3AYDA

Crystal structure of galectin-3 crd domian complexed with tfn
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
135
Chain Sequence
MPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-3
publication title Structural basis for distinct binding properties of the human galectins to thomsen-friedenreich antigen
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 30
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aydA00
2V5YA 3PMEA 4FPFA 4M00A 5CB7A 3AZXA 4LBNA 4BLJA 1OQ1A 5F9TA 1S0GA 4TYSA 4I30A 3I8TA 3D4KA 5DZFA 2OUJA 1KDKA 1AXYA 1SLIA 3PVOA 4XBQA 1BJQA 3AXDA 1W6QB 2VUAA 3FLTA 1V6IA 2JD4A 1ZM1A 2HYKA 2KM2A 4YG3A 3ENRA 1HLCA 1AJKA 1X50A 4FPHA 3SH3A 4YW3A 1JUIA 4YFWA 2NP0A 2GNMA 4BM8A 1C57A 4AWDA 1D0HA 3WLUA 4SLIA 1QMJA 1S0BA 5JOWA 1JHNA 2ZGNA 1QKQA 1N3PA 2D6OX 2YZ4A 1Q8PA 4C1WA 1JOJA 1V6OA 1FNZA 1IOAA 3FFZA 1IS4A 2A71A 3WUDA 3ZXEA 2GNBA 1U0AA 2ARBA 3POSA 3T1MA 1DGLA 4XIOA 2EALA 2FMDA 5DXDA 4ASMB 2ENRA 4WVWA 2DUQA 1N3QA 4Y1UA 1H30A 2ZGQA 2D3SA 5IK5A 5T5OA 4YZ2A 1WBFA 2ES3A 2I2SA 1F9KA 1CESA 3LCPA 3WZ1A 2A6ZA 1IKPA 1DQ1A 4GKXA 3OPZA 1V00A 5CA6A 4ZXKA 2CWMA 2RHPA 3AZYA 3NV2A 1GZWA 4UW3A 3O5SA 4XJZA 4YM3A 3N7LA 3ZXFA 3BIWE 2A3YA 4ITCA 3WDVA 3WDYA 1ULEA 3RRDA 3ZYPA 4DRVA 3U4XA 2ZA9A 4R9CA 4OZXA 4YM2A 4AVVA 3W59A 3W58A 3SH4A 1I3HA 1UKGA 2AENA 3OY8B 4FQ4A 3SLIA 1VIWB 3N7MA 2WSUA 3USUA 1DHKB 1SBEA 2D44A 3D5OA 1LU1A 1AF9A 4BQ1A 2A75A 2B7YA 4P9XA 3N7JA 1V6LA 1VAVA 2PHFA 2VW1A 3AYDA 3PJQA 1QNWA 4FP2A 1O4ZA 1A3KA 1LHVA 1N1TA 2E7TA 2EXHA 4LBQA 5KXCA 2ZGTA 1LGBA 4ATFA 3RG0A 3USUB 4XIKA 4C1XA 1G7YA 2DUOA 2R1BA 2WKKA 4ISRA 4LBJA 2DVFA 1QOOA 5GLZA 3V64A 4Y1XA 2ZGPA 4KBBA 1LOAA 4Y1YA 1CQ9A 2CNAA 5BYNA 2EXKA 4M3CF 3O12A 4XHBA 5AVAA 2ZGMA 4FOVA 5L73A 4Z8BA 1LESA 5JOXA 1WD4A 1WUVA 4K1ZA 4LBQB 4RL7A 3Q9OA 3FLPA 3A0NA 1HKDA 1GYKA 3HN1A 4FPOB 4U36A 4Y1VA 4IQPA 2E53A 2ZBJA 1RITA 1UPSA 3AP9A 1UX6A 2ZABA 3UL2A 1QF3A 3AFKA 4P9WA 3WDUA 2UWBA 1WLDA 3VV1A 2A7AA 1UZZA 3MPPG 2DVGA 3WNXA 2P34A 4XDQA 1LODA 2YXSA 3JUUA 3RS6A 1Z78A 1W6MA 2D6KA 5GLWA 3WG3A 3O0WA 1SCSA 5JOZA 5E8AA 1DQ6A 5H9RA 3AYEA 1N47A 2WLQA 4XBNA 1QDOA 3T2TA 1GZ9A 5KXBA 3JU9A 4P14A 1LOBA 4GWMA 4YW5A 2W39A 2PELA 3M3QA 1URXA 4JCKA 3VKNA 3V0AA 3NV1A 1ENQA 1LENA 2D43A 5GZEA 1AX1A 4PBPA 2DUPA 2YY1A 2SBAA 1W6NA 2SLIA 1LHOA 1W6OB 3MEPA 2UWCA 2YV8A 2ARXA 3IMNA 2D6LX 5E89A 1GKBA 5GZGA 2DYCA 4Y20B 4LBOA 1N3OA 2P2KA 2CYFA 1G86A 3T1LA 1LGNA 3OYWA 1LGCA 1ULCA 2VY0A 1EPWA 3I4IA 4AGGA 3V0AB 5DUWA 5LK5A 4YGEA 3H0OA 4AGRA 1LU2A 3WG4A 2V73A 4AYUA 4D69A 2C5DA 5H9SA 1QOTA 2GMPA 4FOQA 3RQ0A 4AVTA 1VLNA 1W6NB 4U2AA 3V0BB 1MS4A 1QOSA 2JDZA 2ZGLA 3GALA 2W52A 1MS5A 1MS3A 3IN9A 1ENRA 3MW4A 4YGCA 5GALA 4XILA 5EWSA 4YZ1A 5GM0A 1DBNA 3OYWB 1RIRA 3ZSMA 4K1YA 3KQRA 4JC1A 1FNYA 2EXJA 3VKLA 3D6EA 3VUOA 3RMYA 1UZYA 2D7FA 4LBKA 5DZGA 2G4IA 1APNA 3M2MA 1FV2A 3IKWA 1ZA4A 2AH2A 1BQPA 5FREA 4NOTA 1ONAA 2DTYA 3NV4A 3UJQA 3SH5A 2ZHKA 1SACA 1BKZA 3N35A 3LSDA 4YGDA 4PF5A 5GJ6A 1UL9A 3FLRA 3DGTA 1MZ6A 1GNZA 4FPJA 1N1VA 4NO4A 5T5LA 1SBFA 5GZCA 5H9QA 3SISA 2R0FA 1LECA 5JVVA 2ZZJA 1LTEA 3ZXJA 1PZ8A 4RA0A 4YLZA 3VKFC 1NXD1 3MW2A 4P9YA 3WHTA 2CY6A 5EXOA 3V65A 1W0OA 4DPNA 4XJ9A 3QCWA 4XMIA 3BTAA 2BQPA 1FV3A 1O4YA 5IT6A 1NLSA 1G9DA 1DLLA 2NMOA 4XJAA 5JLVA 5T5JA 3OY8A 3ATGA 3ILFA 1R1ZA 3N3HA 2DVAA 4XE9A 4M3CB 1Z0HA 3ZYRA 2ZGOA 2OW4A 5GLVA 3WG2A 4M01A 3WHUA 3ZXLA 3KM5A 4BMEA 2E7QA 1N1SA 1G8WA 3AZVA 1HQLA 2DVDA 1V6KA 1C1FA 5GZDA 1MZ5A 4PQ9A 4WVVA 4XTPA 4FPYA 1AJOA 1MS0A 1ULDA 4FPGA 3ILRA 3NV3A 1N1YA 3WCSA 1W0PA 2A6XA 5T54A 2VU9A 4CTEA 1WLWA 1QU0A 1GNHA 3FUOA 2A70A 1ULGA 1B09A 4LBMA 2Z42A 3OJBA 5KXEA 2JJ6A 3C2UA 3HMYA 2TEPA 1Y7BA 4DS0A 4YW2A 4YFZA 1FX5A 1WBLA 3ZSKA 1MVQA 4GKYA 1F31A 1WW5A 3PVEA 1QGLA 5SV8A 5F5QA 2ZHMA 1KITA 2C9AA 4XZPA 2E51A 4YW1A 1CR7A 4XYXA 2AR6A 2ZMNA 2LALA 1CONA 5IK4A 1KQRA 3WVJA 1IKQA 4FPLA 1BYHA 5CNAA 4YZ5A 4UW5A 1AXKA 1C1LA 4FOWA 1KJLA 4WV8A 1A8DA 5T52A 3ZSJA 4YM0A 4Q8KA 2A3XA 3AP4A 1LOEA 4XOGA 4XMAA 4BOWA 1S1AA 1CPMA 3M1HA 4LBLA 1DZQA 2PHXA 1OFSA 5T50A 3OGGA 1GANA 3AK0A 2A6WA 2DV9A 4ATEA 2R16A 1MS1A 2XB6C 4UW4A 1W6OA 4PBOA 4R9AA 3AJYA 5KXDA 2ZKNA 3MW3A 4Y20A 3WDWA 1GLHA 1OKQA 2GN7A 4FP3A 2VW0A 3VKOA 2JKBA 1S0JA 1TEIA 2OUHA 5E88A 1S0FA 2A5ZA 3AX4A 4ISQA 1DFQA 3SNMA 3V0BA 1AVBA 5IK8A 1KJRA 1W6PA 1BZWA 1UN1A 4XTMA 3N7KA 4XXPA 2DWRA 4Y1ZA 4Q27A 5GZFA 2LTNA 1V6JA 2ZHLA 2UU8A 3A0KA 4FPCA 2D3PA 3M3EA 3IPVA 5DUVA 3WUCA 2WT2A 1G9FA 3DUIA 3A4UA 4M3CE 2GMEA 2D6NA 4XHXA 1W6PB 2CTVA 1ENSA 1DQ2A 1GZCA 1KDMA 3CNAA 1RINA 2JECA 1WCSA 4L8QA 3ZPYA 4XJUA 3OBTA 1LHWA 2GNTA 2WSVA 4Y26A 1AX0A 3IPVB 1BXHA 1QNYA 4W65A 1QDCA 1V6MA 1IS3A 4XBLA 2UWAA 4YZ3A 4XXAA 1SBDA 3UJOA 1JYIA 5HCFA 3AYAA 2FHRA 1LOCA 4FQZA 3O0VA 2W68A 3R4UA 5T55A 3FBYA 3PVNA 3GNEA 3POYA 1Q8VA 3TB0A 1S0CA 1PZ7A 4LBQD 1F5FA 3B69A 2ZAAA 4CRQA 1JYCA 5JDBA 1UAIA 2NMNA 2NN8A 3B3QE 2YMZA 2AUYA 3NWKA 4M3CA 2DU0A 1Q8QA 2EXIA 2R1DA 2EF6A 2WT1A 3FUQA 3HR9A 1AXZA 2AREA 1LOFA 3IM0A 3INAA 4FOYA 4F83A 2PHUA 1DQ5A 2WQZC 4Q1RA 4XJ8A 2W08A 3ASIA 3AP6A 5DG2A 1JXNA 2P3IA 3M3CA 3ZSLA 1HQWA 4BPZA 1CPNA 1SLTA 2D6MA 2WT0A 4Q8LA 1WLCA 2VXRA 4DQAA 1G9CA 3O0XA 2AYHA 2ZMLA 1D2SA 3BODA 2GMMA 3AP7A 5CAZA 2ZGKA 2ZACA 1LOFC 1WW6A 2EAKA 2GALA 2R49A 4R9BA 1FYUA 3L2YA 1YXWA 3QLQA 1WW4A 3ILNA 3B00A 3LSEA 3ZXKA 1Q56A 1C4RA 1YYNA 1SLAA 5HCBA 1KRIA 3OBRA 2P37A 1WD3A 4YGBA 1H9PA 5HCAA 3BOPA 4GALA 2ZHNA 2GNDA 4Q26A 3WDXA 1H9WA 1ULFA 1XQNA 4BMBA 1Q8OA 3AJZA 3WCRA 1V6NA 3R05A 4HL0A 1A78A 3WDTA 4PCRA 1CJPA 1YIFA 1LHUA 1SLBA 2A6YA 2VW2A 5GLTA 5T5PA 2ERFA 1IS6A 2GN3A 4FVVA 1GSLA 5EYXA 1CVNA 3TAYA 4BLIA 2GDFA 4DFSA 3AZWA 4K21A 2E6VA 4YZ4A 1MS8A 2R0HA 2A6VA 4MYEA 2ZGRA 3APBA 1S0DA 2UURA 2VH9A 5DUUA 3RSJA 5JOYA 1G9BA 3UK9A 3ZVXA 1YI7A 4Y22A 1GZWB 1LOGA 1WW7A 1JBCA 2WJSA 3AXEA 4K20A 4YM1A 1MVEA 1AX2A 2PHRA 2NZ9A 3WG1A 5H9PA 4FPKA 1DIWA 2DU1A 1DQ4A 2WNEA 4XJWA 1MS9A 1GBGA 4HANA 5DG1A 5FRAA 5IUQA 2JE9A 3SITA 3N36A 2Q5TA 2ZGUA 1GV9A 3POWA 1CN1A 3AP5A 4WZFA 3AYCA 4Y22B 5JMCA 4UW6A 2D6PA 2DVBA 2JE7A 4TZDA 3B9CA 4JRAA 2CWSA 5CBLA 3RMXA 1S0EA 1DYPA 1GICA 2PHTA 1I1EA 4GA9A 1HDKA 4Y24A 3M3OA 1DQ0A 1LULA 3WV6A 3VKMA 1SLCA 2AGSA 1AZDA 4AGVA 1VAMA 1VALA 1IS5A 1S0IA 1PZ9A 1DYKA 3R4SA 4H55A 4ZKTB 2D3RA 5GLUA 1FATA 4YG0A 2YROA 1MACA 1G9AA 3AZZA 2A3WA 4GWNA 4Q1PA 4YG6A 5DUXA 1Q8SA 1SLLA 1SCRA 1UMZA 1LJ7A 1JW6A 2DURA 2NYYA 1YO8A 1LEMA 5EYYA 4R9DA 4Q2FA 1SFYA 2H0BA 2DTWA 2P3JA 5DZEA 1LCLA 1LHNA 5IK7A 2XG3A 2EIGA 1CIWA 1FAYA 2NM1A 1YRZA 2OVUA 2P3KA 2PHWA 4YW4A 1MR5A 4AVSA 4DRRA 3B01A 4FPEA 2ZGSA 4GXLA 1J1TA 3WOGA 1W6MB 4CZSA 1LEDA 2CL2A 1JN2P 2ZMKA 1W6QA
chains in the Genus database with same CATH superfamily
1RUJ1 2QQPA 4QDRA 5I0SA 2P6HA 2XOMA 4IEZA 5A3TA 1F4AA 4FPFA 1BEV1 2WFF1 3AZXA 4LBNA 5CB7A 1S0GA 4TYSA 5F5IA 4AQTA 4K40A 4YARA 2OUJA 3DYPA 2ZAHA 4IGOA 1RUF2 2VZPA 3U14A 1W6QB 4OMCA 4C0HA 1V0AA 4RHV1 3ZDSA 5JIUA 2QQJA 4MGTA 2E7AA 2QZ3A 3ELNA 1AJKA 3KSCA 2WS93 4FPHA 3SH3A 4YW3A 1ZZ6A 3THCA 3O1RA 1JODA 2VQUA 4QPYA 4FAGA 4BM8A 3I7DA 4MVTA 4JDOA 3POJA 2YFUA 3LF7A 4PLMA 1EUTA 2K9ZA 4AWDA 1S0BA 2R6QA 3E5UA 4NJ4A 2VMEA 1F15A 2VGDA 2ZGNA 1PVXA 3ABZA 4I3PA 2YZ4A 4W8JA 1ZRCA 3CLPA 3DPRA 1JOJA 4F8AA 1TMF3 5FYMA 1CIYA 5FTTC 5FYZA 1UYPA 3HBZA 4HKWA 2GNBA 4QXHA 3LFMA 4FI9A 3ZIXA 2ARBA 1OA3A 4H3WA 3POSA 1OOPC 2O8OA 2Y26A 3PUQA 1OOPB 2WWUA 4QXBA 3KT1A 4Q4V1 1L7RA 5HXVA 2VNRA 5DAPA 2W3JA 4P08A 5FCCA 1H30A 4OI2A 2FCUA 5C5TA 1X33A 4XFFA 1WBFA 3RVHA 1C8NA 3E5QA 4MXWB 3D82A 4UAPA 5C6CA 2A6ZA 2XJSA 1DQ1A 1V00A 1RUF3 2ZX4A 4LHKA 3J9SA 5FZ8A 2RHPA 1TVGA 3IB3A 1GZWA 2XBO1 3O5SA 3ZXFA 1DCSA 2XWBB 3WDYA 2ID4A 4AAXA 3NQHA 4CCKA 1GUIA 3ACLA 5AFBA 4XFBA 4QGNA 3ZYPA 4WBBA 4XFIA 5IYYA 2Y6LA 1O3SA 2W91A 4OZXA 4YM2A 4LK6A 4BQYA 1VRH3 2J42A 3SH4A 3OY8B 3GDBA 3USUA 1XYOA 4AFMA 1DHKB 4COVA 1SBEA 1T6BX 1WZXA 3JQWA 5JI9A 4KG0A 4EE2A 5FPAA 2A75A 4CUGA 1VBD2 1JZ5A 1V6LA 1VAVA 2VW1A 3AYDA 1IQDC 1O4ZA 5BNNA 2HEWF 1N1TA 2P1BA 2EXHA 3B7MA 4LBQA 4XF0A 5F5AA 1QJZA 4ATFA 3IIAA 3ES4A 3U07A 3RG0A 3TEXA 1REFA 4IEOA 1ND2C 5JMOA 4LBJA 1ND2B 1C5IA 4Y1XA 4WM7A 3UV9A 4XHBA 5AVAA 1XXNA 4FOVA 1XNCA 1PGL1 2X29A 2WAOA 5FIXA 3EB7A 1PK6A 4RL7A 3ZN4A 1KFUL 5FBZA 4CP9B 2MNGA 4NAMA 1DGRA 2WQ8A 2J1EA 3CZJA 4EZ4A 3LEGA 2ZBJA 4CEYA 1RUE2 1UPSA 5EJ3A 1RXFA 1XSRA 2N7GA 3VBSA 1WLDA 2QTWB 3VV1A 3WNXA 2D40A 3ZPOA 4MX3A 4CYDA 1IG3A 1PMHX 4H14A 4QPIA 5E8AA 1DZTA 1NZIA 3ZMNA 4JGZC 4QHBA 4JGZB 3BI3A 4XAAA 3WX5A 1LOBA 3VD4A 3Q8BA 3M3QA 5BNPA 1VBD3 2Y34A 4UFLA 3WD5A 5BNQA 3WR0A 5IFPA 2JX9A 2WBKA 2D43A 4QX8A 4JKMA 4CCMA 4EV0A 4PBPA 2C1FA 2SBAA 2SLIA 1LHOA 1YWKA 3ITQA 4QDSA 1XJAA 2D6LX 5E89A 5GZGA 4LBOA 1G86A 3OYWA 3I4IA 1YC61 1ZX5A 2QQMA 5DUWA 5BPXA 3J7NA 4YGEA 5LK5A 3WG4A 1AR92 5A33B 5KC6A 3OPWA 3E6CC 5FY5A 5H9SA 2HWD2 3IZOA 4GWIA 4U2AA 4OHZA 1SG3A 2PAKA 1OSGA 2V4AA 4JQTA 4S2HA 1K12A 2W52A 4AFAA 3IN9A 1RUE3 5JXHA 1ZBE2 2RV9A 5GM0A 2ZX2A 3I2GA 4NPRA 4NWWA 2EXJA 3D6EA 3ZYFA 2D7FA 1ULPA 2FD8A 2G4IA 2MEV1 4B4PA 1HQNA 3LQCA 3M2MA 5K0UC 4DOUA 5K0UB 3VD7A 1BQPA 4K8RB 5CFDC 1CZTA 4BHPA 1XPWA 2RMU1 4MOAA 2XL7A 5CFDB 5JUVA 1CJDA 3I2JA 2ZXQA 1BKZA 3KB5A 2TBVA 3D0SA 4PF5A 5JXJA 1NLRA 4JDNA 3S0MA 1MZ6A 4FPJA 1N1VA 4A6OA 2BYVE 5FDBA 1NOVA 1RTVA 4E4HA 2ZZJA 4XUOA 1LTEA 1W8UA 1PZ8A 4RA0A 3O1TA 2CY6A 1K45A 5EXOA 1W0OA 3V65A 4DPNA 2EIDA 2WWSA 1RUI2 1AR73 1MPXA 3HD8B 1POV1 2WS91 4NAOA 1DLCA 4IE6A 5IT6A 5LASA 1NLSA 3RZMA 1AR93 3KF5A 4IUGA 2XKPA 4OUSA 5T5JA 3KD4A 2HWD3 5HBAA 3ATGA 3ZXDA 1XNKA 4OCTA 3FWEA 5LWBA 2RVAA 1GZTA 4M01A 3ZFFC 1PX3A 5IVEA 1FT9A 3ZFFB 2QQIA 1W8ZA 3PNAA 5FUNA 3KM5A 5A7WA 5CG8A 1SPPB 2VZ1A 3VDBA 4DMIA 2B9UA 1BVP1 3CDZB 3WQ1A 5D8AC 1HQLA 1V6KA 3K2OA 5GZDA 4WVVA 3T0BA 1RXGA 4FPYA 1AJOA 2WDBA 4AQ2A 3ILRA 5JXIA 1JYWA 2A6XA 5T54A 3LPFA 4CTEA 1WLWA 1QU0A 2ZPXA 5DDJ2 4LBMA 2TEPA 3NNLA 4Q0VA 5KC5A 4DS0A 4YFZA 4E8DA 3LIGA 3ZSKA 3O1OA 3GCWA 3ZSEA 4GKYA 2LM3A 3HBKA 4NR1A 1RUF1 4AI9A 1F31A 5FAXA 4AL9A 3I3BA 5SV8A 5FZHA 1AR62 3LZZA 3CJIC 5FXVA 3RI8A 3WNNA 3CJIB 1OXCA 1RUI3 5HPOA 2ZMNA 1CONA 1HJFA 4FFFA 1VJ2A 4FPLA 3K48A 4A3XA 1VRH1 5KBFA 4QX3A 1XB9A 3S30A 5T52A 1DZRA 4NHKA 5A3MA 4DINB 4Q8KA 5B4NA 2A3XA 3M1HA 4LBLA 2MPFA 1H2KA 1OFSA 2VZQA 3SMHA 1TNFA 2RS12 3OGGA 3WP4A 4HSLA 5FP3A 1NLQA 4ATEA 4IEWA 1MS1A 1W6OA 4OHWA 1S2KA 1HRV2 2RM21 3MW3A 3EXUA 5C3OA 2Z2SB 4RQPA 5E16A 1S4CA 4ZU7A 1FOD3 5I93A 2C4XA 3R4DB 4GD4A 3SKVA 3NRUA 3VDCA 1GLHA 1L7LA 5FXZA 3E1F1 2EICA 3MLJA 4M4RA 1VPHA 3AKQA 1UCXA 3VKOA 1POQA 3MV01 3U0ZA 3SCFA 2WZR3 2YFZA 5HXMA 1E5RA 3MUY1 4QX2A 1SQ4A 2C24A 1WCUA 3PUIA 4GQ7A 3V0BA 1AVBA 2HEYF 3RPQA 3E6DA 5FXWA 4C91A 1GQPA 1ND3A 2ZS6B 4ZS2A 4OUEA 1AR63 1WCDJ 5GZFA 4SBVA 5E1RA 3W20A 4CCDA 1HXS2 4LA3A 5C3RA 1XOYA 2W47A 2WNVA 4QX1A 5DAQA 5FWEA 4QT6A 4IEYA 4CU8A 4GH4C 4LKFA 4GH4B 2D5FA 4M3CE 5K4LA 2ZX1A 1Y3TA 4RGAA 1GZCA 2JECA 1WCSA 4AFCA 3ZPYA 1LHWA 1WA4A 2GNTA 2VOWA 1UYZA 5CKMA 3IPVB 2BNMA 1WWYA 2QUOA 1RGSA 1V6MA 3L2HA 4CDQC 2VMFA 4CDQB 4D7YA 1QJX1 2LRPA 2E33A 3ALQA 3OEAA 4FFHA 5LBBA 1HRV3 1K5MC 2JDPA 1LOCA 4FQZA 1K5MB 3O0VA 3KV4A 2DBIA 3R4UA 2ZZQA 3TB0A 1ZREA 1S0CA 4HETA 1PZ7A 5FY9A 1F5FA 2Z4FA 3B69A 4GMP3 4L92A 2XL9A 2O14A 3K75B 4ZPIA 1ZZCA 2C6SA 4MHUA 5F3IA 1PGSA 4BIOA 3TNPB 5JDBA 3DXUA 4K3UA 3B3QE 4QHOA 2J1VA 5FP8A 1W9SA 4Z2AA 4BYYA 2R1DA 2WT1A 1AYN2 3BN6A 3HR9A 2AREA 4WM8A 4MGYE 4LR4A 3WW4A 1RUE1 4TTGA 4CCNA 3U1XA 2WQZC 2VMGA 4XJ8A 2W08A 1PMJX 3ASIA 5C4WA 1JXNA 4E27A 1UQXA 4EN0A 3I3MA 3ZDVA 4BPZA 2QVSB 1H2MA 4Q8LA 5EJ1B 1WLCA 1QQP3 5FMDA 4D7TA 3BTZA 2AYHA 2ZMLA 1VBC1 3BODA 5C3PA 2GMMA 1LB2A 3UYJA 4AHXA 5CAZA 4NN0A 2ZGKA 3ES1A 3NNMA 1QXRA 3L2YA 4EN6B 1O5UA 3JB4C 4J1WA 2ETEA 2KD7A 5HV0A 3ZXKA 5I0DA 1AL22 1C4RA 2WNUA 3JQXA 4IE4A 1XC6A 1P8JA 1EAH3 3OBRA 3DPRC 1S2BA 1WD3A 5FYBA 5IVVA 2XPJA 3DPRB 1G6NA 5FLHA 4NIHA 4GALA 3DV8A 1R1A1 3URFA 4OVEA 5EQUA 4OI4A 4DZGA 4MLOA 4MGZE 3VBHA 5A3NA 1Q8OA 3U10A 1AR71 1QWRA 1JYVA 1RUJ2 1U5IA 3LKJA 4JTOA 1YIFA 4A7ZA 2Z69A 5IVJA 1SLBA 4UOJA 2FZ1A 1AR91 2ERFA 1BEV2 2GN3A 4FVVA 4DFSA 1CVNA 1F2NA 3KGLA 3KS7A 2WZPP 3HT1A 1MEC2 1MS8A 2A6VA 2R0HA 3FHIB 4MYEA 1AYN3 4P9JA 4WVZA 3APBA 4LHSA 1AR81 2V09A 4X6QB 4DIQA 5BUVA 4XABA 5FY8A 1ZNPA 4CCOA 4GB31 3WNOA 1GZWB 4PF1A 1JZ2A 4DXZA 4PT6A 1X9TA 1MVEA 2G9GA 2YB7A 3WG1A 3NSTA 2R30A 1YQ6A 4IE7A 5K7PA 1GNYA 1MS9A 4IL7A 1Y9QA 5FRAA 2JE9A 3SITA 1C28A 1GV9A 3POWA 5JMCA 2DVBA 3B9CA 5FFOC 1VBB2 4JRAA 1HN1A 2CWSA 4P9LA 4LULA 3THTA 2VCCA 3HNMA 1S0EA 4KQ7A 5FZ7A 5BNNC 1GICA 5BNNB 1UKRA 3LGRA 3NAPA 1HDKA 4Y24A 5DMYA 4AI2A 2BBAA 2J1SA 1DQ0A 1LULA 2IXLA 1RUI1 2HWC1 3KV6A 3T08A 4Q4V2 4LORA 1RUJ3 1AZDA 1VALA 1LRHA 2G1MA 2RG4A 3AKPA 3I2DA 2HBUA 3R4SA 4A4AA 4WM7C 1BEV3 4BB3A 4WM7B 1FATA 3CQOA 1MACA 5FLJA 1PK6C 1O59A 1SHWB 1MEC3 1PK6B 1LR5A 3P1IA 1KXGA 4OHVA 3KV5A 1SCRA 1JW6A 1FPN2 2DURA 2XBO2 4CA9A 4CEYC 1SDWA 4IEQA 4CEYB 2P4EA 2WO2A 2H0BA 2DTWA 2P3JA 4V1PA 5DZEA 4D3WA 3O1VA 2BW8A 1R64A 2NM1A 1YQ5A 1PO12 2P3KA 2QQOA 3EO6A 4FPEA 2ZGSA 2YUEA 4NIAA 2BFUS 2F17A 2MHFA 4EN8B 1FOD1 4QPIC 5EP9A 4CZSA 1LEDA 3BYWA 4QPIB 2CL2A 1UY2A 2ZMKA 4XC9A 5TSWA 3U4SA 3ZMOA 5I0UA 1GQGA 3RZLA 1YHFA 2WZR1 4YPJA 1VBB3 4EZHA 5BNPC 4QM9A 3MLLA 5BNPB 1OQ1A 4BISA 2PN5A 3I8TA 3D4KA 1AXYA 3LEIA 4XBQA 3JZVA 5FKBA 4BQ5A 5I0TA 1KS5A 3FLTA 1V6IA 1D0GA 1ZM1A 5FZGA 2KM2A 3GM8A 4NHLA 2YHJA 4P5HA 3AC0A 3BU7A 4YG3A 1ZRDA 1X50A 3TEWA 2Y6GA 5I8TA 3LFIA 4JZRA 2NP0A 3ECQA 2OT7A 3RYKA 2VULA 3ZXGA 2VD7A 1FPN3 1GWLA 1US3A 1FNZA 2HEVF 4PQQA 1IOAA 5EPAA 1F8VA 1IS4A 1PO13 3SKJE 3C7FA 2A71A 5F32A 5FZMA 1HRV1 2W1UA 2ZOEB 4BQ2A 5C3SA 2FZ2A 2XJPA 4AEKA 4LKEA 3ZFGC 4CDWA 1NG0A 4LPLA 3ZFGB 4YW6A 4XIOA 5KHJA 2J1TA 4GMP1 5DXDA 4ASMB 3K77A 2ENRA 4M0NA 2JDYA 3NNJA 1U5XA 4QDQA 1PVC3 1UXZA 2Y33A 4CDXA 2ZGQA 1HB4A 1RUC3 2D3SA 4BDVB 2Z79A 2H6BA 5T5OA 4YZ2A 4UBGA 1JYTA 4NPMA 2ES3A 2I2SA 1X7NA 3WZ1A 2QFEA 4FTEA 5CA6A 1UYXA 4Q5OA 4UW3A 4YM3A 4NIDA 5D21A 3HNBM 4RS5A 4Z07A 4HK8A 3BIWE 2A3YA 2CDOA 1PIV2 4ITCA 1J83A 1NZCA 1QQP1 4P00B 3WDVA 3NMBA 4ZU4A 4NHYA 2JICA 1WCQA 3RRDA 4R9CA 3W59A 4LLOA 1UKGA 2AENA 4NWVA 1VIWB 2Q1ZB 2IXHA 2OKXA 2Y0IA 1IHMA 1OPOA 2Q4SA 5F8PA 3P3PA 1L7QA 1EAH1 1LU1A 5LBCA 4BQ1A 3W5NA 2B7YA 4COYA 2WN2A 1D7PM 4AFBA 3PJQA 4FP2A 1JZ4A 2VXJA 2HBTA 2MEV2 1A3KA 1OLRA 2E7TA 5A6YA 5KHHA 1OA2A 2VUJA 2ZGTA 2KA3A 2WO7A 5A7PA 2WR9A 1G7YA 2WKKA 1HIXA 5JPMB 4XFGA 4KBBA 1LOAA 4AZZA 4CP0A 4M3CF 2R042 2ZGMA 4Y5SA 1LESA 5FO9B 3H42B 2VZUA 4EJRA 5AFEA 1Y4WA 5C70A 4FFGA 1RHI1 5A3LA 2Q8CA 2BNOA 3HN1A 2J22A 1IZ3A 2Q1FA 5FPXA 2E53A 2QKDA 4LK7A 2JKXA 3AP9A 1NE6A 5IHRA 1PIV3 2WS92 3WXPA 3AFKA 4P9WA 5DN2A 4Q29A 3KT4A 2A7AA 1UZZA 4N53A 2YXSA 3TN91 1IG0A 3JUUA 1Z78A 2D6KA 3RWKX 1QXPA 3LE0A 3IAQA 3PURA 3WG3A 5JOZA 1DQ6A 2ZCWA 4YVSA 2F4PA 2WABA 4WVMB 4MHRA 1GZ9A 3KLSA 5C33A 2Q30A 5KXBA 3CL1A 3JU9A 1CX1A 4YW5A 2W39A 5FZ6A 4JCKA 2FBEA 3NV1A 1SDDB 1UNBA 1GOGA 4N8MA 2MEV3 1AX1A 4QKBA 3P6BA 2YY1A 3FZ3A 3KT7A 4O7XA 3HT2A 1W6OB 2IFRA 2ZEZA 5HCHA 4KWKA 3AL6A 2GZWA 3D0JA 4OFGA 5JOYA 1GKBA 1W0NA 2JIJA 1SFNA 1G9BA 5CU1A 5I8YA 1ALYA 1EPWA 2WN3A 4J1XA 4BQWA 3V0AB 5A32A 2R043 4AGRA 3IWZA 2HYXA 3LA2A 4AYUA 4D69A 1MEC1 3MFCA 4LE4A 4LE3A 3HNYM 1W6NB 3V0BB 1V9U3 4D6RA 2VUCA 4YWAA 1QOSA 3GALA 3WY6A 1MS5A 3VBFA 1QH6A 1JZ3A 4Q4Y3 5BXXA 2RDNA 5EHDA 2YG0A 1POV3 4K1YA 4A44A 1XNTA 3VKLA 3WEZA 2WNVC 4LBKA 4JHZA 1VRH2 2Y6HA 2WNVB 5DZGA 5J48A 2ZX3A 1ZA4A 2AH2A 3DN7A 2Y64A 4QQLA 3WQ0A 3IDAA 2FQPA 3WF1A 3NV4A 5D1IA 2XQXA 3SH5A 2G9FA 1SACA 2VMDA 3JB8A 3LWCA 4YGDA 1VBB1 3ZM8A 2HH9A 2Y6FA 3AL5A 4CU9A 5FZKA 4D94A 4NO4A 3CZUA 2BPA2 2Q8DA 3EYPA 3WNLA 2BGCA 2R0FA 1MQTA 2QQKA 2E9QA 4M0HA 4YNIA 4GULA 3ZXJA 2RM22 2XUEA 1NXD1 1JH5A 4HOOA 4QQ2A 3MW2A 1NCQA 2JG9C 2PYTA 4JGYA 3WHTA 2JG9B 4XF4A 4XJ9A 2JG8A 1XYNA 3QCWA 5F6KA 1LNSA 4LA2A 4AVBA 5FYIA 2ILMA 1UZ0A 4MH0E 1GP4A 2W95A 4GAZA 1SEFA 1YEWA 3H8UA 3BKZA 4I09A 5B4XA 5BNOC 5BNOB 3VGIA 4XE9A 3J8F2 4IERA 4KU8A 5EZWA 2ZGOA 1FPN1 5GLVA 3LAGA 1F5JA 5C4WC 3V56A 5C4WB 4J25A 2E7QA 1PO11 1G8WA 3AVSA 2VMCA 1C1FA 2ET1A 5FYVA 2BRTA 4JKLA 2VAUA 4QXKA 1ULDA 3WT3A 4RD7A 4BE3A 4CUCA 2WL1A 3MV11 5FZ1A 3KCYA 2VU9A 4JHTA 4BXSV 5B2GB 2EVXA 3BGAA 1PVC1 2B9VA 5IW0A 1RUC1 5IATA 1FMD2 3MIDA 5KXEA 2JD9A 5L9RA 4IXLA 1Y7BA 4OMDA 2XJVA 1QJX2 3MI8A 4XF1A 1MVQA 2VMHA 3UGHA 5F3CA 2RM23 2VZ3A 4N9IA 2DCZA 1QHDA 4W50A 1J58A 1HN0A 1RUOA 2BGPA 3RJRA 4FXGB 3WQ7A 3SCHA 2IFWA 3OSDA 4W6XA 5IK4A 5ANNA 1IKQA 1ZA7A 3KHBA 4UW5A 1AXKA 1C3HA 2VQTA 2XMLA 4FOWA 1KJLA 3DECA 3J8F3 5L9BA 5DAXA 3ZSJA 3RNSA 4ONUA 3AP4A 1CWPA 4BOWA 4QB1A 1CPMA 1DZQA 4LO8A 2PHXA 3AMQA 5FPLA 4AK3A 4N90A 2V72A 3UETA 1GR3A 2RDRA 2YU2A 3ACHA 3AK0A 1VBC2 2DV9A 5FY1A 1L3JA 1UXXX 4QX0A 4UWDA 4R9AA 4DXSA 1EP0A 5FPUA 3RZGA 4AAPA 5KXDA 2WINB 4KGQA 2D97A 4Q4W3 3Q8AA 3WDWA 2CSGA 2BGOA 4D6QA 1OKQA 2GN7A 1FMD3 3HAGA 4FP3A 5A3PA 4AHZA 3CHXA 3O1PA 4HVRA 2OUHA 3D8CA 4TSVA 2VZRA 3ROUA 1QJX3 1R1A2 4L9BA 4XCAA 2G9ZA 3LIHA 3ZFEA 2VQ0A 1PM4A 5FZOB 5IK8A 1KJRA 1W6PA 1BZWA 1TME3 1UN1A 2VPVA 3OUJA 4XTMA 2DWRA 4IGQA 1AR72 4Y1ZA 1JI6A 4Q27A 1W2OA 1PIV1 3B93A 3A0KA 3GZTB 2GC2A 5FP4A 3DYOA 5FJKA 4ORFA 5DUVA 2E32A 1X8EA 3H1WA 3JD72 3CJXA 1X9PA 1T6GC 2QCSB 3P3NA 2GMEA 2D6NA 3VDDC 1XRUA 1AR82 3ZLIA 3VDDB 1ENSA 1DQ2A 1KDMA 5A7NA 3UKTA 1RINA 4COUA 1M06G 3SCGA 5F1RA 3MHZA 4GB32 3H1MA 4LO6B 4XJUA 3OBTA 3IDCB 2RS52 1PX4A 1VE0A 4Y26A 4DUXA 1BXHA 1W28A 2P17A 4XBLA 1HRI1 1W8FA 1I5ZA 1VBC3 3WP5A 2UWAA 5F5CA 4YZ3A 2JB8A 1JYIA 2A73B 4W6WA 3B9IA 2I74A 2W68A 3PVNA 4DEVA 3GNEA 3POYA 3QOPA 5IWFA 3WINE 2VTXA 4LNVA 4LT5A 4AOCA 2R041 2ZAAA 4JTNA 2OYZA 5A6ZA 2GH2A 1UAIA 4FTBA 2YMZA 3RI9A 1R1A3 1V9U1 2DU0A 1Q8QA 2EXIA 2R7EB 4IE0A 3W21A 3IM0A 1LOFA 1XU2A 3INAA 4K9SA 5FMCA 5FYYA 3KCXA 4F83A 2HWC2 4Q4Y1 1W03A 2X10A 3GXUA 4Q1RA 3BU0A 5DG2A 3AP6A 3ZSLA 2P3IA 4E4SA 5F37A 1CPNA 1SLTA 2D6MA 2GSYA 2WT0A 3M7AA 3M8LA 4H2AA 4XETA 3OBAA 4DQAA 3O0XA 4URAA 1H6XA 1YFXA 3JD73 4RR3B 4HPKA 2E63A 4QMAA 2EAKA 1WW6A 2GALA 1OQEA 2R49A 1AR83 3QH7A 4R9BA 1CAWB 1YXWA 3QLQA 4XEZA 1WW4A 4GB33 4XFCA 1UOJA 4F7ZA 4CUBA 2QNKA 5CG9A 3E5XA 1CAXB 2RS53 1PMIA 5JR7B 1B35A 4YGBA 4QPGA 1H9PA 1UOGA 5D8AB 1NT0A 4FTSA 4J6GA 5HCAA 1W2UA 4E4DX 3GCXA 5JAXA 2ZEYA 3WDXA 1CAVA 1OLME 3HQRA 4S2DA 5EFUA 5JSOA 1DYOA 1ULFA 1FOD2 1XQNA 2A1XA 4BMBA 3MIFA 4K7JA 5AC93 3PLQA 2LUWA 3FX3A 3WDTA 3ZN6B 1UMHA 2DF7A 4PCRA 5FLIA 4P9IA 4A7YA 2WZR2 5T5PA 2W87A 2VBPA 2X5IA 4CDXC 1REEA 1IS6A 1GSLA 1NA1A 1JZ6A 1WMDA 4HG6B 2WO1A 2GDFA 3KQ4B 4K21A 2E6VA 4YZ4A 2X8KA 3FMGA 3VD5A 2B4KA 5JSRA 2VH9A 5FZ9A 1OUSA 1RYYA 1WMEA 5DUUA 3RSJA 4W6YA 3LEMA 3VZJA 3UK9A 1O91A 2HWC3 3VBUA 3ZVXA 1AL0G 3C7OA 1BVVA 2WZ8A 1ZYBA 2FDIA 4FSJA 4RS5C 1WW7A 4P02B 4RS5B 2WJSA 3GHNA 2B46X 3OD4A 4RR3A 1QEXA 1NKGA 2Q0AA 4AG4A 5H9PA 1O7FA 3RYPA 2DU1A 2WNEA 1NYWA 2LS6A 3ETQA 3ZO0B 3MIGA 4LO7A 2YBSA 1KGYA 2BFUL 3AP5A 4Y22B 3BOWA 2JE7A 3K3OA 2H0VA 2VUDA 1UU5A 5A1AA 2YBPA 5CBLA 4XF3A 3RMXA 1CZVA 3VL8A 2VMIA 4BH9A 4IV3C 2FDGA 5CKNA 5ISLA 4IV3B 3K46A 1I1EA 3AKTA 2C0ZA 1F35A 5C9AA 3M3OA 2IXCA 3WV6A 2AGSA 4BA6A 3MBWA 5GKAC 4NRPA 2BJSA 2FDHA 3FL7A 5FYUA 4A3ZA 1PZ9A 4H55A 1FXZA 1IPKA 3KV9A 2E31A 2D3RA 3E6BA 5FY0A 3FFQA 4NRQA 3J8F1 1NCRA 1G9AA 3AZZA 4GWNA 3EJKA 4QB2A 4YG6A 1RUG3 4LMFA 5JI7A 5LZ6A 1Q8SA 1YO8A 4AQSA 3G6JB 1LEMA 4L11A 3VL9A 3F2ZA 1QQP2 4NMIA 3NKTA 4HBNA 5IK7A 2XG3A 1G9DA 5FQ0A 2OVUA 2OZ6A 2PHWA 4YW4A 2Y60A 4QX5A 4DB5A 2P6CA 3NJYA 2JDNA 2XR4A 1F4HA 3B94A 4LEJA 4Q4W1 4XFHA 3I2OA 4YVSC 2D98A 1W6QA 4YVSB 1FMD1 4FO9A 1EAH2 4WZCA 5KHGA 1YIPA 4XCBA 2V5YA 2UY8A 5FZCA 5A7QA 4I3GA 3T30A 4B8EA 3ZX7A 5JPNB 4F3JA 3ACGA 4BLJA 5LA2A 1XNBA 5DZFA 1TME1 3U11A 4AE2A 2ZTNA 3QBQA 1SLIA 2P5BA 5LRRA 2WC2A 1PM7A 3L9JT 4YW7A 1BJQA 1I6XA 3POIA 2IXJA 2JIGA 2EIEA 2VUAA 5FK8A 3RYRA 3J7MA 2JD4A 2WYFA 3POEA 3GBWA 4B29A 4ZONA 2W1SA 1YQ2A 1HLCA 3KVBA 5BY5A 4D7SA 2O8QA 3AB0A 3KF3A 1JUIA 5A32B 4ARXA 4YFWA 3HWJA 1RHI2 2FCTA 4IEPA 4ZY9A 3POFA 1COV2 4OHYA 4AI8A 5CISA 4SLIA 1QMJA 1ZZ9A 3O7OA 3I59A 3VBFC 3VBRA 5IAXA 4ZU5A 4B4RA 3VBFB 1N3PA 1Q8PA 1E5IA 4C1WA 5JSPA 1R082 4B7EA 1Q3EA 4EWDA 3FFZA 5FOBB 1HB2A 3TN92 2IXIA 3WUDA 3ZXEA 1U0AA 5FY7A 2DCJA 2CGNA 1W2NA 3H3LA 3T1MA 1DGLA 2AEZA 4G9SB 2EALA 2FMDA 5AVPA 2NPIA 2XVKA 4PLNA 4WVWA 4Y4YA 1AUYA 2PFWA 4RSUA 5IK5A 2AC1A 5FPVA 4CEWA 5J1XA 2JDMA 1REDA 1UIJA 2UY9A 4LQRA 1CESA 3DYMA 4DO0A 1MQTC 2OA2A 1MQTB 3ZR5A 3C7GA 5LBFA 3FHQA 3OPZA 4LKDA 4HKOA 2CWMA 3AZYA 3NV2A 1U5YA 2OXBA 4OQ8A 2YC2A 4C90A 3UT0A 2JG8C 2JG8B 1OPMA 3JD71 5J7MA 1JHJA 5LA9A 4CXWA 3U4XA 4PIXA 2ZA9A 3KVAA 1CGPA 1UPIA 2PA7A 3S7IA 1JYNA 1DGRN 1ODMA 1I3HA 1RHI3 4FQ4A 1POV0 2WUHA 3LPGA 5IFTA 1COV3 5KHKA 2RS51 1UU4A 4ES8A 3T3YA 5CADA 4P9XA 4MG2A 2Q8EA 1R083 3VZLA 5FMOS 3MDPA 3OPTA 1LHVA 4MSVA 3TN93 1ZBA3 2QQUA 3ZR6A 1CAUA 5KXCA 4QAWA 4UFKA 5AC91 1XE7A 1W8OA 3DXTA 3MIEA 3USUB 3BPSA 1AYM3 4XIKA 2DUOA 1DGWX 1GP5A 2DCKA 4ISRA 5DPNA 5EIYB 3BALA 3N9NA 1QOOA 2JE8A 4MADA 5ANQA 2VCBA 3IDEA 2ZGPA 5FZFA 2QBXA 5BYNA 4Y1YA 2CNAA 4TN7A 4X8NA 3A23A 4Z8BA 3I2FA 3OUHA 3C7HA 4RN5A 5JOXA 1WD4A 1WUVA 1BK1A 3HVDA 4K1ZA 4LBQB 3Q9OA 3ZIWA 3FLPA 3CO2A 3A0NA 3VLBB 4LO5B 1ASJ3 1O6UA 2VTFA 4FPOB 4L0PA 4IQPA 4Y1VA 2R072 2WRAA 3VHPA 4CP2A 1ENXA 2DBNA 4XW3A 1RITA 1W8HA 4TXWA 4C0BA 2FCVA 2DFBA 3OD0A 3PMSA 2HWE2 3THDA 3OGRA 3UL2A 2BU9A 2CGPA 3I2IA 1YI9A 3MGUA 2DVGA 2P34A 4AVAA 4GJYA 5IVYA 5BV6A 3RS6A 5LW9A 3BIEA 3O0WA 1SCSA 4OZOA 3M70A 3NO8A 1N47A 3TBDA 1OMIA 1A8MA 2VZOA 4B1LA 3T4VA 3FN9A 5E6HA 4GWMA 4AVCA 3ETPA 3VKNA 2PELA 3T2PA 3VBSC 4EWEA 5FZ3A 4LKSA 5LEJA 3VBSB 3LDBA 4G3YC 1RVF2 2VL4A 4AEMA 2XJQA 3QH6A 2DUPA 2VOXA 4IEVA 4META 4N43A 4R8HA 5A7OA 3FJSA 5J98B 4A42A 2UWCA 2YV8A 4O65A 2ARXA 1UZVA 4O9EA 3IMNA 5SV5A 1Y9MA 2NLRA 1PVC2 4A6SA 1N3OA 1W9YA 1RUC2 5M0TA 3BB6A 2CYFA 2FDJA 3T1LA 2W2IA 1LGNA 1LGCA 1ULCA 4AGGA 2ADEA 2J1AA 4FBFA 3H0OA 2B5HA 1PO22 4KBZA 2I45A 2E26A 2GMPA 1VBE1 5K0UA 1RUG1 4FOQA 3ZFEC 4MV2A 4AVTA 2VECA 3ZFEB 5CFDA 1RJ7A 2ZGLA 3HN3A 2JDZA 5A1LA 2R073 4FXKB 2QQLA 1MS3A 1ENRA 3TWIA 3WF4A 4YGCA 4YYOA 1NAEA 5FZ0A 3OYWB 1RIRA 1TZOA 3ZSMA 2HWE3 2VOVA 3NNFA 3JCIA 1FNYA 4JC1A 3H8XA 3H9AA 3VUOA 4QKDA 3RMYA 3H1YA 4CCEA 1W8NA 1DDLA 1APNA 3LDKA 5G04L 1FV2A 3IKWA 2JDAA 2RJ2A 1ONAA 2XVLA 3UJQA 2AZ5A 5EV7A 4XURA 4QQHA 4UXAA 1S55A 1ST8A 3N35A 3LSDA 3IDBB 4XQ4A 5LATA 1Q43A 1H1IA 1UL9A 4NIIA 5A6XA 3DGTA 5JIAA 2WAAA 1VAKA 2HWF2 1KEXA 3K3NA 1SBFA 1RVF3 1K5JA 4ZZ5A 5ACA2 5GZCA 5H9QA 4OI0A 3SISA 1LECA 5JVVA 1UY0A 1X82A 4MGIE 1US2A 2D93A 4YLZA 1UY4A 3VKFC 4EN7B 1OF4A 1UMIA 1XE0A 4P9YA 4H7MA 2QZ2A 4Y4RA 1PNGA 3BTYA 1E5SA 3AMHA 5L7OA 2PXJA 2BP6A 1SPPA 2BQPA 2QJVA 2XKOA 3KGZA 2GP3A 1EY2A 1PO23 4CDUA 1DLLA 3WP6A 1VMJA 5FYHA 1ZRIA 1EUUA 1R1ZA 3SEEA 1BBT3 3ZYRA 3UNPA 4JKKA 3T09A 3UKNA 2OW4A 3MF6A 4RFRB 2J7MA 4B4QA 2OQ7A 5FP9A 1OQDA 4GJZA 2JDKA 3GZAA 1JOPA 3AZVA 3I54A 2DFCA 2DVDA 5I8SA 1EPZA 2D5HA 4PQ9A 1MS0A 5LRSA 4FPGA 3NV3A 4HPKB 1JUHA 1OT5A 4M4PA 1VB2A 3ME2A 3PUHA 4PHZA 3T4HB 2ADDA 3FUOA 4R4XA 4QD2A 4AR2A 5A7WB 1ULGA 1B09A 3OJBA 4Y33A 3C8XA 2JJ6A 3C2UA 3HMYA 3FE5A 1B35C 4QPGC 3PUAA 1HRI2 1B35B 1OA4A 2HWF3 2TNFA 1FX5A 1RUH3 1WBLA 3NW4A 3OG2A 4QPGB 4YW2A 4KWLA 3VHOA 4CU7A 5ACA3 3NKGA 2XLFA 1CAVB 1WW5A 5FWJA 2BBVA 2C9AA 2ORXA 4IV1A 1Y43B 2E51A 3MICA 3WP3A 2AR6A 2VBBA 5IJRA 2LALA 1KQRA 2X5IC 2X5IB 1BYHA 1DP0A 1NA1C 1YFYA 5CNAA 3TYJA 1NA1B 1FI2A 1V9U2 2YBKA 1X8MA 1C1LA 1COV1 1H0BA 3KZ4C 1OLMA 3DL3A 5A7SA 4WV8A 3PIJA 3GHMA 4I0AA 2YGMA 1H8TA 4YM0A 3S6PA 4Q4Y2 2WA3A 1LOEA 4XACA 2BOJA 3UESA 1ULOA 2YU1A 3VBUB 3VBUC 1D4M1 1R081 3Q8CA 5FZBA 4LHNA 3VD9A 4COWA 4V2VA 5T50A 1JOBA 3ZYHA 4RR3C 1ZBA1 3W5MA 3IIIA 3CKHA 1JMUB 2BZDA 2V4VA 2CDPA 1OH4A 2HWB1 4OYUA 3DKWA 4UW4A 4XZUG 3POGA 4PBOA 1RMU2 2WFPA 5CYYA 1AYM1 4Y20A 4AI3A 1QJU1 4JDMA 4QHZA 1UY1A 3LD8A 1ZRRA 3S5AA 1BHGA 2UYBA 2VW0A 1SZBA 3SXWA 2W46A 2JKBA 1RJ8A 1HRI3 3AMPA 4XQDA 2A5ZA 4O61A 4COZA 1DFQA 2KXLA 4CXXA 1ASJ1 5A80A 2QDNA 2IC1A 4Q4X2 4RQPC 4RQPB 4D8MA 1OH3A 4CCLA 2LTNA 1V6JA 1W8TA 2UU8A 3ORJA 4QB6A 3MUZ1 3M3EA 3IPVA 3LOIA 4IE5A 1NX9A 3WW3A 1T2XA 1R093 2BTVC 3WUCA 4TWTA 4BK4A 4CDQA 3LA3A 1ZZBA 4X6RB 3SEPA 4HK9A 4UFIA 3WW1A 3ZYGA 4XHXA 1ND3C 1ND3B 5CFCA 1LKNA 4L8QA 5JZGA 2L9LA 4HFSA 4O9GA 4AHYA 1W2AX 5F3GA 5FOJB 1AX0A 4LLFA 5EJZB 2G19A 1IS3A 1IPSA 1DG6A 5FQ0B 3UJOA 4XXAA 1SBDA 2GP5A 3AYAA 2FHRA 4LJHA 1RMU3 4MZUA 1QH7A 2IVJA 4UF0A 4NHXA 5FV3A 3O1SA 1Q8VA 2OPKA 4KU7A 4LOTA 3H8OA 4LBQD 1WMXA 2B8MA 4I0WB 1AHSA 4DXRA 1O8SA 2DCTA 2PLV1 4CRQA 3LDRA 3FHAA 1O3RA 1JYCA 3MPBA 2NN8A 3RZKA 2DDUA 4CPBA 2Q1MA 3HQUA 4M3CA 3WW2A 1OBNA 4QGMA 4BJ0A 2R071 1AXZA 4Q4X3 3PTRB 1JU3A 1RUNA 4NPLA 1VP6A 1DQ5A 3P5BA 3I2KA 3RWNA 2XJTA 2HWE1 1JZ7A 1HQWA 1XNAA 2YC0A 3NJXA 3K4DA 3T2QA 4EN9B 2I07B 2PTMA 3DEMA 3TNQA 3H8RA 1OVSA 4WM8C 5F39A 4WM8B 1FYUA 5J36A 5FPBA 1KS4A 3IT8A 3LSEA 4CSWA 1PNFA 2XWJB 4INDA 5LB6A 3VBRC 3I59B 1C8M2 1SLAA 3VBRB 1KRIA 2P37A 3I2HA 1RVF1 3GYDA 1NQDA 2CHHA 2VZVA 3H3UA 4Q26A 1H9WA 1VRBA 4UYBA 1JU4A 4BCUA 3AJZA 4Q4W2 3R05A 2WNUC 1GQHA 1A78A 4HL0A 3KWVA 2WNUB 4Y5TA 3BUCA 5GLTA 1VB4A 2VW2A 4RFT0 5K9YA 1PO21 1QJY1 3N9PA 3OF1A 4R52A 4CEWC 5EYXA 5IVBA 4BLIA 4GMP0 4CEWB 4TLFA 3AZWA 1BBT1 5F3EA 1TME2 2WYSA 3VBHC 1DF0A 2WQ4A 3VBHB 1S0DA 2UURA 4DUVA 3NL1A 5LBEA 1YI7A 3ZYIB 3NJVA 3EMRA 4B7KA 2YPJA 5L36A 2X53S 1JBCA 4ASKA 4ZZ8A 4JQRA 4HKLA 4FT8A 5FZAA 1O3QA 4FPKA 1W9FA 3WSOA 1DQ4A 4C8DA 1GBGA 5DABA 5IUQA 1EYBA 2BUKA 4FAHA 4AW7A 5A6QA 3IAPA 4MXVA 2Q8OA 1O8PA 1RB8G 1CN1A 3TEZA 4UW6A 1IGOA 1QXJA 1C8M3 4YVWA 2HWF1 4NHMA 1H8VA 2RS31 4IESA 1RUH1 1PGW2 4FCAA 4R4ZA 4AFDA 5CEHA 5ACA1 5LK7B 4HXCA 4G4FA 1DYPA 3Q8EA 4IEUA 1OD5A 1CAUB 4AF9A 1Z7S2 3HJRA 3ZXAC 1VMFA 1VAMA 1S0IA 1JYXA 2Y6JA 4NRMA 5IVCA 2OIIA 5LCWL 4ZXKA 4HVQA 1HJGA 1U12A 2C9KA 5GLUA 2YROA 1UD1A 3EBRA 4UBHA 4AEDA 4HN0A 3NAPC 1QY4A 2A3WA 3NAPB 3ON7A 1ZZ7A 4Q1PA 5DUXA 3F95A 4PDWA 2CGOA 1SLLA 4XUPA 4BQ3A 3PU8A 2JB4A 4Z92B 4NVPA 4Q2FA 4DEQA 3TRSB 1LCLA 3NNGA 1CIWA 1FAYA 4AVSA 1MR5A 4BQ4A 1GFF2 5C5UA 4GXLA 1J1TA 4QU1A 3A21A 1WGPA 2ZEXA 2AACA 5JWPA 5FK7A 3AMMA 1IPJA 4LOSA 2PAEA 1WA6X 3JBG2 3OTFA 5FPZA 3CU7A 3PMEA 4M00A 1QJFA 5F9TA 4I30A 3OGJA 1MZFA 3USSA 3CEWA 1KDKA 4N43C 5L19A 5JCTA 2OQ6A 2W1QA 4N43B 2FMYA 1E5HA 3PVOA 4DY5A 3J26N 5AC92 1Z7S3 1XBFA 4JRLA 3AXDA 3EQEA 4AI1A 3UGFA 2HYKA 4BIFA 1R091 3ENRA 1OHFA 1ACCA 2UYAA 3AFGA 1W9TA 1XE8A 2YC4A 1I5PA 2JDUA 5I91A 2GNMA 3X29B 1C57A 3BCWA 4Y5Z0 3WF3A 3ZFGA 1D0HA 3WLUA 3VZMA 2QDRA 2VVDA 5FYCA 5JOWA 4EROA 4Z2WA 1JHNA 3I3QA 1Y9GA 1QKQA 2D6OX 2R062 4NE9A 3VBOA 4ES9A 2HLEA 4B3NA 1V6OA 2VC9A 3RZJA 1TNRA 4XDOA 2AEYA 3N4MA 3N9LA 1RMU1 5C8CA 3DF0A 3ZKUA 2IVIB 5FMOL 3ZOIA 2VTXJ 1MZEA 4QU2A 1HB3A 4GWJA 1WCKA 3OB8A 3RFRA 4HMZA 4X8PA 2DUQA 1N3QA 3JBG3 3MLKA 4Y1UA 5FUPA 3QACA 1W90A 3H50A 3GF6A 1TQ5A 1VBA2 5ABJA 3BPZA 2EAAA 4CDWC 1F9KA 3NJZA 4Q4X1 4CDWB 2XQRA 1O3TA 3LCPA 3TOJA 1IKPA 5J09A 4GKXA 5C71A 1GMMA 1J84A 4XJZA 3O14A 3N7LA 5IAVA 1OKOA 3PJYA 1OD3A 5L7OC 4CDXB 5DQ0A 5J96B 1ZBE3 5L7OB 2QQVA 1ULEA 1TMF1 5FZIA 4FFIA 4N7IA 1CX4A 4DRVA 4CDUC 2RE9A 5G05L 4AVVA 5KR7A 1BLZA 4CDUB 1VBE2 1RUG2 3W58A 3MFAA 4XF9A 5LY2A 3SLIA 3N7MA 4HT1T 4XAEA 2PHLA 4Q0UA 2WSUA 2B39A 2X05A 2VNOA 1UIKA 2D44A 3D5OA 4QKNA 1AF9A 2R063 3N9MA 3N7JA 3SC7X 3EHKA 2PHFA 2VVFA 2GU9A 1QNWA 2XDVA 2YGLA 3A7QA 2LROA 2LW8A 5FZEA 1WKYA 3S57A 1LGBA 4QWNA 3T2OA 1H1MA 4OLLA 3MIHA 4XPVA 4OQ9A 4C1XA 1UWWA 2R1BA 3M3IA 3I49A 4QX7A 2DVFA 3CBNA 2BEOA 3H7YA 1CQ9A 3MYXA 2EXKA 2QQWA 2JDHA 2VCMA 3AKRA 3O12A 5L73A 4I01A 4BZ4A 1VBA3 3DCQA 3ZN5A 1HB1A 2XHNA 2R32A 3JXSA 5F6LB 3WNPA 2VG9A 4YSFA 4QQOA 4Q0QA 1HKDA 1GYKA 2JWPA 4LHLA 4U36A 3RZZA 3T0DA 3I97A 4EWAA 2XJUA 4LO4B 4XFAA 4WVMA 3THPA 4CCJA 4IV1C 1NY72 1UX6A 2QQNA 2J1UA 2ZABA 4IV1B 3RGBA 1QF3A 4E4ZA 1A34A 3U78A 3WDUA 4XUTA 3WF0A 1XNDA 1ZVFA 2WNOA 2UWBA 4CCCA 3MPPG 1STMA 1J3RA 4PLOA 4XDQA 1LODA 1XYPA 5C7GA 1VBE3 3V64A 4QPWA 5GLWA 1W6MA 2W92A 2X09A 5H9RA 1HV1A 3AYEA 4A7KA 3RDIA 4QM8A 1H8TC 2WLQA 4Y3OA 3IBMA 4XBNA 1H8TB 1QDOA 1C8M1 1HW5A 2Y8KA 1UW8A 4UI9L 3T2TA 5FBJA 2XLGA 4P14A 4Q0SA 1SMVA 2VM9A 5DDJ3 4AHWA 1URXA 4E9KA 3V0AA 4N53C 4ZS3A 2XHKA 1ENQA 1LENA 3C3VA 1ZZ8A 1EV12 3C7EA 1W06A 4LIUA 4N53B 1K3IA 5FMBA 5FY4A 5GZEA 5A3OA 4I0BA 2J1RA 1ODNA 2VZSA 1W6NA 3MEPA 3QD6A 3ZKYA 5C8WA 2ZKLA 5LA1A 4V2WA 4YRDA 1UOFA 2DYCA 4Y20B 2P2KA 2F6BA 2VY0A 4AQ6A 1XU1A 3CF6E 1LU2A 2V73A 2C5DA 4HN1A 5CVRA 1QOTA 1YQ8A 3O1MA 2K2SA 5FZLA 3RQ0A 1VLNA 2RR12 3D3AA 1RL3A 3VD3A 1J3QA 1MS4A 1O5LA 3MW4A 3LOBA 5FJHA 5GALA 1LAJA 4XILA 3K51A 5EWSA 1CD3G 1RUD2 1DBNA 2Y6KA 5T3NA 4YZ1A 4NUBA 1H6YA 1VBD1 3KQRA 4LUKA 1UZYA 4CXYA 3HIFA 2RS13 1SFPA 4ARYA 1YJLA 4LUMA 4IDZA 5FREA 4NOTA 5FO7B 4AI0A 4MGSA 4KMQA 2DTYA 4KL1A 4EQVA 1OOPA 2DCYA 3DKQA 5FKCA 1BMV2 2ZHKA 2PMWB 4OULA 4MUVA 3VZKA 4RYDA 5CFCC 5CFCB 4RGKA 3VDAA 5JZGC 2JG9A 1D4M2 1H4GA 5GJ6A 5JZGB 2BOIA 1PGW1 3FLRA 3TEYA 1GNZA 1YUDA 4KH9A 5T5LA 1ZBA2 4MXWA 5F7UA 1UY3A 4E2GA 1EV13 2HWB2 5A3UA 4OI1A 1GWMA 1UZWA 5BNOA 1Z7S1 1AYM2 5A70A 3PUSA 4PI0A 1QJU2 1HV0A 3IMMA 1W3XA 4UF0B 4XUNA 4ZXEA 3VN4A 3FBMA 1OVPA 1W3VA 4XMIA 2W1WA 3BTAA 2VZTA 1FV3A 2BWAA 1O4YA 2PQQA 2V5DA 1HXS3 2EIBA 2BERA 1PHMA 4L2NA 1J59A 1A6CA 2NMOA 4XJAA 4XVHA 5FYTA 5JLVA 3OY8A 2FDKA 1ASJ2 3ILFA 1XSQA 2KR2A 3N3HA 2DVAA 3PDQA 2RR13 1Z0HA 4M3CB 5DAVA 4D0QA 4E8CA 1NCQC 4JGYC 3O1UA 4Z82A 1U5ZA 1NCQB 2HKXA 4JGYB 3WG2A 3WHUA 2XH6A 2VOTA 3ZXLA 4TLGA 5C3QA 1RUD3 2OS2A 3PL0A 4BXFA 4BMEA 4PI2A 1N1SA 2CV6A 2IWGB 3G7DA 4BK5A 1MZ5A 4XTPA 2BV4A 1YNAA 2BDRA 3WCSA 4ASLA 5CZKA 1RC6A 1N1YA 3I3EA 1W0PA 5HV4A 5FZDA 2Z5WA 1DU3D 2B42B 3ST7A 1ND2A 3PTYA 1GNHA 3JBG1 3MZHA 2A70A 1C5HA 1D4M3 3N9QA 2Z42A 3MF9A 3PVBB 1ZRFA 1UF2C 2O0OA 2BNNA 4QXCA 2BWCA 2VVEA 2XGXA 2WFF2 4CP9A 2HWB3 2HWD1 4IETA 3OEBA 4UFJA 4URTA 5GLZA 3K4AA 2XVGA 4KWJA 1O4TA 1D2QA 2CAVA 3PVEA 2GC1A 3UGGA 1QGLA 1YQCA 5F5QA 2OZJA 1KITA 1QJU3 1IQAA 2ZHMA 4XZPA 4XQWA 4JVAA 1ZBE1 2VCAA 1TG7A 1CR7A 4XYXA 4RHV2 4YW1A 1JS9A 2PLV2 1H2NA 1VR3A 3MO4A 4S2FA 3WVJA 3VZNA 2TUNA 4H7LA 2K0GA 5ERLA 4DUWA 1NE4A 4YZ5A 5HI0A 1M4WA 4XUQA 1JZ8A 4S2GA 4KWUA 1WMFA 5F2WA 4Z1VA 4JGZA 5IVFA 1A8DA 3GZUC 5FZ4A 2QE3A 3PIGA 3WNMA 2W9XA 2R061 1H2LA 3R0RA 4XMAA 4XOGA 1S1AA 3T0AA 2RJLA 1AL23 1YJKA 2WLPA 1H1AA 3GBGA 1GANA 1H4HA 3I3DA 2A6WA 2ARCA 2R16A 1BK0A 2XB6C 3CIHA 1GOFA 4IGPA 4KGGA 4JAAA 4UFMA 2RDSA 3OUIA 3AJYA 3OGSA 5FZOA 5A3WA 2ZKNA 3SQOA 1X36A 2W0XA 2WWJA 3OBZA 3OOXA 2OX0A 5KWRA 5LEKA 4QQPA 2CAUA 2XLAA 3ACFA 4DY3A 4D6SA 3LA7A 2RJKA 4KI5M 3PHMA 2P3YA 3AM2A 1VBA1 4YVWC 5A33A 3WNKA 5FO8B 5E88A 1S0JA 1TEIA 4YVWB 4EYUA 4PIZA 1S0FA 3GGLA 3J7HA 2WFF3 3AX4A 2ORZA 4ISQA 2XUMA 1W39A 4IEXA 2VQAA 3SNMA 4ZHNA 2ARAA 4UFHA 2Y38A 3VDDA 3N7KA 1TE1B 4XXPA 1GU3A 1J1LA 1GP6A 5JXGA 2BVVA 2ZHLA 3HOBA 4FPCA 4RHV3 2D3PA 2PLV3 1D4VB 1QJY2 3GJAA 4QKFA 5I0RA 5JR2A 1NUKA 4PIYA 4ET7A 1DGWA 1BBT2 2WT2A 1G9FA 2F4LA 3A4UA 3DUIA 4AEDC 2WO3A 2VR4A 4AEDB 1W6PB 2CTVA 4K8FA 1OI6A 3CNAA 4AEJA 5FR3A 1GOHA 4KG8A 4PDWC 1W9WA 2VO5A 4PDWB 1JTZX 4JV4A 1Q5OA 5D2AA 2O1QA 5DDJ1 3HQXA 2WSVA 3POBA 2GC3A 4W65A 1QNYA 3PU3A 4HSJA 1QDCA 4L97A 2WZEA 3H3ZA 1KD7A 5HCFA 2VBDA 5LA0A 2ZJCA 2OPWA 3LEKA 3FC0A 5T55A 3FBYA 4MGKE 1AR61 2H6CA 1GWKA 1UU6A 4Q4V3 2RS32 3K4ZA 1BCXA 1RUH2 2YPDA 3RZHA 4A45A 3OCPA 1WLTA 4I02A 2XONA 2NMNA 1QIQA 1W2TA 2ET7A 2AUYA 3NWKA 1PGL2 3FUQA 2EF6A 2ZX0A 4LITA 4FOYA 1NQJA 5K8SA 1CAWA 4LTAA 5FUIA 4BU2A 3ZFFA 2PHUA 1NY71 4HLTA 2VE1A 2YYOA 3M3CA 1CAXA 2XBO3 2XXZA 1W99A 4P5YA 1QJY3 2IXKA 2VXRA 5D8AA 2RS11 1G9CA 3ZYJB 1D2SA 2W5FA 1J3PA 1V70A 5J37A 1K42A 2IUWA 3AP7A 3VHNA 3GZEA 5CKQA 2ZACA 1LOFC 1YLLA 3WF2A 1CZSA 4K6BA 2GH8A 3ILNA 3B00A 1Q56A 3ZN6A 3LB9A 1YYNA 2VNGA 4GZ9A 5HCBA 3VBOC 2FDFA 2K46A 3VBOB 1OLQA 3WQBA 1EV11 3BOPA 1OUXA 5DAWA 2ZHNA 2GAUA 2GNDA 4OHXA 4BQXA 5C8CC 3KCCA 5C8CB 1QJEA 3WCRA 1V6NA 1YCIA 1UOBA 3CJIA 4JX0A 2BVBA 1CJPA 1W04A 2WIIB 1LHUA 1NXMA 1HXS1 2A6YA 2Y0OA 2RS33 3ACIA 4CU6A 1W8WA 4RGGA 3U75A 4CUAA 5A1FA 5J3UA 3TAYA 5ABJC 4KNCA 4L99A 3BVCA 3J7LA 5ABJB 2RR11 4W4ZA 4XDPA 5CIRA 4P9GA 2ZGRA 4E2QA 2HJIA 4N7UA 3KHCA 4UT5A 2RDQA 1OF3A 1OURA 1RUD1 3E97A 4A2UA 5L9VA 4Y22A 1LOGA 4PJYA 4E2SA 2NQYA 4Q0PA 3VZOA 2PQSA 5LY1A 1R092 3Q8FA 3AXEA 4IW3A 4K20A 4YM1A 2PHRA 1AX2A 4HVOA 2NZ9A 2W94A 1HX6A 2JEMA 3H7JA 4MO3M 1DIWA 2XJRA 3MIBA 4IV3A 2PAMA 5FYSA 1BMV1 4XJWA 1KFXL 3J4UH 4HANA 5DG1A 3W9AA 1S2EA 2RMU2 3N36A 2Q5TA 2ZGUA 3VB9A 4WZFA 4NIGA 2B45X 4MGQA 3AYCA 4TZDA 2D6PA 1OC1A 4OUMA 2EA7A 2C26A 3ZYBA 3GBFA 3N9OA 3M4FA 3CMGA 4B1MA 3GJBA 4NROA 2PHTA 3S5QA 4A41A 1AYN1 3AMNA 4GIQA 4GA9A 5F2SA 3HEIA 2GC0A 3B02A 4CP1A 1W05A 2YDEA 4QGLA 3VHRA 4CE8A 4DNYA 4HONA 3VKMA 1SLCA 5APAA 3NVCA 4AGVA 4LIVA 1IS5A 4CPBD 1VMHA 3AKSA 1DYKA 1UX7A 3KMHA 4ZKTB 3BTXA 4CVUA 5KHIA 1UO9A 2VOKA 2IZWA 2JXAA 1YFWA 3OGVA 4YG0A 5FP7A 4GH4A 3S7EA 2JENA 4LXLA 5C9AC 3SHRA 2ATFA 2CU5A 5C9AB 1UMZA 1LJ7A 2NYYA 2WA4A 1OFNA 2ZEWA 3UKVA 1E57A 1I9RA 1AL21 5EYYA 4R9DA 4AXOA 4I2OA 4HZFA 1SFYA 4BWOA 1LHNA 4N9HA 1TMF2 2EIGA 2PHDA 2VNVA 3RJ2X 1YRZA 4DRRA 3R6SA 3U37A 1NCRC 2VJXA 1NCRB 3B01A 1K5MA 4DXTA 1YFUA 3WOGA 1UYYA 1W6MB 3AVRA 3HPNA 2RMU3 1JN2P 5FXXA 3B5LB 3A22A
chains in the Genus database with same CATH topology
1RUJ1 2QQPA 5I0SA 4IEZA 4FPFA 1BEV1 2WFF1 3AZXA 4LBNA 5CB7A 1S0GA 4TYSA 4YARA 4AQTA 4K40A 2OUJA 2ZAHA 1RUF2 1W6QB 4C0HA 4RHV1 3ZDSA 5JIUA 2E7AA 2QZ3A 3ELNA 1AJKA 3KSCA 2WS93 4FPHA 3SH3A 4YW3A 1ZZ6A 4QPYA 4FAGA 4BM8A 3I7DA 4MVTA 4JDOA 4AWDA 4PLMA 2K9ZA 1S0BA 2R6QA 3E5UA 4I3PA 2VGDA 2ZGNA 1PVXA 2YZ4A 3CLPA 3DPRA 1JOJA 4F8AA 1TMF3 5FTTC 3HBZA 4HKWA 2GNBA 3ZIXA 2ARBA 1OA3A 4H3WA 3POSA 1OOPC 2O8OA 2Y26A 1OOPB 3KT1A 4Q4V1 5HXVA 2VNRA 5FCCA 1H30A 4OI2A 1X33A 4XFFA 1WBFA 1C8NA 3E5QA 4MXWB 3D82A 5C6CA 2A6ZA 2XJSA 1DQ1A 1V00A 1RUF3 2ZX4A 4LHKA 3J9SA 4ZXKA 2RHPA 1GZWA 2XBO1 3O5SA 3ZXFA 2XWBB 3WDYA 5AFBA 3ACLA 4XFBA 4QGNA 3ZYPA 4WBBA 4XFIA 1O3SA 4YM2A 4OZXA 1VRH3 3SH4A 3OY8B 3USUA 1XYOA 4AFMA 1DHKB 4COVA 1SBEA 3JQWA 5JI9A 4KG0A 2A75A 1VBD2 1V6LA 1VAVA 2VW1A 3AYDA 1O4ZA 5BNNA 2HEWF 1N1TA 3B7MA 2EXHA 4LBQA 4XF0A 1QJZA 4ATFA 3IIAA 3ES4A 3U07A 3RG0A 1REFA 4IEOA 1ND2C 4LBJA 1ND2B 1C5IA 4Y1XA 4WM7A 3UV9A 4XHBA 5AVAA 1XXNA 4FOVA 1XNCA 1PGL1 2X29A 1PK6A 4RL7A 3ZN4A 1KFUL 5FBZA 2MNGA 1DGRA 2ZBJA 4CEYA 1RUE2 1UPSA 5EJ3A 2N7GA 3VBSA 1WLDA 3VV1A 3WNXA 2D40A 4MX3A 4CYDA 4H14A 4QPIA 5E8AA 1DZTA 3ZMNA 4JGZC 4QHBA 4JGZB 3WX5A 1LOBA 3M3QA 5BNPA 1VBD3 3WD5A 5BNQA 3WR0A 2JX9A 2D43A 4EV0A 4PBPA 2C1FA 2SBAA 2SLIA 1LHOA 1YWKA 2D6LX 5E89A 5GZGA 4LBOA 1G86A 3OYWA 3I4IA 1ZX5A 5DUWA 5BPXA 4YGEA 5LK5A 5A33B 3WG4A 1AR92 5KC6A 3E6CC 5H9SA 2HWD2 4U2AA 4OHZA 2PAKA 1OSGA 4S2HA 4AFAA 2W52A 3IN9A 1RUE3 1ZBE2 5GM0A 2ZX2A 4NPRA 4NWWA 2EXJA 3D6EA 2D7FA 2G4IA 2MEV1 4B4PA 1HQNA 3M2MA 5K0UC 4DOUA 5K0UB 1BQPA 5CFDC 4BHPA 2RMU1 5CFDB 2XL7A 1CJDA 1BKZA 3KB5A 2TBVA 3D0SA 4PF5A 1NLRA 4JDNA 3S0MA 1MZ6A 4FPJA 1N1VA 2BYVE 5FDBA 1NOVA 1RTVA 2ZZJA 1LTEA 1PZ8A 4RA0A 2CY6A 5EXOA 3V65A 1W0OA 4DPNA 2WWSA 1RUI2 1AR73 3HD8B 1POV1 2WS91 5IT6A 1NLSA 1AR93 2XKPA 4OUSA 5T5JA 3KD4A 2HWD3 5HBAA 3ATGA 3ZXDA 1XNKA 3FWEA 4M01A 3ZFFC 1FT9A 3ZFFB 3PNAA 3KM5A 5CG8A 4DMIA 2B9UA 1BVP1 3WQ1A 5D8AC 1HQLA 1V6KA 5GZDA 4WVVA 4FPYA 1AJOA 4AQ2A 3ILRA 2A6XA 5T54A 4CTEA 1WLWA 1QU0A 2ZPXA 5DDJ2 4LBMA 2TEPA 4Q0VA 5KC5A 4DS0A 4YFZA 3ZSKA 3ZSEA 4GKYA 2LM3A 4NR1A 1RUF1 1F31A 5FAXA 5SV8A 1AR62 3LZZA 3CJIC 3RI8A 3CJIB 1RUI3 2ZMNA 1CONA 1VJ2A 4FPLA 3K48A 4A3XA 1VRH1 5KBFA 3S30A 5T52A 1DZRA 4NHKA 5A3MA 4DINB 4Q8KA 2A3XA 3M1HA 4LBLA 2MPFA 1H2KA 1OFSA 3SMHA 1TNFA 2RS12 3OGGA 3WP4A 4HSLA 4ATEA 4IEWA 1MS1A 1W6OA 4OHWA 1S2KA 1HRV2 2RM21 3MW3A 3EXUA 2Z2SB 4RQPA 5E16A 4ZU7A 1FOD3 5I93A 3R4DB 1GLHA 3MLJA 3AKQA 1UCXA 3VKOA 3U0ZA 3SCFA 2WZR3 1SQ4A 4GQ7A 3V0BA 1AVBA 2HEYF 3RPQA 3E6DA 4C91A 1ND3A 2ZS6B 1AR63 1WCDJ 5GZFA 4SBVA 5E1RA 1HXS2 4LA3A 2WNVA 4QT6A 4IEYA 4GH4C 4GH4B 2D5FA 4M3CE 2ZX1A 1Y3TA 4RGAA 1GZCA 2JECA 1WCSA 4AFCA 3ZPYA 1LHWA 1WA4A 2GNTA 2VOWA 3IPVB 2BNMA 2QUOA 1RGSA 1V6MA 3L2HA 4CDQC 4CDQB 4D7YA 1QJX1 3ALQA 1HRV3 1K5MC 1LOCA 4FQZA 1K5MB 3O0VA 3R4UA 2ZZQA 3TB0A 1ZREA 1S0CA 4HETA 1PZ7A 1F5FA 3B69A 4L92A 4GMP3 2XL9A 1ZZCA 4BIOA 1PGSA 3TNPB 5JDBA 4K3UA 3B3QE 4BYYA 2R1DA 2WT1A 1AYN2 3HR9A 2AREA 4WM8A 4MGYE 4LR4A 3WW4A 1RUE1 2WQZC 2VMGA 4XJ8A 2W08A 3ASIA 5C4WA 4E27A 1JXNA 4EN0A 4BPZA 2QVSB 1H2MA 4Q8LA 1WLCA 1QQP3 4D7TA 2AYHA 2ZMLA 1VBC1 3BODA 2GMMA 1LB2A 4AHXA 5CAZA 4NN0A 2ZGKA 3ES1A 1QXRA 3L2YA 4EN6B 1O5UA 3JB4C 4J1WA 2ETEA 3ZXKA 1AL22 1C4RA 2WNUA 3JQXA 1EAH3 3OBRA 3DPRC 1S2BA 1WD3A 2XPJA 3DPRB 1G6NA 5FLHA 4GALA 3DV8A 1R1A1 3URFA 4OVEA 4OI4A 4DZGA 4MLOA 4MGZE 3VBHA 1Q8OA 3U10A 1AR71 1QWRA 1RUJ2 1U5IA 3LKJA 4JTOA 1YIFA 4A7ZA 2Z69A 1SLBA 2FZ1A 1AR91 2ERFA 1BEV2 2GN3A 4FVVA 4DFSA 1CVNA 1F2NA 3KGLA 3KS7A 2WZPP 3HT1A 1MEC2 1MS8A 2A6VA 2R0HA 3FHIB 4MYEA 1AYN3 4P9JA 4WVZA 3APBA 4X6QB 1AR81 2V09A 5BUVA 1ZNPA 4GB31 1GZWB 4DXZA 1MVEA 2G9GA 3WG1A 3NSTA 2R30A 5K7PA 1MS9A 4IL7A 1Y9QA 5FRAA 2JE9A 3SITA 1C28A 1GV9A 3POWA 5JMCA 2DVBA 3B9CA 5FFOC 1VBB2 4JRAA 2CWSA 4P9LA 3THTA 4LULA 1S0EA 4KQ7A 5BNNC 1GICA 5BNNB 1UKRA 3LGRA 3NAPA 1HDKA 4Y24A 4AI2A 1DQ0A 1LULA 2IXLA 1RUI1 2HWC1 4Q4V2 1RUJ3 1AZDA 1VALA 1LRHA 3AKPA 3I2DA 3R4SA 4WM7C 1BEV3 4WM7B 1FATA 1MACA 5FLJA 1PK6C 1MEC3 1PK6B 1LR5A 1KXGA 4OHVA 1SCRA 2XBO2 1JW6A 1FPN2 2DURA 4CEYC 1SDWA 4IEQA 4CEYB 4D3WA 2H0BA 2DTWA 2P3JA 4V1PA 5DZEA 2BW8A 2NM1A 1PO12 2P3KA 3EO6A 4FPEA 2ZGSA 2YUEA 2BFUS 2MHFA 4EN8B 1FOD1 4QPIC 4CZSA 1LEDA 3ZMOA 4QPIB 2CL2A 2ZMKA 5TSWA 5I0UA 1GQGA 1YHFA 2WZR1 1VBB3 5BNPC 4QM9A 3MLLA 5BNPB 1OQ1A 2PN5A 3I8TA 3D4KA 1AXYA 4XBQA 3JZVA 5I0TA 1KS5A 3FLTA 1V6IA 1D0GA 1ZM1A 2KM2A 4NHLA 2YHJA 4P5HA 3BU7A 4YG3A 1ZRDA 1X50A 5I8TA 2NP0A 3ECQA 3RYKA 2VULA 3ZXGA 1FPN3 1FNZA 2HEVF 1IOAA 1F8VA 1IS4A 1PO13 2A71A 1HRV1 2ZOEB 2FZ2A 2XJPA 4AEKA 4CDWA 3ZFGC 1NG0A 3ZFGB 4XIOA 5KHJA 5DXDA 4GMP1 4ASMB 2ENRA 4M0NA 1U5XA 1PVC3 4CDXA 2ZGQA 1RUC3 2D3SA 2Z79A 2H6BA 5T5OA 4YZ2A 4UBGA 2ES3A 2I2SA 1X7NA 3WZ1A 2QFEA 4FTEA 5CA6A 4UW3A 4YM3A 4RS5A 4Z07A 4HK8A 3BIWE 2A3YA 4ITCA 1PIV2 3WDVA 1NZCA 1QQP1 4ZU4A 2JICA 3RRDA 4R9CA 3W59A 4LLOA 1UKGA 2AENA 4NWVA 1VIWB 2Q1ZB 2IXHA 2Y0IA 1IHMA 1OPOA 2Q4SA 3P3PA 1EAH1 1LU1A 4BQ1A 2B7YA 4COYA 4AFBA 3PJQA 4FP2A 2MEV2 1A3KA 1OLRA 2E7TA 5KHHA 1OA2A 2VUJA 2ZGTA 2KA3A 1G7YA 2WKKA 1HIXA 5JPMB 4XFGA 4KBBA 1LOAA 4CP0A 4M3CF 2R042 2ZGMA 1LESA 5FO9B 4EJRA 5AFEA 1RHI1 5A3LA 2BNOA 3HN1A 1IZ3A 5FPXA 2E53A 2QKDA 3AP9A 1NE6A 1PIV3 2WS92 3WXPA 3AFKA 4P9WA 4Q29A 3KT4A 2A7AA 1UZZA 4N53A 2YXSA 3TN91 3JUUA 1Z78A 2D6KA 1QXPA 3WG3A 5JOZA 1DQ6A 2ZCWA 4YVSA 2F4PA 4WVMB 1GZ9A 3KLSA 5C33A 2Q30A 5KXBA 3CL1A 3JU9A 4YW5A 2W39A 4JCKA 2FBEA 3NV1A 2MEV3 1AX1A 2YY1A 3FZ3A 3KT7A 3HT2A 1W6OB 2IFRA 4KWKA 3D0JA 2GZWA 4OFGA 1GKBA 1SFNA 5CU1A 5I8YA 1ALYA 1EPWA 3V0AB 4J1XA 5A32A 2R043 4AGRA 3IWZA 3LA2A 4AYUA 4D69A 1MEC1 3MFCA 4LE4A 4LE3A 1W6NB 3V0BB 1V9U3 1QOSA 3GALA 3WY6A 1MS5A 3VBFA 1QH6A 4Q4Y3 5BXXA 1POV3 4K1YA 3VKLA 2WNVC 4LBKA 5DZGA 1VRH2 2WNVB 5J48A 2ZX3A 1ZA4A 2AH2A 3DN7A 4QQLA 3WQ0A 2FQPA 3NV4A 5D1IA 3SH5A 2G9FA 1SACA 3JB8A 3LWCA 4YGDA 1VBB1 4D94A 4NO4A 2BPA2 2BGCA 2R0FA 1MQTA 4M0HA 2E9QA 4YNIA 4GULA 3ZXJA 2RM22 1NXD1 1JH5A 4QQ2A 3MW2A 1NCQA 2JG9C 2PYTA 4JGYA 3WHTA 2JG9B 4XF4A 4XJ9A 2JG8A 1XYNA 3QCWA 5F6KA 4LA2A 4AVBA 2ILMA 4MH0E 1SEFA 3H8UA 4I09A 5BNOC 5BNOB 3VGIA 4XE9A 3J8F2 4IERA 4KU8A 5EZWA 2ZGOA 1FPN1 5GLVA 3LAGA 1F5JA 5C4WC 3V56A 5C4WB 2E7QA 1PO11 1G8WA 1C1FA 2ET1A 4QXKA 3WT3A 4BE3A 1ULDA 4RD7A 2WL1A 3KCYA 2VU9A 5B2GB 2EVXA 1PVC1 1RUC1 1FMD2 3MIDA 5KXEA 4IXLA 1Y7BA 2XJVA 1QJX2 3MI8A 4XF1A 1MVQA 2VMHA 2RM23 4N9IA 2DCZA 1QHDA 1J58A 1RUOA 3RJRA 4FXGB 3WQ7A 3SCHA 2IFWA 5IK4A 4W6XA 1IKQA 4UW5A 1AXKA 1C3HA 4FOWA 1KJLA 3J8F3 3ZSJA 3RNSA 4ONUA 3AP4A 4BOWA 1CPMA 1DZQA 4LO8A 2PHXA 3AMQA 4AK3A 4N90A 1GR3A 3AK0A 1VBC2 2DV9A 1L3JA 4R9AA 1EP0A 5KXDA 2WINB 4KGQA 2D97A 4Q4W3 3WDWA 1OKQA 2GN7A 1FMD3 3HAGA 4FP3A 4AHZA 4HVRA 2OUHA 3D8CA 4TSVA 3ROUA 1QJX3 1R1A2 4L9BA 3ZFEA 2VQ0A 5IK8A 1KJRA 1W6PA 1BZWA 1TME3 1UN1A 2VPVA 4XTMA 2DWRA 1AR72 4Y1ZA 4Q27A 1PIV1 3B93A 3A0KA 3GZTB 2GC2A 4ORFA 5DUVA 1X8EA 3H1WA 3JD72 3CJXA 1T6GC 2QCSB 3P3NA 2GMEA 2D6NA 3VDDC 1XRUA 1AR82 3VDDB 1ENSA 1DQ2A 1KDMA 3UKTA 1M06G 1RINA 4COUA 3SCGA 5F1RA 4GB32 3H1MA 4LO6B 4XJUA 3OBTA 3IDCB 2RS52 4Y26A 1BXHA 2P17A 4XBLA 1HRI1 1I5ZA 1VBC3 3WP5A 2UWAA 4YZ3A 1JYIA 2A73B 4W6WA 3B9IA 2I74A 2W68A 3PVNA 3GNEA 3POYA 3QOPA 3WINE 4LNVA 4LT5A 2R041 2ZAAA 4JTNA 2OYZA 2GH2A 1UAIA 4FTBA 2YMZA 1R1A3 1V9U1 2DU0A 1Q8QA 2EXIA 3IM0A 1LOFA 1XU2A 3INAA 4K9SA 4F83A 3KCXA 2HWC2 4Q4Y1 4Q1RA 5DG2A 3AP6A 3ZSLA 2P3IA 4E4SA 1CPNA 1SLTA 2D6MA 2GSYA 2WT0A 3M7AA 3M8LA 4XETA 4DQAA 3O0XA 1YFXA 3JD73 4HPKA 2E63A 4QMAA 2EAKA 1WW6A 2GALA 1OQEA 2R49A 1AR83 3QH7A 4R9BA 1CAWB 1YXWA 3QLQA 4XEZA 1WW4A 4GB33 4XFCA 4F7ZA 2QNKA 5CG9A 3E5XA 1CAXB 2RS53 1PMIA 5JR7B 1B35A 4YGBA 4QPGA 1H9PA 5D8AB 4FTSA 4J6GA 5HCAA 1W2UA 4E4DX 5JAXA 3WDXA 1CAVA 4S2DA 5EFUA 5JSOA