 2A6ZA 2ERFA 4BHPA 1NCQA 3I4IA 5FMOS 3RZZA 4XW3A 3MIGA 1HV1A 1OMIA 3SH5A 1S55A 1NA1B 4AFBA 2Z5WA 2LTNA 3A0NA 2ZMLA 1BCXA 3AXDA 4P9JA 2VUAA 3TYJA 4XBLA 2DTYA 4LBJA 4OUMA</