3AYDA

Crystal structure of galectin-3 crd domian complexed with tfn
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
135
Chain Sequence
MPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for distinct binding properties of the human galectins to thomsen-friedenreich antigen
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-3
total genus 30
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aydA00
2R16A 1HKDA 2YROA 4WV8A 4DPNA 1H30A 4DFSA 1V6IA 1ONAA 4YM1A 2P3IA 4BLIA 1KDMA 4R9DA 2A3XA 3FLRA 1CESA 2WQZC 3NV3A 3AZXA 4BM8A 3NV1A 2UWBA 1EPWA 3VKFC 3OBTA 1JBCA 1LOGA 3AZYA 4I30A 1SCRA 1YO8A 3WOGA 1KRIA 2ES3A 2Z42A 4FPOB 1F31A 1SBEA 2A75A 3RMXA 4LBQA 5KXDA 1QMJA 2D44A 5T5LA 2I2SA 4HL0A 4FPFA 3ILNA 2A3YA 1ZA4A 4XBNA 4AWDA 4Y24A 2B7YA 1LHUA 1SCSA 1UAIA 1YRZA 2A7AA 1W6MB 1D0HA 1S0CA 5DUWA 1U0AA 1HDKA 2H0BA 2VW2A 2ZMNA 1DIWA 4LBQB 4BMBA 1UPSA 2ZABA 4UW4A 4Y1XA 2FHRA 3POYA 4YM2A 5GZDA 4XJWA 1MVQA 2SLIA 2D6OX 3WHTA 5FREA 4XZPA 4U2AA 1FAYA 3RMYA 4GKXA 4NOTA 2WSUA 4YZ4A 3V0BA 3GALA 3WVJA 1LOFC 5JOYA 2OUJA 1KJLA 4ATFA 5EYYA 3MPPG 3LSDA 2D6MA 1RINA 4ISQA 3VKNA 2LALA 2W08A 1CIWA 1MS3A 4ATEA 5GLTA 3BIWE 3FBYA 4ZKTB 1A78A 1FATA 1MACA 1BQPA 1C57A 2W68A 3VKOA 2E53A 3AZVA 2V73A 1LU2A 4FOQA 1UZYA 3FUQA 3I8TA 1W6NA 4YGCA 1LGBA 1BXHA 3RG0A 3BTAA 4P9WA 2GN3A 3JU9A 1QOSA 3NWKA 1GANA 3NV2A 1WD4A 4FQZA 1WW6A 4XYXA 4XOGA 4Y22A 2AREA 1QKQA 3B9CA 4YGBA 2R49A 3AYDA 2A6YA 2LTNA 2P3KA 5GZFA 3GNEA 2R0HA 1AX1A 4PBOA 4GALA 5GALA 1MS1A 1Q8OA 4H55A 4UW6A 5DZGA 3B00A 2C5DA 4C1WA 1UKGA 4M3CA 1N1YA 3RSJA 1WLDA 4R9AA 2JDZA 3M1HA 4MYEA 5T5PA 2DYCA 5CBLA 2ZGSA 5F9TA 3M3QA 4P14A 1QNWA 3AZZA 1TEIA 4YLZA 4XXAA 3AZWA 3WUCA 4AGVA 4L8QA 4BOWA 1SFYA 1AX2A 1N3PA 1LGCA 1UL9A 3WG2A 4FVVA 1YXWA 1LOFA 3OJBA 2PHXA 4GA9A 3WDYA 1SBDA 2ZMKA 2A70A 4GWMA 1WLWA 3WDVA 5FRAA 1S0JA 4XXPA 1OKQA 1IS6A 4XJZA 5IUQA 3OY8B 5T5OA 4D69A 5GLUA 3KM5A 2HYKA 1JXNA 3POSA 3N7LA 1J1TA 2VU9A 3PMEA 2CWMA 4YW4A 3U4XA 1JOJA 1URXA 5DZEA 3T1MA 4DQAA 4LBOA 2DWRA 2AENA 5AVAA 3UJOA 2UU8A 1C4RA 1KDKA 2CWSA 3FUOA 4Q27A 3W58A 1H9WA 2WLQA 3O0WA 3N35A 1GKBA 1DZQA 2PELA 1W6OB 2NP0A 1WW7A 3O0VA 1IS3A 5EYXA 3WG4A 1S0FA 2P3JA 3N7JA 3UL2A 4YG6A 1RITA 4LBKA 1Z0HA 1WUVA 1GZWA 4KBBA 1DLLA 3WZ1A 3AYCA 3DUIA 3V65A 2PHTA 1WW4A 4ZXKA 1MS9A 5T52A 2DV9A 1LHNA 4XBQA 1AZDA 2CL2A 4YG3A 1MVEA 1RIRA 2D3PA 4R9BA 1F9KA 3AP4A 1LGNA 1ENSA 2EIGA 2D3RA 2ZA9A 4ASMB 3UK9A 3WDUA 2YZ4A 1WW5A 2DU0A 5KXBA 4W65A 3MEPA 4YZ3A 1G9FA 3RRDA 4YZ5A 3AP7A 4Y1ZA 5DG2A 2EXHA 3SH3A 1SACA 3D6EA 2ZMLA 2AGSA 3VUOA 2ARBA 3IMNA 1WLCA 4YW5A 3RQ0A 3WDWA 2PHRA 3V0BB 3SNMA 2NM1A 2VY0A 3MW4A 4U36A 3VV1A 3O12A 1S1AA 1AJKA 2JD4A 1PZ7A 1MS0A 1N47A 1N1TA 1O4YA 4M00A 5GZCA 4GXLA 1AXKA 5T50A 2WSVA 2YMZA 1G7YA 4FPLA 4DS0A 3D5OA 5IT6A 4ITCA 3AXDA 1GZCA 1LEMA 3AXEA 4LBJA 1LHWA 5T54A 4DRVA 2EALA 2NYYA 2EXIA 2EAKA 2NN8A 2D6LX 2YV8A 1AX0A 1BKZA 2ERFA 3ZSMA 1ULGA 2ZGTA 1SLLA 3V0AB 3PJQA 1AF9A 1LOCA 4M3CE 2D6PA 4Q8KA 1I1EA 5HCFA 5HCAA 2GNBA 2WKKA 5SV8A 5IK7A 5JOWA 1IKQA 1GSLA 1N1SA 3ASIA 4SLIA 1SBFA 3SH5A 3WDTA 5GLZA 4AYUA 1VAVA 5GZGA 4XJAA 4BLJA 1FYUA 3OBRA 1IS4A 1V6OA 3AP6A 4AVVA 1QNYA 4FPYA 4FP3A 4M3CF 2AH2A 4XIOA 2OW4A 2GMMA 2ZKNA 4K20A 1CONA 4YZ2A 2AUYA 2GNTA 3CNAA 4Q8LA 1ENQA 1O4ZA 4YW2A 1CQ9A 3N36A 1DQ5A 4PF5A 5DUVA 4FPJA 4Y20A 1Z78A 1UX6A 2DUPA 2P34A 1S0DA 1DQ1A 3IN9A 1N1VA 5CAZA 1VIWB 3ZXEA 1KITA 4AGRA 2D43A 2DUOA 1C1LA 1PZ9A 2DURA 1GICA 1NXD1 4WVWA 4Y26A 2NMOA 4FPEA 4YFZA 5JMCA 3SH4A 2ZZJA 1V6MA 1GNZA 3AK0A 5T5JA 3SITA 4YZ1A 2VH9A 2KM2A 3M3EA 4YW1A 1UN1A 5GJ6A 4AVTA 1X50A 4K1YA 4XTMA 3A0NA 4LBMA 2WT1A 2UWCA 1G9DA 4Y22B 4Y1YA 5IK4A 2ARXA 3W59A 4M01A 4GKYA 1LOBA 4YG0A 3AFKA 3M3CA 4YGDA 3OYWA 5E88A 1YIFA 1G86A 2ZHNA 2E51A 2VUAA 1FV2A 3HMYA 3LCPA 1LHOA 4FOWA 3WCSA 4C1XA 1GZWB 1FV3A 3Q9OA 4LBLA 1S0GA 2JKBA 3MW2A 4XIKA 5DUXA 1JW6A 3H0OA 3LSEA 1ENRA 1JUIA 4K1ZA 4XJUA 1GBGA 1I3HA 1WBLA 1AVBA 3ZYPA 3USUB 3ENRA 3R05A 5JOZA 4JCKA 2P2KA 1LJ7A 1Q8SA 2D6NA 2ZACA 1S0BA 2OVUA 2ZGRA 4LBQD 1HQLA 4P9YA 3L2YA 2JE7A 3N7MA 5GLVA 1G9CA 4DRRA 2JJ6A 1W0OA 2ZHMA 2PHUA 1QF3A 2UWAA 1GNHA 4JC1A 3OYWB 3B3QE 2R1DA 1W6MA 2GMEA 1LU1A 2ZHKA 1DQ4A 1W6NB 1ULEA 4FPGA 5CA6A 1JN2P 1DYKA 3OPZA 5DZFA 1DHKB 2A6WA 2ZGKA 5LK5A 1D2SA 3WCRA 3QCWA 1W6QB 3SISA 2A6XA 4PBPA 3ZSKA 5KXCA 1C1FA 3ZXLA 2DUQA 4ISRA 1ULCA 1CPMA 3IPVA 5DUUA 3FLPA 2CYFA 2R1BA 2VXRA 2YY1A 4Y1UA 2A5ZA 2E6VA 2D3SA 3O0XA 4Q1RA 5T55A 4AVSA 1KJRA 4WVVA 3FFZA 5EWSA 5GZEA 3T2TA 1Q8VA 5HCBA 1LHVA 3HN1A 2E7QA 1JYCA 3A4UA 1LTEA 3M2MA 5CNAA 1PZ8A 1JHNA 2RHPA 2ZBJA 1QOOA 1VLNA 3PVNA 1WBFA 4XHXA 1S0EA 3B01A 1CR7A 4FPHA 1H9PA 3WNXA 1V6LA 3D4KA 3ZXKA 5DG1A 2GNMA 3QLQA 2DVBA 4FOYA 2C9AA 2V5YA 1MS8A 5EXOA 4UW3A 1A8DA 2UURA 4XE9A 1SLBA 4M3CB 3B69A 3N3HA 2NMNA 1G8WA 4BQ1A 2XG3A 3POWA 4YM3A 4AGGA 4XHBA 1KQRA 2DVFA 3ZYRA 1MZ5A 1VALA 1W6PA 2A3WA 1OFSA 1LULA 4XMAA 1Q8QA 4CRQA 1V00A 3VKLA 4FQ4A 2Q5TA 3KQRA 2DU1A 3HR9A 1WCSA 3IPVB 4HANA 1YYNA 3M3OA 2ENRA 2R0FA 2DVDA 3PVOA 4Q2FA 5H9RA 3TAYA 1LEDA 4Y20B 2CTVA 1CN1A 2P37A 3AJYA 1DGLA 2EXKA 4P9XA 4F83A 1LESA 3PVEA 5KXEA 2WT0A 5GLWA 5L73A 3JUUA 3ZPYA 1MR5A 4JRAA 2ZGOA 1HQWA 1N3QA 4YW3A 1XQNA 4XMIA 2A6VA 5CB7A 2GDFA 1UZZA 1DFQA 2PHWA 1DQ0A 2A71A 2ZHLA 1GLHA 1CVNA 2DTYA 1AXYA 3WHUA 2G4IA 2ZGUA 1W6OA 2ZGNA 1ULDA 1A3KA 1GYKA 3WV6A 3WUDA 3T1LA 4R9CA 1AXZA 1Q8PA 2GALA 4OZXA 4XBLA 3ILRA 3AYAA 1BJQA 2WNEA 2ZAAA 3IKWA 1IOAA 2ZGLA 5E8AA 1DQ2A 3UJQA 2D6KA 2D7FA 3AYEA 1FX5A 1WD3A 3USUA 2ZGMA 4Q26A 1NLSA 2DTWA 3ZXFA 2W39A 1V6JA 1CJPA 1CPNA 2VW0A 3AJZA 2DVAA 3O5SA 4TYSA 1LODA 3RS6A 1QDCA 3WG1A 1F5FA 5H9QA 4XTPA 2OUHA 5JLVA 1N3OA 1R1ZA 2WJSA 2SBAA 1BZWA 4NO4A 1LCLA 1AJOA 4RL7A 1LENA 2AR6A 3TB0A 4BPZA 3N7KA 5IK8A 4YM0A 1DYPA 2GMPA 3ATGA 1JYIA 4FPKA 5JVVA 1DQ6A 1OQ1A 4XILA 1APNA 3BODA 4UW5A 2GN7A 1SLIA 4TZDA 1MS5A 1QDOA 5H9SA 3A0KA 2EXJA 1W0PA 4K21A 5E89A 4FP2A 3I4IA 3R4SA 3OGGA 3ZVXA 1B09A 3WG3A 1QGLA 1W6QA 1G9BA 3WDXA 3ZSLA 1HLCA 1GV9A 4PCRA 1LOEA 2PHFA 4IQPA 3ZXJA 5BYNA 1Y7BA 2CNAA 4XJ8A 2ZGQA 2WT2A 1FNZA 2W52A 4YFWA 2FMDA 5DXDA 2CY6A 3APBA 2VW1A 3DGTA 3NV4A 4XJ9A 3FLTA 3VKMA 4Z8BA 1MS4A 1Q56A 2JECA 2XB6C 3AP5A 1S0IA 4GWNA 5H9PA 2NZ9A 1YI7A 4LBNA 4Y1VA 1UMZA 2TEPA 2DVGA 1IKPA 1SLTA 4PQ9A 2GNDA 4BMEA 3SLIA 5JOXA 2AYHA 1LECA 1DBNA 1FNYA 4WZFA 3V0AA 4FOVA 1V6KA 4CZSA 5IK5A 3ZSJA 2ZGPA 3IM0A 4Q1PA 3V64A 1IS5A 1ULFA 1W6PB 3MW3A 4FPCA 5JDBA 2JE9A 1VAMA 4CTEA 3ILFA 4YGEA 1V6NA 3R4UA 3BOPA 3AX4A 1BYHA 2EF6A 1MZ6A 3AP9A 3C2UA 1SLAA 4RA0A 3OY8A 1GZ9A 4XDQA 5F5QA 1ZM1A 1QU0A 2A6ZA 1G9AA 1QOTA 1SLCA 2E7TA 3WLUA 2BQPA 3INAA 2YXSA 1LOAA 5GM0A
chains in the Genus database with same CATH superfamily
3K77A 4UYBA 1ND2A 1Q43A 2K0GA 2LW8A 2O1QA 4XPVA 4AHWA 1UMHA 1RUOA 1ONAA 4YM1A 4BLIA 3ZIWA 1KDMA 3LIHA 5FY5A 3HBZA 4EN7B 1JOBA 3LFIA 2HWD3 2WWJA 5FBJA 3AZXA 1W9YA 2RDSA 4IW3A 4BM8A 3I2DA 2PQSA 3NAPA 4QHOA 2XVKA 1LOGA 3DV8A 5DDJ2 2WZPP 2CAUA 3MFAA 1UIJA 2CGOA 1LR5A 4TLGA 3WOGA 2ES3A 2Z42A 1QY4A 3OPTA 4LBQA 5KXDA 3DF0A 1QMJA 4EN6B 2D44A 3HIFA 3MZHA 2Y6FA 5T5LA 5IWFA 2Z79A 4FPFA 1AL23 1ZA4A 4GIQA 2JENA 2FQPA 4XBNA 3RGBA 1ODMA 2BZDA 1YQ8A 4LA2A 3RFRA 1YRZA 2A7AA 2HWE2 5F7UA 1D0HA 4BQ3A 1HRV1 3R4DB 1S0CA 4HT1T 2R063 1DGRN 2YFZA 3ITQA 3P5BA 2W1UA 4LBQB 4P5YA 1GP4A 1RMU2 4C90A 3POYA 3I7DA 3IAQA 2SLIA 1X33A 3IIIA 1IG3A 5FK8A 3VHNA 1W2NA 4GKXA 3GBWA 2D97A 5FMCA 5FZ1A 3UETA 4YARA 5JOYA 3I2JA 2YGMA 4DZGA 1CJDA 1RINA 2LALA 4Y4RA 4LKDA 1CIWA 2HWF1 1XU1A 5A3UA 4KWLA 2VZTA 2O8QA 5J36A 1UOJA 3KWVA 4Y3OA 2Q1MA 1L7RA 2KA3A 2W68A 5LRSA 3AZVA 4XFHA 2OQ6A 1R1A3 1I5PA 4LO8A 2BNNA 1W6NA 3I8TA 3B94A 3RG0A 4G9SB 1XPWA 1Y9QA 4P9WA 3JZVA 2QQIA 3VL9A 4JGYB 1WD4A 1JMUB 4QX0A 3ZFGA 5A3NA 3AL5A 5FV3A 2HLEA 3TN93 2OS2A 4FXKB 1PO23 4L99A 3TEXA 5FYUA 1YQCA 2R49A 4K8RB 3H7YA 3O7OA 4N53A 3WQ1A 2XPJA 4IEZA 3B00A 4C1WA 4AFMA 1UY2A 3M3IA 4M3CA 4KBZA 4NRPA 2VZQA 2J1TA 1FMD3 2JDZA 3M1HA 4MX3A 1KFUL 3OG2A 5CBLA 5F9TA 2MPFA 3M3QA 5C71A 4YLZA 3WUCA 4QHZA 1S55A 2X29A 4L8QA 3OTFA 1SFYA 1AX2A 1UL9A 1A6CA 2ORXA 4AQSA 5CIRA 1YXWA 3OJBA 1JZ6A 2PHXA 4CE8A 3WDYA 3RJRA 2RDRA 2ZMKA 4NAMA 2A70A 1TVGA 4QX5A 5ANNA 2Y6KA 5FPVA 1C8M1 4XXPA 4HXCA 3CLPA 4XAEA 3S7EA 5LATA 4LHLA 4AK3A 3KM5A 3LA2A 1YFUA 4AE2A 1POV0 1J1TA 4H14A 4N43B 3DECA 3I97A 2VAUA 5DZEA 1F5JA 3T1MA 3NSTA 1KS4A 2DWRA 5FLHA 3CHXA 2QQPA 1OI6A 3UJOA 1CWPA 2UU8A 2XKPA 4RFRB 3UKNA 1ZRDA 3HNBM 4YW6A 3ELNA 4Q27A 1REDA 3P1IA 5C8CA 3WW2A 4QKFA 3HQRA 3O0WA 4M4RA 3N35A 2FMYA 1GKBA 2AEZA 4GB33 1XNTA 1AR63 2NP0A 3O0VA 1IS3A 4UBGA 4OMDA 5LEJA 2P3JA 4OLLA 4NHLA 3T4VA 5FPLA 3ZXAC 4XFAA 4YG6A 1RITA 4AF9A 3BKZA 3AYCA 4UAPA 3WSOA 4ZXKA 1WW4A 3E6CC 3E6BA 2VCMA 1PNFA 5T52A 3LEIA 4CCDA 4YG3A 4EN0A 1RIRA 2TUNA 1D2QA 4QX8A 3RZHA 1POV1 2IUWA 1UYPA 2NLRA 2RMU3 2ZA9A 3ORJA 1EY2A 4PQQA 3ZXDA 3BU7A 3T2QA 5C70A 5JXJA 3SQOA 4M0NA 4EN9B 2R073 2VL4A 2C1FA 1ND3A 5KXBA 3MEPA 4WBBA 5DDJ3 4EWDA 5ABJC 3UYJA 2XJSA 1SACA 1PO22 3USSA 4Q0PA 3VDBA 1EUUA 3AL6A 1VJ2A 2ARBA 2VCBA 4YW5A 3ZKUA 2XJQA 4E4HA 2QZ2A 4A6SA 2V4VA 4YVSC 1RJ8A 2P3YA 2DCYA 2YYOA 2PYTA 3DXTA 3MIEA 3WW4A 1R1A1 4M00A 4XETA 5GZCA 4FPLA 3NNJA 1OUSA 5FZ6A 1OBNA 3BTZA 3OPWA 4JTOA 3TYJA 1LEMA 2WZ8A 2HEVF 3D8CA 5CVRA 3B7MA 3NW4A 5C9AC 1AUYA 4IV3B 2WQ8A 1QJU1 2VNRA 4HFSA 1QHDA 4YVWC 1P8JA 2Z2SB 1VBD1 1J84A 3LA7A 4FI9A 3V0AB 1AF9A 2D6PA 5JI9A 2XLAA 1NY71 5HCAA 4FAGA 4V2WA 1CZTA 5SV8A 1OA3A 4WM7C 2E32A 1IKQA 1POQA 1YQ2A 3ASIA 4SLIA 4CEYA 2XKOA 4AYUA 5BNPC 5GZGA 2B39A 3VBSB 3A7QA 1V6OA 3ZFEA 1NKGA 4AVVA 3OUHA 4FPYA 4Y5TA 2QNKA 3A22A 5F3GA 5JSPA 4QPIA 2IZWA 3ZO0B 3JBG1 2B9VA 4YW2A 1MQTC 3N36A 4ZZ8A 1UX6A 2DUPA 1K42A 4W4ZA 3IN9A 3SCGA 4BXFA 4L0PA 4D7YA 1VIWB 5IVFA 2VQAA 2B4KA 2G19A 3Q8AA 1AR62 2D43A 2DUOA 5CYYA 4D94A 3ZYGA 1V0AA 2NMOA 4FPEA 3SXWA 2ZZJA 3SITA 2VVFA 3AK0A 2R042 2VH9A 1FPN1 4COUA 1REEA 2KM2A 3BYWA 5GJ6A 4AVTA 3UNPA 4BCUA 2UWCA 3X29B 1G9DA 4KG0A 3SCHA 3VZJA 1IQDC 2NQYA 4HPKB 3ZFGC 5C5UA 2C9KA 4LLOA 4CCLA 3CKHA 5JXIA 4IEYA 5FP3A 3GYDA 3HNMA 3CJIB 3VZNA 4CUAA 4BQXA 3M3CA 4YGDA 1AR92 3PTRB 1J59A 3VBUC 3OYWA 2XQRA 3N9NA 4CCEA 4MHUA 1FV2A 1HB3A 1DZRA 3C8XA 3WCSA 3U10A 4E8CA 5A1FA 5BNOB 1IPKA 1GZWB 5LBCA 1LRHA 1FV3A 3GBGA 4LBLA 4E8DA 4E2GA 2OPKA 2KR2A 1BBT1 4PLNA 1SFPA 2IVJA 2K9ZA 1ULOA 4HVRA 1ENRA 4LO6B 1JU3A 1WBLA 3N9PA 3ZYPA 2DBNA 3ENRA 1GOGA 3C7FA 3R05A 5FMBA 4E2SA 5JOZA 5A1AA 3W5NA 5F3IA 2P2KA 1Z7S2 4W6WA 1KGYA 2XL7A 2XUMA 3IDCB 4GZ9A 1Q8SA 3SKJE 2D6NA 1HXS2 1S0BA 2OVUA 5HV0A 1UYZA 3ZMOA 3KQ4B 5A6ZA 3POIA 2FD8A 1W0OA 2ZHMA 4FO9A 2GZWA 4GD4A 2V72A 2JG8B 2UWAA 4HN0A 1O3TA 2VJXA 1QXJA 1I5ZA 4AAXA 4YVWA 1M06G 4C0HA 1UCXA 3U78A 4N43C 1LAJA 3VBHB 4DEQA 5A70A 1GOFA 3MFCA 3WNMA 2HWB2 4QWNA 3RNSA 5FO7B 3OPZA 1TMF2 4UOJA 1A8MA 1VBD3 1PMHX 2RJLA 4CDWA 4LIVA 3QCWA 2BUKA 3VBOA 1NG0A 2G1MA 3J7HA 4NAOA 4PBPA 2QQNA 3ZSKA 4I0WB 4ISRA 1CPMA 5DUUA 5FZHA 5C3OA 2CYFA 1HRV2 1AR91 2VXRA 2YY1A 4UWDA 2E6VA 4KMQA 4Y1UA 4CPBD 3O1SA 5T55A 2VXJA 1KJRA 3VN4A 4IGQA 1OF3A 1LHVA 1XNBA 1W8OA 3VBOB 5FPXA 1ZNPA 3VBSC 1US3A 3VD7A 1WCKA 2XH6A 4AVCA 1NE6A 1GU3A 1JUHA 4CU9A 3WQBA 3KT1A 1F4HA 1VLNA 3PVNA 4XHXA 5HBAA 4LE3A 2VOWA 1DZTA 4N9IA 1H9PA 1JZ4A 1MS8A 1YFWA 4AR2A 1R092 2UURA 4E9KA 3AKPA 5J09A 2NMNA 3JD73 2J1EA 5BNNB 1G8WA 2IFRA 1ZBA1 2BVBA 2XOMA 5EV7A 4BQ1A 4QPGB 5C9AB 1RVF1 4YM3A 3CMGA 1MZ5A 5I0TA 4FQ4A 2Q5TA 2VO5A 2JDKA 1VB2A 1WCSA 2HKXA 3E97A 4HANA 1YYNA 4LKEA 1QXPA 4META 4HKLA 4S2FA 4QXKA 4Q2FA 2R0FA 3UKTA 3I3EA 5I8YA 5FPUA 1VB4A 2XVLA 2YC2A 4XFBA 1GQHA 1CN1A 3AJYA 1NY72 5IJRA 4NWWA 3LKJA 1HJGA 3TEWA 4XC9A 2P6HA 3PVEA 4I2OA 1FOD1 2A1XA 4QAWA 4QX2A 1MR5A 4LJHA 5EJ3A 5GLWA 5L73A 4DEVA 2QQJA 2Q1ZB 1C5IA 4IE4A 4JKKA 2GDFA 2QQLA 1BK0A 2YBPA 2VOVA 5CB7A 2PHWA 5F5AA 3ZYJB 4Q4V3 1GLHA 3EYPA 2DTYA 3IMMA 2ZGUA 3U11A 4Q0UA 1K5JA 1ZRRA 4W8JA 3BU0A 1VR3A 3K75B 3J7LA 3AC0A 2PLV1 4NIDA 3ILRA 3AYAA 1WMXA 5T3NA 1IOAA 1JH5A 1EV13 5A3OA 4MG2A 2D7FA 3USUA 2QQOA 4DUXA 4Q26A 5HV4A 3SCFA 3EMRA 3CF6E 1V6JA 4TXWA 4UFMA 5A33A 1RUD1 3AJZA 2D93A 3BVCA 3KGZA 3O5SA 2BOJA 4I3GA 4TYSA 2IVIB 5F8PA 5FMDA 3RS6A 4BWOA 5JMOA 3I49A 2OUHA 2WJSA 3I3DA 2OX0A 4NO4A 4HMZA 1YC61 3BPZA 5FYHA 4BPZA 2AR6A 4CP9A 1V9U1 4NE9A 2JG8A 2P5BA 1DYPA 4O9EA 3WF4A 1AYM2 1AYN2 2VNOA 4RQPB 1AR61 4OQ8A 4HKOA 4XUNA 2QZ3A 1J3RA 2EXJA 1W0PA 2GSYA 4K21A 3I4IA 4G4FA 1FPN3 3CJIC 3WDXA 3WP6A 4PCRA 3HVDA 1LOEA 1EAH2 4NVPA 5FZ3A 3U4SA 4QQHA 3WP4A 2Q0AA 2PHFA 1RUH1 3IDEA 4CCJA 3AMNA 3ZYHA 3KV4A 4CDQB 2JD9A 1BEV2 1GQGA 1FMD2 4YFWA 5FYMA 3SEPA 1U5IA 1XXNA 5DXDA 5FXZA 4UXAA 5FZDA 1F8VA 3NV4A 3DPRA 4XJ9A 3FLTA 3VKMA 2WUHA 2XB6C 1S0IA 3AKSA 2WYSA 2NZ9A 2VNVA 2ZEWA 1W2OA 1VRH2 1SLTA 1YFYA 2ARCA 4BK4A 1E5IA 3N9LA 2OQ7A 1RUF1 1OSGA 2JX9A 2VVDA 2WN2A 1AYM1 3DPRB 5I8SA 3ZDSA 1CAXB 1OA2A 1WA6X 2AYHA 4MH0E 2QKDA 3E5UA 1DBNA 4OYUA 2MEV2 4EJRA 4WZFA 5JZGC 3IZOA 4FOVA 4AG4A 1V6KA 4IETA 1JYNA 4NIGA 3DYPA 1UIKA 2A73B 3V64A 1IS5A 1R1A2 2QVSB 2JE9A 2GC0A 1E5SA 1KXGA 3ILFA 4YGEA 5B4XA 4LULA 5FYIA 4WM7B 3HJRA 3ZM8A 3NJXA 2C26A 1PX4A 4CXXA 1OA4A 2I45A 2HEWF 4L9BA 4RA0A 4QPIB 4Q5OA 5CFDB 5HXMA 5F5QA 2P4EA 3NAPC 2ET7A 5FYVA 1BHGA 4QX7A 3VHOA 1TME3 1YUDA 2H6CA 2RS33 3AXEA 5C4WB 5F2SA 1S2EA 1RUI2 4W50A 2R16A 1HKDA 2JB8A 1D7PM 2YROA 1H30A 3RI9A 3MPBA 4P9JA 2P3IA 4JAAA 4K7JA 2JIJA 1YFXA 4UF0A 1X8EA 2D5FA 4XAAA 1SDWA 3NV1A 1XC6A 2E26A 4WM8B 1NOVA 1EUTA 1SG3A 2XJUA 3W5MA 1PIV2 3CQOA 5LASA 4RS5A 3AZYA 5F2WA 4YVSB 4I30A 4NPRA 3LWCA 5F39A 3S6PA 3T09A 3S5AA 3Q8CA 2QFEA 3L2HA 1H6XA 1KRIA 3GM8A 1XE0A 4IE5A 3LDBA 4COVA 2N7GA 4OHXA 4F8AA 1EV11 5ABJB 2VZSA 1UOFA 3NKTA 3NO8A 2VZOA 4KNCA 3I3QA 4JGYA 4ASKA 1B35A 2YU2A 2MEV1 1W6MB 5APAA 4B7EA 4Q4V2 5KHHA 5LCWL 5DUWA 2ORZA 4N7IA 4BMBA 1ZBA2 4XCBA 5FZGA 2FHRA 2VTFA 4Q4X3 4Z1VA 1MVQA 5A3MA 5J7MA 2BFUL 2XBO2 3MICA 4GQ7A 2D6OX 2VD7A 3WHTA 4AHYA 1GUIA 2YB7A 3OB8A 4K3UA 1FAYA 5JXGA 1AR82 3H1YA 4LMFA 4AHZA 5K0UA 5FBZA 3NKGA 2BPA2 1X9PA 1OLME 3MPPG 2WS93 1W0NA 1T6GC 2HH9A 1EV12 3C3VA 3RI8A 3FBYA 4YPJA 4ZKTB 4PHZA 1H0BA 1HJFA 3BOWA 4DY5A 1FATA 1Y3TA 3VKOA 2BGCA 2P17A 4X8NA 1RUH2 1QJZA 1UOGA 1UZYA 5C3QA 3HNYM 5M0TA 3I3BA 1UWWA 4IDZA 1K5MA 2BV4A 3BB6A 5A6XA 2GN3A 3JU9A 4XDPA 3LFMA 1Z7S3 2P1BA 3MYXA 3ZN6A 1TMF1 3JB4C 4GMP0 1HQNA 1VBC3 3KD4A 2DCKA 1QKQA 3B9CA 4X6RB 4XOGA 4YGBA 3AYDA 2A6YA 1H2NA 2LTNA 4D6RA 4QQ2A 1RHI2 1ZRFA 1RUJ2 3GNEA 1AX1A 4PBOA 1RUE1 4LUMA 4GALA 3AMHA 5JPMB 5GALA 1Q8OA 2VMFA 5DZGA 2C5DA 2PN5A 2DCTA 3K3NA 2EIEA 1JYVA 2FZ2A 4L92A 4TWTA 4OI4A 4N8MA 4Q4Y3 4BIFA 5T5PA 3KHCA 1TME2 3C7EA 1YNAA 2JXAA 3P3PA 3AZZA 4AGVA 3TEZA 2VMEA 4HOOA 4LXLA 1LGCA 3LPFA 2WN3A 1LOFA 2O0OA 4GA9A 2FCVA 3RPQA 4URTA 1WLWA 3I59B 1EP0A 2HYXA 1S0JA 1OKQA 1BBT2 1D4M3 1RUG1 1PVC3 2VBDA 3ACIA 3B93A 5T5OA 3VDCA 4PDWA 3PMEA 3ZR5A 1JOJA 3KCYA 4LO5B 4EYUA 3RZLA 2BWCA 4LBOA 3VD9A 5D8AB 2AACA 3SMHA 4LT5A 2HWE1 3VBUA 2ZX2A 1B35C 1IHMA 1C4RA 3GCWA 4OFGA 5FJHA 4C0BA 5LY2A 1KDKA 4MV2A 1VBE2 1WMDA 2RS13 3AKQA 2WLQA 4WZCA 5C3RA 1MQTA 2VQUA 3KV9A 5JAXA 1J1LA 4QXBA 2PELA 1W6OB 2UYAA 4Z82A 2W3JA 1S0FA 2JKXA 2R6QA 4GH4A 4L2NA 3WQ7A 5J1XA 4CU6A 2IFWA 5K4LA 2PHTA 1MS9A 4CDQA 3GCXA 1LHNA 3PUAA 3AKTA 2D3PA 2HWD2 3HT1A 2VTXJ 4GWIA 3OUIA 3UGFA 3VHPA 2EIGA 1PVC2 4IEQA 1NE4A 4ASMB 3WDUA 1W2AX 3T30A 1QJY2 1WW5A 2JDAA 3LEMA 2WZR3 3RYRA 3MO4A 4L11A 5FIXA 5FQ0A 4K6BA 1G9FA 2CGNA 4FAHA 4YZ5A 5DG2A 3D0SA 1SEFA 3ABZA 3D6EA 1H1IA 1PMIA 1H1MA 4LA3A 3VUOA 1UW8A 2HWC2 2WR9A 3KS7A 4WVMB 4NIIA 1Q5OA 4PJYA 3IMNA 1WLCA 3ZFFB 2ZZQA 3WDWA 2GC2A 3J26N 2VY0A 3TN92 3O12A 4QQOA 5JWPA 5HI0A 1OUXA 1MS0A 1N47A 3OD4A 1VBC1 5I0UA 4RQPA 2ADEA 4GXLA 1AXKA 4CDUC 3PMSA 2VOTA 2BEOA 4DS0A 3D82A 5IT6A 2VBBA 3E6DA 5A1LA 4AFCA 4XQDA 3J8F1 1RUG2 1YQ5A 5JPNB 4YYOA 2EAKA 2NN8A 5FPBA 5CEHA 3OEBA 2Y64A 4AAPA 1UU6A 2CAVA 2OZ6A 2YV8A 1BKZA 2ERFA 1PGW2 2IXIA 1R081 5I8TA 5DAWA 3VBRA 1E5RA 1LOCA 4M3CE 1ZZ8A 4EQVA 5HCFA 2GNBA 1UZVA 2VUCA 4K8FA 4N43A 1AYN3 2B42B 2BWAA 1GSLA 2YDEA 4PDWC 4DXRA 3W9AA 4CCNA 5AC92 1RB8G 2W1QA 2Q8EA 4BLJA 1XYOA 3OBRA 3U14A 3ZYIB 4AL9A 1RUF3 1PIV3 1YQ6A 1OPMA 3OD0A 4MUVA 4XIOA 4K20A 1RHI1 1QQP1 2GNTA 4GB32 5FXVA 4YZ2A 1ENQA 1CAVA 1NT0A 2FDFA 4CRQA 5DUVA 4FPJA 1W8ZA 2P34A 1IPSA 1CX1A 4JKMA 4ARXA 2WS91 3HPNA 1DQ1A 2Y6HA 1KFXL 4LO7A 5CAZA 1GMMA 5I91A 1KITA 4AGRA 2VULA 5F6LB 2YFUA 3VBUB 3KZ4C 1NUKA 5A3TA 2WAAA 4QGNA 4HG6B 2BBVA 1PZ9A 2DURA 1GICA 1JS9A 4WVWA 4Y26A 3THCA 4BXSV 4YFZA 5FWJA 3SH4A 4V2VA 1WCQA 2F17A 4GJZA 4JGZB 2D40A 1UN1A 2ZEYA 4LPLA 4XTMA 3W21A 3NNGA 2JG9B 2X5IC 1FXZA 1QQP3 3PTYA 5FPZA 2PA7A 1ND3B 3RZMA 3W59A 3LOIA 1LOBA 5BNNA 3K4AA 5AC93 3FHQA 3AFKA 4AI2A 4ZS2A 1G86A 1OLRA 1PGSA 3ACGA 5A7NA 4CUBA 3ZXGA 5BUVA 1JYWA 5FZLA 1CAWA 3EXUA 4Y5Z0 1UY3A 2Y34A 3MW2A 1LB2A 1C8M2 4K1ZA 1JUIA 5FQ0B 2DFBA 1GBGA 5L7OA 1HRV3 2BGPA 3I2IA 1VMFA 4QB1A 3WNNA 2Z4FA 2L9LA 4QQLA 2VZPA 1BEV3 1WCUA 3MV11 5FY9A 1LJ7A 4FT8A 5F3CA 3OGRA 2ZACA 3VD4A 1CZSA 3AMQA 3L2YA 2JE7A 1G9CA 4DRRA 4FFGA 4CDWC 3IDAA 4XURA 4IV1B 3VBFA 1C28A 4JC1A 5DAQA 3OYWB 3LZZA 2ZX4A 5ACA2 3VBRC 1JZ5A 4CP0A 1E57A 4LORA 5FY4A 3BIEA 3LIGA 1PM7A 1LU1A 1H2LA 5LW9A 2ZHKA 2W87A 3LGRA 4JHTA 1C3HA 1DQ4A 4COYA 1W6NB 2R30A 2FDHA 4IGOA 4FPGA 4AZZA 1DYKA 3ZIXA 3VBFB 3PUHA 5FOJB 1D2SA 3SISA 1W6QB 2YU1A 2Y6GA 5F6KA 2A6XA 5E1RA 4NIHA 4FTBA 1H4HA 4KQ7A 4W6XA 4EROA 5K0UB 3M4FA 1ULCA 4MXVA 5E16A 4TLFA 3CDZB 1XB9A 4Q4V1 2R1BA 4SBVA 5ISLA 4NR1A 2J22A 3FFZA 4WVVA 5IVCA 1Q8VA 2HWE3 5HCBA 4IL7A 4RSUA 4RYDA 2R062 3IT8A 1LTEA 3IAPA 4XF4A 3ZSEA 5CNAA 4E2QA 3WY6A 1JHNA 1F4AA 1DCSA 2W2IA 3N9MA 4MZUA 1KEXA 2WFF3 4D7SA 1QOOA 4IE0A 1WBFA 4MOAA 2QBXA 5K9YA 4MHRA 3WNXA 1EAH3 1V6LA 1U5ZA 2RDNA 3ZXKA 4EZHA 5DG1A 5ACA3 2GNMA 3QLQA 4D6QA 1AR83 4UW3A 2Z5WA 5FUNA 3FX3A 5F37A 1HRI3 3MI8A 1RMU1 4LLFA 3POWA 2P6CA 2JIGA 2VCAA 4AGGA 3K4ZA 4NRQA 2DVFA 3URFA 1W9TA 1H8TC 1QQP2 1US2A 1VALA 1W6PA 4GB31 1Q8QA 3VKLA 1ASJ3 1W39A 3LDKA 3MIBA 4LHNA 5LA0A 2DDUA 2TNFA 4LQRA 5EJZB 4AQTA 3N9OA 3M3OA 2ENRA 3IDBB 1PO11 3HAGA 1MEC2 5FP8A 3S57A 4HETA 4Y20B 5FY7A 1JODA 1SMVA 1TQ5A 2EXKA 4MGZE 4P9XA 5L7OC 5KXEA 3K4DA 1QJX3 2WT0A 4J6GA 3JUUA 3ZPYA 4XZUG 2WFF2 2ZGOA 5JR2A 4YW3A 1DF0A 3MIGA 5A7WA 3C7GA 3KT7A 1PVXA 2ZHLA 3MBWA 3OF1A 1NA1B 2G4IA 2ZGNA 4P9GA 3FFQA 2DFCA 5BNPA 3TOJA 2E33A 2YPJA 3QD6A 5J48A 2EA7A 3JD72 4WM7A 4OZXA 2XBO3 2VMHA 1Y43B 3OBAA 4OHZA 1YHFA 2ZAAA 4N7UA 4RHV3 3IKWA 4JKLA 1DQ2A 1YJKA 1K45A 3AYEA 1NLSA 2XL9A 2YGLA 4OI2A 3WP5A 3VL8A 3WX5A 3ZXFA 2PQQA 4CU8A 5IAXA 3PNAA 5LWBA 3GF6A 3FJSA 1OLMA 1QDCA 4E4DX 5D1IA 4LKFA 1HN1A 2FZ1A 3KCCA 1F5FA 2BYVE 4XTPA 1WA4A 1N3OA 1PO12 1R1ZA 1U5XA 1UYYA 1JU4A 5FYZA 3OEAA 2GH2A 4YM0A 3VDAA 3ATGA 4RGAA 5JVVA 4LNVA 1DQ6A 2WNUA 1O3QA 4CSWA 3OGJA 4RR3B 2GN7A 1RHI3 2GP5A 5JDBA 5HCHA 4UFKA 1VE0A 1MS5A 4OHWA 4OQ9A 1ZX5A 4CPBA 3A0KA 2Y6JA 5KHKA 1J83A 2D98A 5FMOS 3OGGA 3ZVXA 1G9BA 1QGLA 1W6QA 2XWBB 3FHIB 1GZTA 2WFPA 3DKWA 1UX7A 4MGTA 1FOD2 2PMWB 1DGWX 4Y5SA 1NCRA 1ZBA3 1JTZX 5BYNA 1Y7BA 3GXUA 4QPGA 4XJ8A 2ZGQA 2O14A 5IVBA 5FZ4A 3WNOA 3DL3A 2W52A 2IXKA 4IE6A 2FMDA 4M4PA 2YHJA 1ASJ2 4DNYA 5FY8A 5DQ0A 4CCCA 3APBA 5A7QA 2JICA 2WO3A 2VW1A 3ZYFA 1QWRA 3U1XA 1H8VA 5FUPA 4CDXB 3E1F1 3JBG3 1MS4A 4A3XA 3AP5A 1COV3 5FDBA 4LBNA 1YI7A 1UMZA 4BQ4A 3CU7A 1RL3A 4I0BA 5IFPA 4CXYA 4PQ9A 1NCQA 2WABA 1JZ2A 2HWC3 2XJVA 1RXGA 3ZX7A 3ZFEC 4BMEA 3SLIA 1PK6C 1Y9MA 1AR93 3RYPA 1T2XA 3CJXA 4RS5B 1FNYA 1CAXA 4UFJA 4CZSA 1RYYA 3TWIA 5C8CB 2AEYA 5CU1A 5IK5A 2RDQA 2ZGPA 3IM0A 4XDOA 4Q1PA 4P02B 3SKVA 1NCQB 1ULFA 1O7FA 1W6PB 3MGUA 4FPCA 5A3WA 3RWNA 3TBDA 1XYPA 2Y60A 3ACLA 3PIGA 4A45A 4CTEA 1O3SA 3K2OA 1BYHA 5ERLA 1MZ6A 2OIIA 3KVAA 4I0AA 2HWC1 2LM3A 5A7SA 4B1MA 5JSOA 1QXRA 1GZ9A 4PIYA 4FFIA 1QU0A 2A6ZA 1G9AA 2VE1A 4NPMA 3KV5A 1QOTA 4IUGA 4LO4B 5A32B 1W8FA 3WLUA 4Y4YA 3Q8EA 3INAA 1WD3A 1LOAA 2WO7A 4WV8A 5LRRA 2OT7A 4TSVA 2JG9A 1OT5A 1V6IA 3N9QA 4GH4B 3ACHA 3GZEA 3HN3A 4Q0VA 4IESA 3ZFEB 1W28A 5I0RA 3MUZ1 3OBZA 4N53B 1CESA 4LOSA 1UU4A 3IBMA 4OVEA 5FZAA 3J7MA 1OMIA 5FO8B 4AVBA 3PIJA 1GWMA 2ZPXA 3A23A 5FXWA 1JBCA 2PAKA 2BRTA 3K3OA 4FCAA 2YC0A 1OPOA 1O4TA 5FPAA 4AXOA 5L9VA 4E4ZA 2QCSB 1F31A 1SBEA 2A75A 4H3WA 3RMXA 1AR72 1VBA3 1H8TA 3ROUA 3UESA 3KSCA 4L97A 4PLMA 4HL0A 4Y33A 3H3LA 2A3YA 3UGGA 4AWDA 4P00B 4Y24A 1SCSA 1UAIA 2W0XA 3EBRA 2VVEA 5FP7A 5LZ6A 3PUSA 2IXJA 3T08A 1GNYA 1K5MB 4BQ2A 2E9QA 5I0DA 4QPYA 4YSFA 3ZYBA 1UPSA 2ZABA 2VECA 4A6OA 4YM2A 2HJIA 1WZXA 1STMA 2D5HA 2JEMA 2WBKA 3AKRA 4MXWB 4IERA 3PDQA 4D7TA 5I93A 4NOTA 3V0BA 5FZKA 4O61A 3WVJA 2VR4A 1W8TA 3KVBA 3WQ0A 5EYYA 4ATFA 3LSDA 4ISQA 1XOYA 5LA1A 2Y0OA 5FK7A 5FMOL 1CAUA 4MVTA 1ASJ1 4O65A 3VKNA 1OH3A 4ATEA 1R64A 2VGDA 3KMHA 5GLTA 1DLCA 1W2UA 2QQVA 4LITA 4LR4A 1A78A 1MACA 2H0VA 1BQPA 1C57A 3I54A 5DAPA 5CFCB 1PIV1 4FOQA 1ZBE2 1LGBA 3PUQA 4NMIA 4AEDB 1HV1A 4P9LA 1OURA 1HN0A 2RJKA 1UNBA 2XLFA 2Y6LA 1XE7A 3OGSA 4P9IA 1K3IA 1REFA 1J3QA 4FQZA 3HQXA 5FZOB 2W91A 2ZS6B 1DYOA 3ST7A 4OULA 4NHMA 4URAA 3DKQA 4OUMA 2AREA 4Y22A 4BU2A 1UY1A 3L9JT 3ETPA 1RUE3 4P08A 1RJ7A 2PTMA 2R0HA 3VD5A 1PMJX 5FOBB 4BHPA 3BI3A 1MS1A 5F5IA 4RHV1 2VMGA 1UKGA 4KWKA 5IATA 3U75A 5AFEA 3RSJA 4RGGA 1HIXA 1WLDA 1OXCA 3JCIA 4KGGA 2DYCA 2IXHA 4OHVA 4Z2AA 2WZEA 3GDBA 1TNFA 1D0GA 3U07A 1WWYA 5BV6A 3OCPA 1TEIA 2WA4A 1IGOA 1OD5A 5LK7B 5IVVA 4BOWA 1UKRA 3WG2A 4Z2WA 3S5QA 1SPPB 1SBDA 4GWMA 2XONA 1AR81 1Q3EA 4R8HA 3VDDA 4JZRA 1VMJA 2X5IA 3SEEA 1QJY1 5CKQA 2RMU2 4LHKA 1UQXA 1JXNA 3POSA 3N7LA 2B5HA 1VBB3 2IXLA 2VU9A 4YW4A 3U4XA 1AR73 1URXA 2K2SA 4DY3A 4H7MA 4BDVB 2AENA 2WNOA 2VQTA 4MGQA 2RVAA 4HSLA 1EYBA 4D0QA 3E5QA 3FUOA 2CWSA 3W58A 4BH9A 5KWRA 3T0DA 1PK6A 1WGPA 2DCZA 3H1WA 3M7AA 4UF0B 2WNUB 1NCQC 4QU1A 4MGSA 2ZXQA 3N7JA 3UL2A 3ZN4A 1WUVA 1GZWA 3HQUA 1DLLA 2E7AA 2J1AA 4KBBA 3WZ1A 1JI6A 1OQDA 3ZDVA 2JE8A 1PK6B 2DV9A 4XBQA 2CL2A 1F15A 5A32A 5A33B 1MVEA 1CZVA 2WS92 2YBSA 3AP4A 2I07B 1LGNA 4QMAA 1ENSA 3WXPA 4EN8B 3VBFC 2YZ4A 3NJZA 4W65A 2QDNA 4YZ3A 2C4XA 1QJX2 3RRDA 3FN9A 3AP7A 1QH7A 4N90A 1OKOA 5FXXA 4GMP3 3LD8A 3T0AA 4CDUA 3ALQA 3PUIA 2ZMLA 4S2HA 5LBEA 4ES9A 5AC91 4H2AA 1K12A 3NQHA 3RQ0A 1RUD2 5E6HA 3LF7A 4RR3A 4F3JA 1IZ3A 4I09A 3DXUA 3SNMA 3T0BA 2NM1A 3TEYA 4U36A 4ZPIA 3VV1A 3CJIA 5JIUA 1S1AA 1AJKA 2RR13 2RS53 2PXJA 3IWZA 2JD4A 1HB1A 3U37A 3VBHA 1PZ7A 4NHXA 4UI9L 1N1TA 1O4YA 1PO21 1RUJ3 2V5DA 2Y8KA 3LOBA 1G7YA 5IYYA 1JYXA 4ZONA 3PL0A 1OQEA 1RMU3 2E63A 2F6BA 3AXDA 1GZCA 3J8F2 4A7KA 1C5HA 2RMU1 3POBA 1LHWA 4LBJA 4DRVA 1RUC1 2EALA 2EXIA 3DPRC 3OOXA 2B45X 1VRH1 4CEYB 5EJ1B 5KBFA 3HOBA 2WO1A 4PLOA 1TZOA 2NPIA 4Q4Y2 1ZVFA 3ZSMA 1ULGA 2ZGTA 4AEKA 4QDRA 4WVMA 4B1LA 3VDDC 4IEUA 3Q8FA 1OC1A 5FLIA 3TN91 4Q8KA 5FZ0A 2ZX1A 3LQCA 4I3PA 1VBA1 5IK7A 3NJYA 5JOWA 1ZBE3 3QH7A 4IE7A 1FMD1 1BVP1 1SBFA 4JVAA 1UXZA 4KU8A 3VZOA 3ZN6B 4FBFA 4FSJA 2XUEA 4XJAA 3KT4A 5CG8A 3T2OA 2QE3A 1RUC3 2ZOEB 2PAEA 3AP6A 3KLSA 3TNQA 4HVQA 4M3CF 1SQ4A 3W20A 2V4AA 2AH2A 2XGXA 2OW4A 4XF9A 1YJLA 3RJ2X 5FY0A 2CU5A 3WF1A 1CONA 2J1VA 4Q29A 4Q8LA 1O4ZA 1ACCA 1DQ5A 4Y20A 3CZUA 3P6BA 1S0DA 4Q4W3 4AEMA 2XBO1 2CV6A 1N1VA 2XJPA 1L7QA 4GH4C 2X8KA 5A80A 1SZBA 3PHMA 1NXD1 1PNGA 2CDOA 4QQPA 1GNZA 2GP3A 1H6YA 4YW1A 4NWVA 5DAVA 1BMV2 1ZZ6A 3UV9A 1X50A 4K1YA 4OCTA 4MSVA 3A0NA 4LBMA 2MHFA 4ZXEA 2WT1A 4KL1A 4DXZA 3MF9A 3MIFA 4XUTA 4Y22B 5D8AA 3I2GA 1GP5A 2X05A 2HWF3 2QQMA 4D6SA 5FUIA 3NNMA 4JX0A 1DG6A 4EZ4A 1JZ3A 1NX9A 2VG9A 1F2NA 1YIFA 3BN6A 3HMYA 3LCPA 1HW5A 3HBKA 4NHYA 5C8CC 3UGHA 2BNMA 3Q9OA 2WA3A 5EP9A 4RS5C 1S0GA 2JKBA 4AQ2A 4JHZA 4JV4A 4XIKA 2CGPA 1JW6A 3H0OA 3LSEA 4A7ZA 4XJUA 5KC6A 5LBBA 1I3HA 2QQKA 2ADDA 4O7XA 4Q0QA 3USUB 2RM23 4JCKA 4JGZA 4OUSA 5EHDA 4AFAA 4ZU4A 1OOPC 4P5HA 4HBNA 1W05A 4QXHA 2W1SA 4QDSA 4X8PA 2FCUA 2R043 1XRUA 3HEIA 1HQLA 1H1AA 3N7MA 5KHIA 1SDDB 2JJ6A 2R071 1VMHA 2PHUA 2W92A 3DN7A 4UT5A 1GNHA 5DDJ1 3LB9A 1W9WA 1ZYBA 2BP6A 3B3QE 2R1DA 1UU5A 2W9XA 1OVSA 3MUY1 3H50A 4PT6A 1OOPA 2VNGA 4QB6A 3UKVA 4XFFA 5KR7A 2XJTA 1QEXA 3BALA 3F2ZA 1ZREA 1ULEA 5CA6A 4XABA 4ONUA 4HK9A 1J3PA 2C0ZA 1GOHA 2W5FA 4CCOA 1U5YA 2XDVA 1YI9A 2A6WA 4NHKA 2RR11 2RS51 1ENXA 5LK5A 3E5XA 5IW0A 3H8RA 3CEWA 1C1FA 3ZXLA 1QJFA 2DUQA 3IPVA 5D21A 4XVHA 1VBB1 1X8MA 1TG7A 2A5ZA 1DGRA 1ND2C 2D3SA 3O0XA 4IV1C 4Q1RA 5CKMA 3T2TA 5GZEA 3H42B 5FKBA 5FYCA 5LB6A 4LE4A 4XFGA 1NAEA 2E7QA 5J98B 1JYCA 2Z69A 3B02A 2GC3A 1JYTA 4I02A 5FZIA 4B8EA 2ZBJA 1BK1A 3GJBA 4QHBA 1FPN2 3EQEA 1ZRCA 1CR7A 2G9FA 2UY8A 1U12A 2J42A 3EHKA 4QKBA 2BW8A 2ZTNA 4MO3M 4FOYA 2V5YA 5EIYB 2E31A 5FZOA 5EXOA 3H7JA 2XR4A 1J58A 1A8DA 1POV3 1SHWB 3GGLA 3P3NA 4LHSA 1PVC1 1SLBA 2JDPA 4M3CB 3B69A 4XE9A 4XW3A 4OZOA 5C8WA 4TTGA 4CEYC 1I9RA 4G3YC 2XG3A 1C8NA 1UOBA 1ODNA 1QH6A 4WM8A 5FZ8A 1D4VB 4AEDC 1OFSA 2ZEZA 1LULA 3AFGA 4XMAA 1V00A 5EFUA 4AW7A 4E4SA 1ZZ7A 3KQRA 2DU1A 3KB5A 4KG8A 4F7ZA 4C8DA 5JIAA 3C7OA 4LK7A 2Q8DA 3TAYA 5L7OB 4K9SA 2ETEA 2CTVA 2P37A 1PO13 1VPHA 1DGLA 2R072 2WIIB 4HKWA 5FJKA 4HLTA 5DMYA 1ND2B 3AVSA 4EE2A 4F83A 1UF2C 5A3LA 5JCTA 4V1PA 5A7PA 4JRAA 2VZVA 1HQWA 1N3QA 1Z7S1 4UFIA 5BNOA 4XMIA 2A6VA 1UZZA 1X9TA 4A7YA 1DQ0A 2RM22 4BQYA 1CVNA 4EV0A 2XXZA 3WHUA 1HXS3 1O8PA 1W6OA 3AVRA 1ULDA 1JZ7A 4OI1A 3BGAA 4XF1A 3WUDA 1W8WA 3T1LA 3ZKYA 1AXZA 2GALA 1I6XA 5JXHA 1NCRB 1UD1A 3O1OA 2QQWA 1BJQA 1JZ8A 3O1MA 1GQPA 4NJ4A 2ZGLA 5E8AA 5BNOC 4JTNA 3AMMA 3UJQA 4Q0SA 2ZGMA 2DTWA 1W8UA 4XUPA 2YBKA 4HSJA 3BCWA 2VQ0A 4BA6A 2GAUA 1CJPA 1CPNA 4JDNA 4A3ZA 1LODA 4IXLA 3POFA 4LKSA 4NRMA 1O8SA 5H9QA 1OOPB 4Q4X1 4D3WA 3ZLIA 4O9GA 4IEOA 4PI2A 1LCLA 5FTTC 2R041 3TB0A 1OLQA 4N53C 5FP4A 3SHRA 2VZRA 5IK8A 2VZ1A 1JYIA 4FPKA 3MF6A 2FDKA 1OQ1A 4XILA 1APNA 1XNAA 2OPWA 3BODA 4UW5A 2W95A 3V56A 3MDPA 4BK5A 4HPKA 4JDMA 1SLIA 2B8MA 4TZDA 1RVF2 2BNOA 2WLPA 1QDOA 5FWEA 5H9SA 3WF0A 2AC1A 3LEGA 5KHJA 1W03A 4CDUB 5E89A 4FP2A 4AI0A 3R4SA 5CKNA 2QJVA 5LEKA 1B09A 3ZSLA 3F95A 1NZIA 2J7MA 2HBUA 2ZX3A 2WL1A 2WC2A 4XEZA 5FY1A 4IQPA 3THPA 2BOIA 2Y0IA 3ZXJA 2CNAA 1BEV1 1KS5A 2VUDA 1XE8A 2J1RA 2WT2A 4HZFA 1FNZA 2ZKLA 5J3UA 2VMCA 2CY6A 4ZU7A 3VHRA 2EAAA 4CEWC 2CHHA 3NJVA 4LOTA 1S4CA 3I59A 1XYNA 3KHBA 1VBD2 2JECA 5DABA 4GWNA 3HD8B 4Y1VA 1BVVA 1VBB2 4YVWB 1TMF3 2QQUA 5HXVA 5FZFA 5FZEA 4FXGB 4FTEA 4PI0A 1X7NA 2GNDA 2H6BA 2WRAA 2YC4A 1IPJA 3MIHA 4IV3C 4JDOA 1UZ0A 3I2KA 2PFWA 1IG0A 4YWAA 4DOUA 5JOXA 3M70A 1LECA 1RC6A 2EIDA 5FR3A 5I0SA 3KF5A 4J25A 5EZWA 3ZFFA 1W3XA 4AEJA 1UXXX 1WCDJ 5DAXA 5JR7B 3V0AA 3PU8A 1NYWA 3ZSJA 1RUH3 4DMIA 4NROA 5LY1A 3MW3A 4JRLA 1FOD3 3WF2A 2BU9A 1VAMA 2XJRA 1V6NA 3R4UA 1SPPA 3BOPA 4LTAA 4B3NA 3WEZA 2EF6A 3VDDB 4DINB 1ND3C 2WZR1 4Z07A 1RUG3 3C2UA 4CCMA 1SLAA 4A4AA 1MEC1 1VBE3 5IVYA 1RXFA 3K51A 5FZ9A 2Q8CA 3R6SA 2MNGA 1HXS1 4XDQA 5JUVA 1ZM1A 1YLLA 3DCQA 5EQUA 1NZCA 1SLCA 2E7TA 2VOKA 4IEXA 3K46A 1RUE2 2BQPA 5IHRA 3ZYRA 3O1RA 4CDXA 4GAZA 3NNLA 4BZ4A 4DPNA 4DFSA 2AZ5A 1O5UA 1ZZ9A 1ZZBA 1OFNA 2RV9A 4R9DA 3QH6A 5F5CA 2A3XA 3FLRA 2WQZC 3NV3A 2VBPA 4AFDA 2ZEXA 4ZZ5A 3G6JB 1GWKA 1CAUB 2ET1A 3GZAA 1OH4A 1K5MC 1MEC3 1EPWA 1WMFA 2UWBA 2YUEA 2VM9A 3VKFC 3OBTA 4ZU5A 5IFTA 1IQAA 1LNSA 1SCRA 2WZR2 1YO8A 3A21A 4FPOB 4ZY9A 2R32A 4GWJA 2PLV3 2LRPA 4B4QA 3K48A 1RUD3 1O5LA 4AEDA 1DDLA 1OF4A 4HONA 2BTVC 2I2SA 5BXXA 3ILNA 4BQWA 4BISA 2ID4A 2RE9A 2B7YA 1LHUA 2ATFA 2BVVA 2UY9A 2XHKA 3ZPOA 5FLJA 5LBFA 4CUGA 1U0AA 1HDKA 1XU2A 2H0BA 1RGSA 1DIWA 2VW2A 2ZMNA 4AI9A 4JQTA 4Y1XA 4UW4A 3I2HA 3H3ZA 2LROA 1PM4A 3EJKA 4ZS3A 1RUI3 4UBHA 4XJWA 5GZDA 1QJU3 2B46X 2XLGA 5FYSA 2VOXA 4I01A 5FREA 4XZPA 1V9U3 4R52A 3NMBA 4U2AA 1O59A 3RMYA 2YG0A 2WSUA 4YZ4A 4MADA 3GALA 1VRH3 1LOFC 4CEWB 2OUJA 1KJLA 4QKDA 2XWJB 4QXCA 5BY5A 2D6MA 2W08A 3FBMA 3GHMA 1H2MA 3S0MA 1AR71 1MS3A 3QOPA 1AL0G 3BIWE 4ES8A 4KGQA 2UYBA 2VCCA 4QM9A 1CAWB 2E53A 2V73A 3LA3A 1LU2A 3ZFFC 1CGPA 2W46A 3FUQA 4YGCA 3TRSB 1BXHA 1H8TB 2MEV3 3AM2A 4XQWA 4XUOA 2Q8OA 3RZKA 2EVXA 3BTAA 3FE5A 3JQXA 1QOSA 2JDNA 1GWLA 4Q4Y1 3NWKA 2KXLA 1GANA 3NV2A 2RR12 2RS52 2Y38A 4J1WA 5FYYA 5FFOC 1WW6A 4XYXA 2K46A 4X6QB 5GZFA 2P3KA 4UFHA 1V9U2 4JGYC 3T3YA 4XFCA 4H55A 4UW6A 4AQ6A 1UO9A 1TE1B 1XJAA 2ZCWA 1N1YA 3POEA 4CDXC 4CP2A 1L7LA 5G04L 4CP1A 3ZN5A 1XBFA 4PIXA 4R9AA 5C5TA 4MYEA 2HWB3 4ARYA 2ZGSA 3FZ3A 3WINE 4P14A 4XF0A 1QNWA 4QGMA 5C9AA 4XXAA 2HWF2 3AZWA 2F4PA 1CAVB 4NIAA 1N3PA 1NCRC 4FVVA 4AOCA 5K0UC 3H3UA 1H2KA 3THDA 5CFDA 2PLV2 3JQWA 2BERA 1B35B 3WDVA 5FRAA 4EWAA 3VB9A 1H4GA 3B9IA 3O1VA 1IS6A 4XJZA 1MPXA 3OY8B 5IUQA 4D69A 4R4ZA 5GLUA 1RUF2 2HYKA 2BFUS 4CYDA 4RN5A 1OD3A 1QJY3 4N9HA 4QPGC 2CWMA 2RM21 2JDHA 5FKCA 2WQ4A 3WR0A 4DQAA 5JI7A 3VBRB 1UZWA 4KH9A 5FYBA 4FFHA 3ZR6A 5AVAA 4QPIC 1VRBA 5CFDC 3WD5A 3CZJA 4QU2A 1CD3G 2DBIA 4Q4W2 1Y9GA 5EPAA 1SFNA 1H9WA 1RVF3 2XVGA 3WNPA 2BBAA 2C6SA 5A3PA 4YNIA 1DZQA 4QX3A 3WW1A 2Y33A 5A6QA 1WW7A 1GR3A 2ZJCA 5EYXA 3WG4A 1E5HA 2RJ2A 4EWEA 3JB8A 2I74A 2JDYA 5C33A 5F1RA 3VBOC 4XACA 4LBKA 1Z0HA 3AMPA 5GKAC 2VZUA 4Z92B 2C24A 3DUIA 3V65A 5JZGB 1NXMA 4CXWA 3PURA 2RS32 2G9ZA 5C7GA 3WF3A 1UY4A 3GZTB 2FDGA 1AZDA 4R9BA 5A7OA 3S30A 1F9KA 1NLQA 1W9SA 2HWD1 5J96B 1OHFA 2D3RA 3UK9A 3T4HB 1W04A 4PF1A 1RTVA 2EIBA 5KHGA 1A34A 4AI1A 3JBG2 2DU0A 4B4RA 3MHZA 1O91A 4A2UA 3HWJA 4XFIA 4Y1ZA 2WYFA 2EXHA 3SH3A 3ES1A 4B7KA 1VBC2 2AGSA 3D3AA 5K7PA 4AHXA 1RUNA 2VMIA 4GJYA 3VLBB 4BIOA 5B4NA 5TSWA 4ZHNA 2PHRA 3WP3A 3V0BB 1VBE1 1GFF2 3MW4A 1W99A 1AL22 3ZOIA 1WMEA 2X53S 3ETQA 4MLOA 3KV6A 4RHV2 5T50A 5ABJA 2WSVA 2CDPA 2YMZA 3IB3A 1QJU2 5DN2A 4E27A 2Y26A 3D5OA 2G9GA 1UMIA 1PX3A 3JD71 4ITCA 3CIHA 1KD7A 5ANQA 4KWUA 3NRUA 5T54A 3GHNA 1HRI2 2NYYA 1R093 1V70A 1PHMA 3GBFA 5C3SA 1AHSA 5FZCA 4RGKA 3H8UA 4AI8A 3VD3A 2D6LX 4DIQA 1AX0A 3MLKA 4JQRA 2WFF1 1SLLA 3PJQA 3CBNA 1ZBE1 1I1EA 1JOPA 2WKKA 5L36A 2FCTA 4R4XA 3WDTA 1N1SA 1QJEA 5KC5A 3SH5A 2VMDA 3KF3A 4KWJA 1NQJA 2LUWA 5GLZA 3ZFGB 3BUCA 1VAVA 1FYUA 5A7WB 1IS4A 2ILMA 4HN1A 1QNYA 4PIZA 4FP3A 2V09A 1DGWA 5G05L 4QX1A 2GMMA 2ZKNA 3HT2A 4BYYA 5JZGA 4WVZA 2AUYA 3KGLA 3CNAA 4A44A 1CQ9A 4PF5A 4S2GA 1W90A 3THTA 5IVEA 1Z78A 2DCJA 4GMP1 1ZZCA 3J9SA 4QKNA 4MGKE 1HV0A 1UPIA 3ZXEA 1PGL1 2J1UA 3VZMA 3FMGA 3Q8BA 3OGVA 3UT0A 1C1LA 5JMCA 3OSDA 3PVBB 2GC1A 4CU7A 2WAOA 1JHJA 1V6MA 5T5JA 4YZ1A 5C4WC 4OHYA 2VC9A 3M3EA 5A6YA 2FDJA 1YIPA 3POGA 3NAPB 3FC0A 2QTWB 2ZX0A 3J4UH 3ON7A 5AFBA 2W47A 3S7IA 2R061 4Y1YA 1TME1 3WNKA 2O8OA 4A42A 5IK4A 2ARXA 1UY0A 1CX4A 4M01A 3PJYA 4GKYA 3NNFA 1BMV1 4DUVA 4YG0A 3JXSA 2KD7A 3MIDA 5FP9A 4K40A 5C4WA 3R0RA 5E88A 4CVUA 2ZHNA 2E51A 2VUAA 5IAVA 3T2PA 4FOWA 1LHOA 4QB2A 4B29A 4C1XA 1BBT3 1D4M2 3J7NA 5LA9A 3H8XA 3CO2A 2BGOA 4YVSA 2R7EB 3AB0A 4IEPA 4CUCA 1ST8A 4RR3C 2WNVB 3FL7A 1CIYA 5K8SA 1FT9A 5DUXA 3U0ZA 3DYMA 3ZMNA 3H9AA 4FFFA 2QDRA 2HWB1 5L9RA 1AVBA 2EICA 3H8OA 4C91A 5C6CA 4DO0A 3RZJA 4UFLA 4CCKA 2BDRA 3PU3A 4COZA 3LPGA 1YCIA 2ZGRA 5GLVA 4LBQD 4P9YA 3RYKA 4XF3A 3PLQA 2OXBA 3WW3A 1QF3A 4H7LA 2XQXA 5HPOA 2PHLA 3ECQA 2PAMA 3J8F3 1W6MA 2GMEA 1O3RA 1VP6A 1ZRIA 2DF7A 2W94A 1DU3D 4ASLA 2Q30A 2X09A 3O1UA 1JN2P 1NA1C 1RUC2 2X10A 5DZFA 3RDIA 1DHKB 2ZGKA 3DEMA 3O14A 3WCRA 1F35A 1RUI1 2WWSA 3LAGA 2WDBA 1D4M1 1W8NA 4A41A 5KXCA 5J37A 1G6NA 3N4MA 4CEWA 1FI2A 2TBVA 3FLPA 5FCCA 4BB3A 1HB4A 2GU9A 2VZ3A 4RQPC 2JDUA 4MGYE 1M4WA 2JG8C 4QD2A 2OYZA 3IIAA 1OVPA 4AVSA 4LUKA 5EWSA 1BLZA 3DYOA 3HN1A 4INDA 3RWKX 5C3PA 3A4UA 4MXWA 3MLLA 3M2MA 4HVOA 1PZ8A 3ME2A 2RHPA 3M8LA 4AVAA 5DPNA 5F3EA 3QACA 1BCXA 1DP0A 3FWEA 4KU7A 1R083 2HBTA 3D0JA 1S0EA 3GJAA 3B01A 4FPHA 3QBQA 1QJX1 3D4KA 3KCXA 4LK6A 2DVBA 2CSGA 2C9AA 4M0HA 1PGL2 4XUQA 3N3HA 3VBSA 1T6BX 2LS6A 3GZUC 4IGPA 3VZLA 2OZJA 4OUEA 3RVHA 2HEYF 4B4PA 4XHBA 1KQRA 2A3WA 4AFBA 1COV2 2IXCA 3MLJA 1X82A 2ZAHA 3LDRA 3HR9A 5CISA 3BTXA 3IPVB 4DXSA 4QT6A 5FZMA 2WNUC 5ACA1 2PHDA 2YPDA 4LIUA 3PVOA 5H9RA 2DVDA 1UYXA 2IWGB 1S2KA 1LEDA 1XNDA 5JSRA 5L19A 4CP9B 4YW7A 3H1MA 1VBA2 1GP6A 1LESA 1EAH1 4NUBA 1R082 1PGW1 1XQNA 3BPSA 1DFQA 1W3VA 1WKYA 2A71A 2WINB 1AXYA 1XSQA 2OKXA 4ET7A 5BNQA 1Y4WA 1A3KA 1XNKA 1GYKA 1MQTB 3SC7X 3WV6A 2FDIA 1AYN1 4R9CA 1Q8PA 3ACFA 5BNNC 2WNVC 4XBLA 2WNEA 2XMLA 4BJ0A 4FTSA 1HB2A 2VTXA 4DB5A 4BQ5A 3VZKA 2D6KA 5IVJA 4QGLA 1AL21 1FX5A 1NA1A 3EB7A 4KI5M 5BNPB 4CDWB 4RD7A 3TNPB 2W39A 2RS11 2RG4A 4DUWA 4YRDA 4D8MA 2VW0A 1W8HA 3B5LB 2DVAA 3RZZA 1QIQA 1S2BA 2Q1FA 3NVCA 3MV01 2W1WA 4QM8A 2F4LA 4BE3A 3WG1A 4WM8C 5FYTA 5JLVA 5FAXA 5SV5A 2SBAA 1BZWA 3POJA 2FBEA 4GULA 5B2GB 1AJOA 4ORFA 1LENA 4RL7A 5BPXA 3VGIA 3N7KA 2XHNA 4IV1A 1VAKA 2GMPA 3I2OA 1COV1 2JWPA 5D8AC 4CA9A 3OUJA 5AVPA 1C8M3 1YWKA 2VUJA 1ULPA 5FZ7A 3NL1A 3LE0A 4W6YA 5FO9B 4XQ4A 2ARAA 2RS31 1O6UA 4S2DA 3WG3A 1HLCA 1LKNA 1GV9A 1W2TA 5CFCC 4QDQA 3VBHC 1ALYA 5CADA 3C7HA 2GH8A 5CZKA 4Q4X2 3CL1A 1WLTA 5LA2A 3I3MA 2JG9C 1W9FA 2X5IB 1ZA7A 4IV3A 4OI0A 3FHAA 4IEWA 2J1SA 2VPVA 4JGZC 4Q4W1 3I2FA 2B9UA 4IEVA 1XSRA 4J1XA 3DGTA 2IC1A 4HK8A 1X36A 4Z8BA 5CFCA 1Q56A 5F32A 3O1PA 5H9PA 1HX6A 3ES4A 5FZBA 1YEWA 2WWUA 3BTYA 2TEPA 2DVGA 3EO6A 1IKPA 1AYM3 2QUOA 1EPZA 5L9BA 3O1TA 2JDMA 4DXTA 1HRI1 4AI3A 5CG9A 3WT3A 4LEJA 1R091 4NN0A 4QPWA 5D2AA 1MZFA 2OA2A 4TN7A 4OMCA 1W06A 4MGIE 4PDWB 4CDQC 1L3JA 2WO2A 2Q4SA 2RS12 3AX4A 3G7DA 3LEKA 1TNRA 4COWA 3AP9A 2WNVA 3WNLA 3OY8A 1NLRA 2JB4A 4RFT0 1XNCA 2BJSA 1NQDA 1MZEA 1RUJ1 3RZGA 4NPLA 4XCAA 2YXSA 5GM0A
chains in the Genus database with same CATH topology
1ND2A 1Q43A 2K0GA 2O1QA 4XPVA 4AHWA 1RUOA 1ONAA 4YM1A 4BLIA 3ZIWA 1KDMA 4EN7B 3HBZA 2HWD3 3AZXA 4BM8A 3I2DA 3NAPA 2XVKA 1LOGA 3DV8A 5DDJ2 2WZPP 2CAUA 3MFAA 1UIJA 2CGOA 1LR5A 3WOGA 2ES3A 2Z42A 1QY4A 4LBQA 5KXDA 3DF0A 1QMJA 4EN6B 2D44A 3HIFA 3MZHA 5T5LA 2Z79A 4FPFA 1AL23 1ZA4A 4GIQA 2JENA 2FQPA 4XBNA 4LA2A 1YRZA 2A7AA 2HWE2 1D0HA 1HRV1 3R4DB 1S0CA 4HT1T 2R063 1DGRN 4LBQB 4C90A 1RMU2 3POYA 3I7DA 2SLIA 1X33A 3VHNA 4GKXA 3GBWA 2D97A 4YARA 5JOYA 2YGMA 4DZGA 1CJDA 1RINA 2LALA 1CIWA 2HWF1 1XU1A 4KWLA 2O8QA 5J36A 2Q1MA 2W68A 2KA3A 5LRSA 3AZVA 4XFHA 1R1A3 4LO8A 2BNNA 1W6NA 3I8TA 3B94A 3RG0A 4G9SB 1Y9QA 4P9WA 3JZVA 3VL9A 4JGYB 1WD4A 3ZFGA 3TN93 4FXKB 1PO23 4L99A 2R49A 3H7YA 3O7OA 4N53A 3WQ1A 2XPJA 4IEZA 3B00A 4C1WA 4AFMA 3M3IA 4M3CA 1FMD3 2JDZA 3M1HA 4MX3A 1KFUL 5CBLA 5F9TA 2MPFA 3M3QA 4YLZA 3WUCA 1S55A 2X29A 4L8QA 3OTFA 1SFYA 1AX2A 1UL9A 1A6CA 4AQSA 5CIRA 1YXWA 3OJBA 2PHXA 3WDYA 3RJRA 2ZMKA 2A70A 4QX5A 1C8M1 4XXPA 3CLPA 3S7EA 4LHLA 4AK3A 3KM5A 3LA2A 1YFUA 4AE2A 1POV0 1J1TA 4H14A 4N43B 5DZEA 1F5JA 3T1MA 3NSTA 1KS4A 2DWRA 5FLHA 2QQPA 1OI6A 3UJOA 2UU8A 2XKPA 3UKNA 1ZRDA 3ELNA 4Q27A 1REDA 5C8CA 3WW2A 3O0WA 3N35A 2FMYA 1GKBA 4GB33 1AR63 2NP0A 3O0VA 1IS3A 4UBGA 5LEJA 2P3JA 4OLLA 4NHLA 4AF9A 3ZXAC 4XFAA 4YG6A 1RITA 3AYCA 4ZXKA 1WW4A 3E6CC 3E6BA 1PNFA 5T52A 4YG3A 4EN0A 1RIRA 2TUNA 1D2QA 1POV1 2NLRA 2RMU3 2ZA9A 1EY2A 3ZXDA 3BU7A 4EN9B 4M0NA 2R073 2C1FA 1ND3A 5KXBA 3MEPA 4WBBA 5DDJ3 4EWDA 5ABJC 2XJSA 1SACA 1PO22 3USSA 4Q0PA 1VJ2A 2ARBA 4YW5A 2XJQA 2QZ2A 4YVSC 1RJ8A 2DCYA 2YYOA 2PYTA 3MIEA 3WW4A 1R1A1 4M00A 4XETA 5GZCA 4FPLA 4JTOA 3TYJA 1LEMA 2HEVF 3D8CA 5CVRA 3B7MA 3NW4A 5C9AC 1AUYA 4IV3B 1QJU1 2VNRA 4HFSA 1QHDA 4YVWC 2Z2SB 1VBD1 3LA7A 3V0AB 1AF9A 2D6PA 5JI9A 2XLAA 1NY71 5HCAA 4FAGA 5SV8A 1OA3A 4WM7C 1IKQA 3ASIA 4SLIA 4CEYA 2XKOA 4AYUA 5BNPC 5GZGA 2B39A 3VBSB 1V6OA 3ZFEA 4AVVA 4FPYA 2QNKA 5JSPA 4QPIA 2IZWA 3ZO0B 3JBG1 4YW2A 1MQTC 3N36A 1UX6A 2DUPA 3IN9A 3SCGA 4D7YA 1VIWB 2VQAA 1AR62 2D43A 2DUOA 4D94A 3ZYGA 2NMOA 4FPEA 3SXWA 2ZZJA 3SITA 2VVFA 3AK0A 2R042 2VH9A 1FPN1 4COUA 1REEA 2KM2A 5GJ6A 4AVTA 4BCUA 2UWCA 3X29B 1G9DA 4KG0A 3SCHA 3VZJA 2NQYA 4HPKB 3ZFGC 4LLOA 4IEYA 3GYDA 3CJIB 3VZNA 1J59A 3M3CA 4YGDA 1AR92 3VBUC 3OYWA 1FV2A 1DZRA 3WCSA 3U10A 5BNOB 1IPKA 1GZWB 1LRHA 1FV3A 3GBGA 4LBLA 4E2GA 2OPKA 1BBT1 4PLNA 2K9ZA 4HVRA 4LO6B 1ENRA 1WBLA 3ZYPA 3ENRA 3R05A 5JOZA 4E2SA 2P2KA 1Z7S2 4W6WA 2XL7A 2XUMA 3IDCB 1Q8SA 2D6NA 1HXS2 1S0BA 2OVUA 3ZMOA 1W0OA 2ZHMA 4FO9A 2GZWA 2JG8B 2UWAA 4HN0A 1O3TA 1QXJA 1I5ZA 4YVWA 1M06G 4C0HA 1UCXA 4N43C 3VBHB 3MFCA 2HWB2 3RNSA 5FO7B 3OPZA 1TMF2 1A8MA 1VBD3 2RJLA 4CDWA 3QCWA 2BUKA 3VBOA 1NG0A 4PBPA 3ZSKA 4I0WB 4ISRA 1CPMA 5DUUA 2CYFA 1HRV2 1AR91 2VXRA 2YY1A 4Y1UA 2E6VA 5T55A 1KJRA 3VN4A 1LHVA 1XNBA 3VBOB 5FPXA 1ZNPA 3VBSC 1WCKA 2XH6A 4AVCA 1NE6A 1JUHA 3KT1A 1VLNA 3PVNA 4XHXA 5HBAA 4LE3A 2VOWA 1DZTA 4N9IA 1H9PA 1MS8A 1YFWA 1R092 2UURA 4E9KA 3AKPA 5J09A 2NMNA 3JD73 5BNNB 1G8WA 2IFRA 1ZBA1 2BVBA 5EV7A 4BQ1A 5C9AB 4QPGB 1RVF1 4YM3A 1MZ5A 5I0TA 4FQ4A 2Q5TA 1VB2A 1WCSA 2HKXA 3E97A 4HANA 1YYNA 4META 1QXPA 4S2FA 4HKLA 3UKTA 4QXKA 4Q2FA 2R0FA 5I8YA 1VB4A 2XVLA 4XFBA 1GQHA 3AJYA 1CN1A 1NY72 4NWWA 3LKJA 3PVEA 4I2OA 1FOD1 5EJ3A 5GLWA 5L73A 1MR5A 2Q1ZB 1C5IA 5CB7A 2GDFA 2VOVA 2PHWA 3ZYJB 4Q4V3 1GLHA 2DTYA 2ZGUA 3U11A 4Q0UA 1ZRRA 1VR3A 2PLV1 3ILRA 3AYAA 5T3NA 1IOAA 1JH5A 1EV13 2D7FA 3USUA 4Q26A 3SCFA 3CF6E 1V6JA 5A33A 1RUD1 3AJZA 2D93A 3KGZA 3O5SA 4I3GA 4TYSA 3RS6A 4BWOA 2OUHA 2WJSA 4NO4A 4HMZA 3BPZA 4BPZA 2AR6A 1V9U1 2JG8A 1DYPA 4O9EA 1AYM2 1AYN2 2VNOA 4RQPB 1AR61 4HKOA 2QZ3A 1J3RA 2EXJA 1W0PA 2GSYA 4K21A 3I4IA 4G4FA 1FPN3 3CJIC 3WDXA 3WP6A 4PCRA 1LOEA 1EAH2 4NVPA 4QQHA 3WP4A 2Q0AA 2PHFA 1RUH1 3IDEA 3AMNA 4CDQB 1BEV2 1GQGA 1FMD2 4YFWA 1U5IA 1XXNA 5DXDA 4UXAA 1F8VA 3NV4A 3DPRA 4XJ9A 3FLTA 3VKMA 2XB6C 1S0IA 3AKSA 2NZ9A 1VRH2 1SLTA 1YFYA 1RUF1 1OSGA 2JX9A 2VVDA 3DPRB 1AYM1 3ZDSA 5I8SA 1CAXB 1OA2A 2AYHA 4MH0E 2QKDA 3E5UA 1DBNA 2MEV2 4EJRA 4WZFA 5JZGC 4FOVA 4AG4A 1V6KA 4IETA 1UIKA 2A73B 3V64A 1IS5A 1R1A2 2QVSB 2JE9A 2GC0A 1KXGA 3ILFA 4YGEA 4LULA 4WM7B 1OA4A 2I45A 2HEWF 4L9BA 4RA0A 4QPIB 5CFDB 5F5QA 3NAPC 2ET7A 3VHOA 1TME3 1YUDA 2H6CA 2RS33 3AXEA 5C4WB 1RUI2 2R16A 1HKDA 2YROA 1H30A 3RI9A 3MPBA 4P9JA 2P3IA 4JAAA 4K7JA 1YFXA 1X8EA 2D5FA 1SDWA 3NV1A 4WM8B 1NOVA 2XJUA 1PIV2 3TNQA 4E4DX 4RS5A 3AZYA 4YVSB 4I30A 4NPRA 3LWCA 3S6PA 2QFEA 3L2HA 1KRIA 4COVA 2N7GA 4OHXA 4F8AA 1EV11 5ABJB 3NKTA 3NO8A 4KNCA 4JGYA 1B35A 2MEV1 1W6MB 4B7EA 4Q4V2 5KHHA 5DUWA 4N7IA 4BMBA 1ZBA2 2FHRA 4Q4X3 4Z1VA 1MVQA 5A3MA 5J7MA 2BFUL 2XBO2 3MICA 4GQ7A 2D6OX 3WHTA 4AHYA 4K3UA 1FAYA 1AR82 3H1YA 4AHZA 5K0UA 5FBZA 3NKGA 2BPA2 3MPPG 2WS93 1T6GC 1EV12 3C3VA 3RI8A 3FBYA 4ZKTB 1H0BA 3BOWA 4DY5A 1FATA 1Y3TA 3VKOA 2BGCA 2P17A 4X8NA 1RUH2 1QJZA 1UZYA 1K5MA 3BB6A 2GN3A 3JU9A 1Z7S3 3MYXA 3ZN6A 1TMF1 3JB4C 4GMP0 1HQNA 1VBC3 3KD4A 2DCKA 1QKQA 3B9CA 4X6RB 4XOGA 4YGBA 3AYDA 2A6YA 1H2NA 2LTNA 4QQ2A 1RHI2 1ZRFA 1RUJ2 3GNEA 1AX1A 4PBOA 1RUE1 4LUMA 4GALA 3AMHA 5JPMB 5GALA 1Q8OA 5DZGA 2C5DA 2PN5A 2DCTA 2FZ2A 4L92A 4TWTA 4OI4A 4Q4Y3 4BIFA 5T5PA 1TME2 1YNAA 2JXAA 3P3PA 3AZZA 4AGVA 1LGCA 4GA9A 1LOFA 2O0OA 3RPQA 4URTA 1WLWA 3I59B 1EP0A 1S0JA 1OKQA 1BBT2 1D4M3 1RUG1 1PVC3 5T5OA 3B93A 4PDWA 3PMEA 1JOJA 3KCYA 4LO5B 2BWCA 4LBOA 5D8AB 3SMHA 4LT5A 2HWE1 3VBUA 2ZX2A 1B35C 1IHMA 1C4RA 4OFGA 4C0BA 1KDKA 4MV2A 1VBE2 1WMDA 2RS13 3AKQA 2WLQA 4WZCA 1MQTA 5JAXA 1J1LA 2PELA 1W6OB 2UYAA 4Z82A 1S0FA 2R6QA 4GH4A 3WQ7A 4L2NA 2IFWA 2PHTA 1MS9A 4CDQA 1LHNA 3AKTA 2D3PA 2HWD2 3HT1A 3VHPA 2EIGA 1PVC2 4IEQA 1NE4A 4ASMB 3WDUA 1QJY2 1WW5A 2WZR3 3RYRA 4L11A 5FQ0A 4K6BA 1G9FA 2CGNA 4FAHA 4YZ5A 5DG2A 3D0SA 1SEFA 3D6EA 1H1IA 1PMIA 1H1MA 4LA3A 3VUOA 1UW8A 2HWC2 3KS7A 4WVMB 1Q5OA 4PJYA 3IMNA 1WLCA 3ZFFB 2ZZQA 3WDWA 2GC2A 3J26N 2VY0A 3TN92 3O12A 4QQOA 5JWPA 5HI0A 1MS0A 1N47A 3OD4A 1VBC1 5I0UA 4RQPA 4GXLA 1AXKA 4CDUC 3PMSA 2BEOA 4DS0A 3D82A 5IT6A 3E6DA 4AFCA 4XQDA 3J8F1 1RUG2 5JPNB 4YYOA 2EAKA 2NN8A 1UU6A 2CAVA 2OZ6A 2YV8A 1BKZA 2ERFA 1PGW2 2IXIA 1R081 5I8TA 3VBRA 1LOCA 4M3CE 1ZZ8A 5HCFA 2GNBA 4N43A 4K8FA 1AYN3 2B42B 2YDEA 1GSLA 2BWAA 4PDWC 3W9AA 1RB8G 5AC92 4BLJA 1XYOA 3OBRA 3ZYIB 1RUF3 1PIV3 4XIOA 1OPMA 3OD0A 4MUVA 4K20A 1RHI1 1QQP1 2GNTA 4GB32 4YZ2A 1ENQA 1CAVA 4CRQA 5DUVA 4FPJA 2P34A 2WS91 4LO7A 1DQ1A 1KFXL 5CAZA 5I91A 1KITA 4AGRA 2VULA 5F6LB 3VBUB 3KZ4C 4QGNA 2BBVA 1PZ9A 2DURA 1GICA 4WVWA 4Y26A 4YFZA 3SH4A 4JGZB 2D40A 1UN1A 4XTMA 2JG9B 2X5IC 1FXZA 1QQP3 3PTYA 5FPZA 2PA7A 1ND3B 3W59A 3LOIA 1LOBA 5BNNA 5AC93 3AFKA 4AI2A 1G86A 1OLRA 1PGSA 3ZXGA 5BUVA 1CAWA 3EXUA 4Y5Z0 3MW2A 1LB2A 1C8M2 4K1ZA 1JUIA 5FQ0B 2DFBA 1GBGA 5L7OA 1HRV3 4QQLA 1BEV3 1LJ7A 4FT8A 2ZACA 3AMQA 3L2YA 2JE7A 1G9CA 4DRRA 4CDWC 4IV1B 3VBFA 1C28A 4JC1A 3OYWB 3LZZA 2ZX4A 5ACA2 3VBRC 4CP0A 1E57A 1PM7A 1LU1A 1H2LA 2ZHKA 3LGRA 1C3HA 1DQ4A 4COYA 1W6NB 2R30A 4FPGA 1DYKA 3ZIXA 3VBFB 5FOJB 1D2SA 3SISA 1W6QB 5F6KA 2A6XA 5E1RA 4FTBA 1H4HA 4KQ7A 4W6XA 4EROA 5K0UB 3M4FA 1ULCA 4MXVA 5E16A 4TLFA 4Q4V1 2R1BA 4SBVA 4NR1A 4WVVA 3FFZA 1Q8VA 2HWE3 5HCBA 4IL7A 4RSUA 2R062 3IT8A 1LTEA 4XF4A 3ZSEA 5CNAA 4E2QA 3WY6A 1JHNA 4MZUA 2WFF3 4D7SA 1QOOA 1WBFA 5K9YA 3WNXA 1EAH3 1V6LA 1U5ZA 3ZXKA 5ACA3 5DG1A 2GNMA 3QLQA 1AR83 4UW3A 2Z5WA 3FX3A 1HRI3 3MI8A 1RMU1 4LLFA 3POWA 4AGGA 2DVFA 3URFA 1QQP2 1H8TC 1VALA 1W6PA 4GB31 1Q8QA 3VKLA 1ASJ3 1W39A 3MIBA 4LHNA 2TNFA 4AQTA 3M3OA 2ENRA 3IDBB 1PO11 3HAGA 1MEC2 4HETA 4Y20B 1SMVA 1TQ5A 4MGZE 2EXKA 4P9XA 5L7OC 5KXEA 1QJX3 2WT0A 4J6GA 3JUUA 3ZPYA 2WFF2 2ZGOA 4YW3A 1DF0A 3MIGA 3KT7A 1PVXA 2ZHLA 3OF1A 1NA1B 2G4IA 2ZGNA 4P9GA 3FFQA 2DFCA 5BNPA 3TOJA 2YPJA 3QD6A 5J48A 2EA7A 3JD72 4WM7A 4OZXA 2XBO3 2VMHA 1Y43B 4OHZA 1YHFA 2ZAAA 4N7UA