3AYDA

Crystal structure of galectin-3 crd domian complexed with tfn
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
135
Chain Sequence
MPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for distinct binding properties of the human galectins to thomsen-friedenreich antigen
pubmed doi rcsb
molecule keywords Galectin-3
molecule tags Sugar binding protein
source organism Homo sapiens
total genus 30
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3aydA00
1OFSA 2DYCA 4FPHA 1YYNA 1V6MA 2ZMKA 1DQ4A 1LHUA 3UJOA 1UKGA 3ATGA 3B00A 3OJBA 4RA0A 3WDUA 4XYXA 2DUOA 3KM5A 2VH9A 3AYEA 4FPJA 3DGTA 1QOTA 5CNAA 2DVFA 2GMMA 2ES3A 3V0BA 3UK9A 3USUA 3V0BB 2ZZJA 4YW1A 1MS0A 2DVGA 3FUQA 2D3PA 1MACA 1KJRA 5GM0A 5T5PA 4AGVA 3FFZA 5JLVA 1WD4A 2EXJA 4YZ3A 4BPZA 4ATFA 3T1MA 1LGCA 1SBFA 2A75A 1YI7A 2R1BA 4XDQA 1CN1A 1Q8VA 2A6WA 2R16A 4XJZA 2YY1A 4DRRA 1MS8A 2AH2A 3AP9A 1CR7A 1S1AA 4FOWA 3HR9A 3RSJA 4UW6A 3ZSKA 3M2MA 3LSDA 1DYPA 1MS4A 2HYKA 5IK7A 1SBDA 5CA6A 3ZYRA 3ENRA 1GBGA 1AXYA 3NV2A 1WW7A 1AVBA 1SLCA 2AGSA 3AZWA 1MS9A 1GYKA 1HQLA 3IM0A 3N3HA 5EYXA 1N1TA 4YGDA 1BQPA 1B09A 1W6OB 2YZ4A 3IKWA 5KXCA 2AYHA 2D6LX 2I2SA 2P37A 3POYA 1WLDA 1RITA 4LBQD 4ZKTB 2A3YA 1DLLA 1F9KA 3T1LA 1S0DA 1S0GA 4XXPA 3O0VA 2ZHLA 1WBFA 1IKQA 1DIWA 3CNAA 3NV1A 4ISQA 1JUIA 2OUHA 2JDZA 2GNDA 3NV4A 4GKYA 4Q1PA 4AVTA 5HCFA 2E6VA 2P3IA 5F9TA 5KXDA 2DVAA 4PCRA 1GICA 3AJYA 2ZGRA 4YG3A 1AX2A 1URXA 1CJPA 4XBNA 3PJQA 1ONAA 3OBTA 2A5ZA 1W0PA 3SH4A 4M3CB 3ASIA 4H55A 1F5FA 4C1XA 5CB7A 2A70A 4K1YA 1J1TA 4FPCA 1QGLA 4L8QA 3WHTA 1S0BA 2ZABA 4Y22A 1YXWA 4BLIA 1A78A 4Y20B 3AZVA 3VKMA 4XMIA 2D44A 1YO8A 2EXIA 1KQRA 3PMEA 1GZWA 1GZWB 1LU1A 1ULGA 2W39A 3JU9A 2PHFA 3MW2A 1FNZA 3HN1A 3QCWA 1AF9A 1W6PA 4BOWA 1W6PB 1MZ6A 1C1LA 2W68A 3FBYA 5JMCA 2CY6A 3ZXFA 2SBAA 1CESA 1HKDA 1CPNA 2OVUA 3OBRA 4U2AA 4XTPA 1G9DA 2A7AA 2H0BA 2JD4A 1RIRA 1V00A 1V6NA 2DTWA 4YGCA 3ZXLA 1GZCA 2C5DA 4P9YA 1SCSA 3GNEA 1LHNA 3WUDA 5GZDA 4GXLA 3AZXA 5T54A 4GKXA 2EXHA 3APBA 3N7JA 1KITA 2R49A 2ZHMA 5CBLA 1SLAA 5T50A 4FQZA 4YM0A 5DUWA 5IK4A 2WLQA 2WQZC 3ZVXA 4LBOA 1WD3A 3WDXA 2JE9A 4XJWA 2JECA 3I4IA 3AJZA 3O12A 4AGGA 3AZZA 2EF6A 4Y1XA 3M1HA 2EXKA 4FOYA 4GA9A 4HL0A 2E51A 2SLIA 1VIWB 1CIWA 1WLWA 4YM2A 3A0NA 1KRIA 2XG3A 4U36A 5DG1A 2V73A 1Y7BA 3VKLA 4M00A 4TZDA 5GLZA 3W59A 3DUIA 4LBQB 4BM8A 1IOAA 5E89A 1GNHA 1BXHA 4KBBA 2EIGA 1UMZA 4PQ9A 3KQRA 4Y24A 1DHKB 1ENRA 5GLVA 3M3QA 2TEPA 2E53A 3QLQA 5E8AA 2D3SA 4D69A 1MVQA 2ZGPA 4FPLA 4I30A 1JW6A 5DZFA 3WG3A 4IQPA 3LSEA 2NM1A 2CYFA 1U0AA 2EAKA 3R4SA 1QOSA 2E7TA 1G9FA 1SBEA 4XIOA 1G9AA 2A71A 3V0AA 3SLIA 3MPPG 3WG2A 5T5OA 2VW1A 3V64A 1DBNA 1JYIA 1LTEA 1NLSA 1V6KA 2GNTA 1S0JA 4XMAA 4DQAA 2PHTA 4NOTA 1Q8PA 2ERFA 1LOFA 1G7YA 2KM2A 5DUVA 1FV2A 2ZMNA 3USUB 5KXEA 3SNMA 5JVVA 2P34A 3ILFA 4WVVA 1LULA 2D6NA 4GWMA 3LCPA 2WSVA 1ENSA 1D0HA 2YMZA 1LOAA 2DUPA 2XB6C 1MVEA 1O4YA 2ZAAA 1FNYA 1VAMA 2ZBJA 4XHBA 1UZYA 3BTAA 1CONA 1D2SA 2ZGNA 3WDWA 1JOJA 2ZHKA 3TAYA 3ILRA 5DXDA 2D43A 2RHPA 3OY8A 4JC1A 3UL2A 1SLTA 3RG0A 1IS5A 4R9BA 3R4UA 2AUYA 1A3KA 1UX6A 1JXNA 4YW4A 2CWSA 5GZEA 4Q8LA 1I1EA 5FREA 1H30A 3ZXEA 4GALA 1A8DA 1GKBA 2UURA 5DUXA 5EXOA 2DU0A 2ZGOA 5E88A 4BMBA 1MS3A 2P3KA 1DGLA 1VLNA 1W6QA 1W6QB 2DWRA 2V5YA 5GLUA 3WUCA 3A4UA 4R9AA 1BJQA 2ZGLA 1WUVA 1LEDA 4XBQA 3MEPA 3AP7A 2A6XA 4Y26A 3M3OA 3TB0A 4JCKA 2UWBA 4UW3A 3H0OA 4M3CF 3V65A 2BQPA 1SLBA 5H9SA 3N36A 2Q5TA 3BODA 2WT0A 4UW5A 3OGGA 4PBPA 3L2YA 2NZ9A 4DS0A 1GZ9A 1QDCA 2UWCA 2G4IA 4Y22B 5H9PA 3GALA 3IMNA 1W6MA 1N47A 4AWDA 4R9DA 1V6LA 1GSLA 3O0WA 3A0KA 1H9WA 1QMJA 3WHUA 2VW2A 3B69A 4PF5A 4XILA 2LTNA 3N35A 3VV1A 4YZ2A 4FPOB 5HCBA 3VKNA 3O0XA 4SLIA 5DZGA 4Z8BA 4YZ4A 2E7QA 2PHUA 3IPVA 5JOZA 2ENRA 2DU1A 2GNMA 4LBLA 1Q56A 1W0OA 2D6OX 4MYEA 2GALA 1GV9A 3B01A 2ZGTA 2OUJA 4XXAA 2ZGMA 3ILNA 2DURA 5JDBA 2A6VA 2A3WA 4R9CA 2WT2A 1IKPA 4CTEA 2CNAA 4YG0A 3BIWE 3RMXA 4YM3A 3AX4A 3AYDA 1QDOA 2NP0A 3AXDA 3AYAA 5DUUA 2DUQA 1LHWA 5T5LA 1AXZA 3B9CA 4FOVA 2D3RA 1HLCA 1EPWA 2CWMA 4BQ1A 3VUOA 1FAYA 2ZACA 1Z0HA 2WT1A 4AVVA 4AYUA 2D7FA 3AK0A 1ULEA 2JKBA 2UWAA 1VALA 2YXSA 1QU0A 3ZPYA 1DQ1A 3SISA 1S0CA 1SLIA 2DVBA 1LJ7A 3PVNA 4XE9A 1XQNA 5GZFA 2GN3A 5H9RA 2ARBA 1LOEA 1UN1A 4FP2A 2VUAA 3ZXKA 5JOYA 3FUOA 1FATA 3U4XA 4Y1ZA 4YZ1A 4Y1UA 2D6MA 4YGBA 1WBLA 2NMOA 3AP6A 5GZCA 4M01A 1S0EA 1AXKA 5IT6A 4FPGA 1AJOA 1TEIA 1WCSA 2D6KA 2GDFA 2P2KA 5CAZA 1HDKA 1HQWA 1LHOA 1C1FA 3N7LA 1FX5A 2P3JA 1ZA4A 1PZ7A 4Q26A 4ASMB 4XJ8A 1G9CA 1IS3A 1JN2P 5EWSA 3WLUA 5JOXA 3V0AB 3INAA 4Q2FA 4DRVA 4YG6A 3B3QE 4Y1YA 4YFWA 4FPKA 3T2TA 2ZGSA 4TYSA 2ZHNA 4CZSA 5HCAA 4ITCA 2PHRA 4LBJA 1S0FA 1C57A 2A3XA 4K1ZA 1GANA 2DVDA 1QNYA 1BYHA 1AZDA 2VW0A 3WG4A 4WV8A 4RL7A 4YM1A 5T5JA 2LALA 2VY0A 2NMNA 3ZSLA 4CRQA 3HMYA 4FOQA 1KDMA 3WDTA 3JUUA 4LBNA 1YRZA 5H9QA 4BMEA 2VXRA 1IS6A 1G8WA 4XTMA 1UPSA 3MW3A 1F31A 4M3CE 2GN7A 5GLWA 1DZQA 1RINA 1LU2A 1WW6A 1Z78A 2GMPA 3OY8B 4P9WA 1QOOA 1JBCA 1DQ2A 2JE7A 1PZ8A 4AGRA 1OQ1A 2GMEA 3IN9A 2ARXA 3M3EA 4DPNA 3WG1A 5IUQA 1LEMA 4GWNA 2WJSA 2Z42A 4FPFA 4F83A 2W08A 2W52A 2R0HA 2A6YA 2NYYA 1AX1A 4LBMA 4UW4A 1LHVA 4FVVA 1DYKA 3PVEA 4WZFA 5BYNA 1N1VA 1CVNA 4XJ9A 4YW2A 1SLLA 3D6EA 4YGEA 1Q8QA 1SACA 3NWKA 3SH3A 2A6ZA 1Q8OA 1N1SA 3VKOA 3WVJA 1ZM1A 4PBOA 3NV3A 3O5SA 4FP3A 2ZGKA 1UZZA 1W6NA 2AENA 1W6NB 2R0FA 3C2UA 3D5OA 5FRAA 1H9PA 4ATEA 1QKQA 1W6OA 4P9XA 3D4KA 5GALA 3MW4A 1CPMA 1WW4A 5AVAA 1LECA 2WSUA 1KDKA 3SH5A 3WDVA 3WNXA 1ENQA 4DFSA 3FLRA 4Q1RA 4WVWA 4ISRA 4XIKA 5DG2A 5KXBA 1UAIA 2CTVA 1JYCA 1W6MB 2YV8A 4AVSA 1MS1A 3UJQA 2FMDA 1AJKA 1LOFC 4FQ4A 5T52A 2C9AA 5IK5A 4XHXA 3RQ0A 3Q9OA 2B7YA 1APNA 1UL9A 1DQ5A 5F5QA 4ZXKA 1V6IA 2FHRA 4M3CA 2ZKNA 1X50A 4NO4A 3WOGA 1S0IA 1LCLA 3IPVB 4YZ5A 4Q8KA 4BLJA 3AFKA 4W65A 3SITA 1V6OA 5GJ6A 1V6JA 1LENA 4Q27A 1C4RA 1CQ9A 3AXEA 3AP5A 4K20A 1LOCA 1LGNA 1LOGA 5JOWA 4Y20A 1SCRA 2PELA 1DFQA 1LODA 1MZ5A 1LESA 3FLPA 1YIFA 1I3HA 2D6PA 3W58A 3ZSMA 5GLTA 2VU9A 3R05A 5GZGA 2AR6A 2CL2A 1JHNA 4HANA 5EYYA 3WV6A 4XJUA 1G86A 3WCRA 1N3OA 3OPZA 1BKZA 2DV9A 4K21A 1MS5A 1WW5A 3PVOA 2R1DA 3M3CA 1SFYA 1PZ9A 1DQ0A 1WLCA 3ZYPA 1IS4A 4YLZA 5DZEA 1QF3A 3AZYA 2ZGUA 3N7KA 4FPYA 1OKQA 4OZXA 3I8TA 2NN8A 4YW3A 4JRAA 2WKKA 4LBKA 3WDYA 1ULFA 5LK5A 1ULDA 2EALA 1N3QA 1AX0A 2YROA 2ZGQA 2PHXA 2PHWA 1FYUA 1BZWA 1ULCA 3ZSJA 1LOBA 3POWA 3VKFC 1G9BA 1FV3A 1GNZA 3ZXJA 3AP4A 3POSA 4YW5A 4Y1VA 3AYCA 4XZPA 1LGBA 5L73A 3OYWA 4FPEA 3OYWB 5SV8A 2UU8A 3RRDA 2OW4A 1KJLA 1NXD1 2DTYA 3WZ1A 1Q8SA 4LBQA 1GLHA 3RMYA 4C1WA 2JJ6A 5T55A 3BOPA 5IK8A 4P14A 4XJAA 3FLTA 2GNBA 1DQ6A 1R1ZA 1N3PA 2WNEA 1MR5A 4XOGA 4YFZA 2ZMLA 3RS6A 4XBLA 1N1YA 3WCSA 1O4ZA 3N7MA 1QNWA 1VAVA 2ZA9A 2AREA
chains in the Genus database with same CATH superfamily
4FPHA 4WM8C 4P5YA 1XNCA 5FZOA 3B00A 4UAPA 1DDLA 4RA0A 4XYXA 4MGSA 2VR4A 2DUOA 3CEWA 3KM5A 2VH9A 5DN2A 4E4DX 4UF0A 3EYPA 1B35C 1RHI2 2BW8A 3S5AA 1LB2A 4LHLA 1IQDC 2ZZJA 1MS0A 3VBSB 1VRH2 3GDBA 3HNMA 4CDQB 3ZFGC 5T5PA 4OHYA 3RI9A 4D7SA 5J3UA 3LFIA 2HBUA 1BMV2 4XDQA 1CN1A 1ND3B 2A6WA 2YY1A 1W2UA 4AFDA 1R092 3AP9A 1CR7A 2MEV1 4RR3C 1ASJ2 1ZBE2 4LEJA 3RSJA 2R062 4R8HA 2NPIA 2OIIA 1AR73 1RUJ3 1W9SA 3E5QA 2C24A 2BVBA 3LSDA 4EN6B 1IQAA 1MQTA 4M4RA 5CA6A 2B9UA 3ZYRA 5A3MA 4BQ3A 3URFA 5C3PA 2D98A 4ZU5A 3DEMA 1QXPA 1C28A 1IZ3A 1EPZA 1HRI1 3LAGA 4PIZA 1BQPA 1B09A 1W6OB 1NCRC 2VM9A 3IKWA 1NLQA 3KD4A 2I2SA 3KWVA 3NNMA 4CCMA 2RDSA 1H1IA 1PK6C 1WLDA 2VZQA 3B9IA 4ZKTB 1VE0A 5K0UB 3T1LA 1S0DA 1S0GA 4QPIB 4XXPA 3CZUA 1TME3 2Q8OA 1QJY3 3POBA 1JUIA 2OUHA 2BRTA 4Q4W1 4C0BA 1JTZX 3H50A 2FZ2A 1XE8A 4LO6B 5JXJA 1RUH3 1AYN2 2HWB1 2YPJA 3HQUA 4NWWA 5F9TA 1GICA 3TNPB 3UKNA 3WW2A 1UMHA 3ZFEA 2Q0AA 3NAPC 2BDRA 3ZYGA 1W0PA 4COYA 1REEA 4C1XA 1M4WA 1F5FA 5CB7A 3UESA 1PVC2 1Q43A 2X5IA 4P9LA 3ZKUA 2ET1A 1C5IA 3I3BA 1QGLA 4L8QA 4LO4B 2QFEA 3RGBA 1GFF2 2WA4A 3VBRA 4CCOA 1YO8A 4I09A 4OUEA 1LU1A 1XYOA 4TN7A 1ULGA 3MW2A 2PHFA 4NWVA 1FNZA 1AF9A 1W6PB 4IV3B 2GC1A 4Q5OA 2Y60A 3PL0A 3ZXFA 2RS52 4CXXA 2OVUA 4B3NA 2VZ3A 3OBRA 1JYNA 1VBA3 2RMU3 1WCKA 2DTWA 1DGWA 1CIYA 1KXGA 1RVF2 1L3JA 4IV1C 1GZCA 2C5DA 4A3ZA 5DPNA 2W95A 1TVGA 2ADEA 3JQXA 4E4ZA 5CG8A 1T2XA 4FI9A 2XJSA 3K3OA 3KF5A 3ZXAC 1V9U3 3I59A 3KV5A 2FCVA 2YU1A 4ZZ5A 1Y9GA 1SLAA 5FXXA 5JR7B 2XJQA 4WBBA 5A33B 2WQZC 4XABA 1UXZA 3LWCA 5J36A 3S6PA 2VTXJ 1QQP3 1W39A 2JECA 3I4IA 3O12A 2OA2A 4AGGA 1GWKA 4Y1XA 3ZFGA 3M1HA 4BWOA 4DXZA 2V4VA 4G4FA 4GA9A 4KU8A 1H1AA 3B02A 3PVBB 4XETA 4L9BA 5L9BA 1BBT2 3UGGA 5A1LA 1QXJA 1CIWA 4YM2A 2XG3A 5F37A 4TZDA 3VKLA 3O7OA 1AR92 4O7XA 5GLZA 1FOD2 3W59A 4RR3A 2WZR1 3U0ZA 2P6HA 3TWIA 2HWD3 1QJU1 1IOAA 4I3GA 5FZHA 1O5UA 2JXAA 1L7QA 2EIGA 3BOWA 1RUF2 4PQ9A 4JGYB 4LA3A 2OS2A 2XKPA 3CDZB 4EE2A 3ES4A 4AQ6A 1EUTA 1J1LA 2D3SA 2BPA2 2ZGPA 4FPLA 5DZFA 3Q8CA 3LSEA 2NM1A 3MUY1 4D8MA 3F95A 5FZOB 2E7TA 1G9AA 4Q4X1 2XPJA 1OD5A 3T2PA 1W8HA 5D2AA 4ZZ8A 2GC3A 5B2GB 3TEWA 1O3SA 2EIBA 3MV01 4A6OA 1W8NA 2EICA 4UF0B 2WR9A 3VZKA 1LTEA 1NLSA 1YFWA 2Y26A 4ONUA 4XMAA 3VD3A 4DQAA 4EJRA 4NOTA 5L19A 1XE0A 2ERFA 5A80A 1G7YA 3FHIB 4KWJA 1XE7A 4AG4A 1NY71 4K7JA 5KXEA 4B8EA 3NAPA 4IUGA 4CPBD 3ZMNA 4WVVA 1ND2C 4JZRA 1D0HA 1ENSA 3GZEA 2YMZA 1W2NA 1QHDA 3PIJA 1MVEA 1O4YA 1WCQA 1XSQA 2QTWB 1VAMA 2VNVA 4K8FA 2CSGA 3VHPA 1YFYA 1CONA 2FBEA 5A70A 1NAEA 3D0JA 5A3PA 1JOJA 3H3LA 4PLOA 4AVAA 5ABJB 1X8EA 3H8XA 4JC1A 3G7DA 4CA9A 4G3YC 1MQTB 3UL2A 5I8YA 5A3OA 4LIVA 4R9BA 2QZ3A 2VTXA 1UIJA 3PUAA 1HQNA 2C26A 3ZXGA 1RHI1 1I1EA 3SEEA 2UY9A 3OPWA 4E8CA 1GKBA 2DDUA 3RZZA 2VQ0A 5EXOA 4NIIA 3U07A 2ZGOA 3Q8BA 1VRH1 2WZ8A 4XUQA 3LIHA 1GOHA 3PU8A 3QD6A 3TN93 4LKEA 4EROA 5I0SA 2V5YA 1WLTA 1BMV1 3A4UA 1VB2A 2IFRA 1R091 4XBQA 1QJY2 4V2WA 4BU2A 3IAPA 1ZBE1 2ZOEB 2A6XA 2R061 4CP1A 1RUH2 2FDHA 2UWBA 2Z5WA 4M3CF 1VRBA 4K6BA 1AYM3 2Z69A 1HJGA 2Q5TA 5IFPA 3R6SA 4XUNA 2WFPA 4A6SA 4EZ4A 5FUPA 2X5IB 3OGGA 5IFTA 1GZ9A 1QDCA 3WINE 3LOIA 2WZEA 4PT6A 3VBRB 4A41A 5G05L 3IMNA 2G9FA 4Q0SA 2VZOA 2XVLA 3U78A 4QPWA 1GSLA 1VBC3 5FY9A 5BNQA 4FAGA 5JI7A 4QDQA 4XILA 4PF5A 1W9TA 2LTNA 1JZ6A 1AYN1 5HCBA 2WO2A 4SLIA 3I49A 1O6UA 2WAAA 1DF0A 3WNKA 2E7QA 1TMF2 2PHUA 2RJLA 4LE4A 2DU1A 1OURA 2XUMA 1W0OA 3Q8FA 3IT8A 3N9QA 4S2FA 3AFGA 2D6OX 1VBA2 2ADDA 2GALA 1KFXL 1WZXA 3B01A 2OUJA 3JQWA 4WM8B 3ILNA 5DQ0A 4F8AA 1ZZ9A 2A3WA 5FP7A 5KC6A 3UKTA 1UX7A 4IE6A 4MZUA 3T4VA 1UU4A 1ACCA 3I59B 3AX4A 3ZDVA 3AXDA 1DCSA 2IXJA 2RS33 1JODA 2DUQA 2Y6LA 1LHWA 1V9U2 3I2FA 4FOVA 2WWUA 1YUDA 2D3RA 4NPRA 3J4UH 1EPWA 4I3PA 5FBJA 4BQ1A 2ZACA 1PO23 4A45A 1ODNA 2E31A 4EN0A 1RJ8A 1W8TA 5FP3A 4P00B 3ZFGB 4OHZA 1E5IA 1ULEA 1QQP2 1VR3A 1JZ7A 2RS51 1AR62 2ZX0A 4BDVB 4E4HA 3ON7A 3GBWA 4AFBA 1QU0A 2X53S 3NRUA 3ZXDA 1S0CA 2WIIB 1RVF1 3LF7A 4Y4RA 2CDOA 3W5NA 2MHFA 4XQ4A 4RR3B 4LT5A 4Y5Z0 2VOVA 4WVZA 4UWDA 1VP6A 4RHV2 2VUAA 5E1RA 4CU6A 4IGPA 3FUOA 1W06A 3VDDC 3U4XA 4Y1ZA 3D0SA 5FPVA 2HWD2 4YGBA 1R1A3 1WBLA 4QD2A 5IT6A 1SZBA 1S0EA 3KVAA 1AJOA 5SV5A 4N7UA 5CEHA 3LA2A 3OGVA 1EY2A 4RS5A 5CFCA 1TE1B 5FZMA 1FMD2 4ASKA 4B4PA 4AI9A 1MPXA 1Q5OA 2R043 4UT5A 4P9JA 4ZS3A 3K4ZA 1K12A 2AZ5A 1JN2P 3WLUA 4ARXA 1BBT1 3ZYIB 5A6QA 4QGMA 4LHKA 4Y1YA 5FYUA 3CJIC 4N8MA 3DXTA 1OPOA 4TYSA 2JDUA 2VJXA 1C57A 4K1ZA 2QDRA 1GANA 2BNNA 3DL3A 5IVEA 5JPNB 3J8F3 5T5JA 1HN1A 3JCIA 3NAPB 2VY0A 3ZR6A 4BQ2A 1XNTA 1RUF1 2VCBA 4HETA 4FOQA 3VHNA 5BNPC 1EV12 4HN0A 4CEYC 3TOJA 1JYVA 2XBO3 1IS6A 3HBZA 4Q0VA 5FV3A 5G04L 1UPSA 1WKYA 2CHHA 2DCJA 4M3CE 3KT7A 2XLGA 2W94A 5GLWA 4OULA 1WW6A 4P9WA 1UY4A 3WF1A 1JBCA 3RZJA 2QQNA 4EN9B 3PHMA 1RUI3 2JE7A 1PZ8A 4Z82A 2VCMA 1GP4A 4AGRA 4A7ZA 1H8TA 1SFPA 4Q0QA 3WG1A 1UOFA 2XQRA 1LEMA 3HQRA 3UNPA 2ID4A 2ZS6B 4GWNA 4H2AA 1D0GA 1YCIA 5ISLA 2W08A 3IDAA 2A6YA 1AX1A 1RUD3 4LHNA 3IDEA 3JB8A 4MGQA 3ZPOA 3FZ3A 2WS93 1N1VA 1CVNA 3E5UA 4XJ9A 4DY3A 4LLFA 3WQBA 4LKDA 4RFT0 1SACA 2DF7A 1Y9MA 1Q8OA 5FIXA 5ANQA 1JYWA 5FO9B 4PBOA 5EP9A 4FP3A 4XFCA 5LCWL 1WGPA 3BU0A 2NLRA 2PLV1 3OEBA 4P9XA 3MW4A 3LZZA 4NRQA 5JZGC 4I01A 5A6YA 3MI8A 1FXZA 1F5JA 5FPBA 3VDBA 1TNFA 3B94A 3TBDA 1PM7A 4AVSA 3SHRA 5FY7A 4BQ5A 4Q4V3 3UJQA 1RJ7A 1PVXA 2VNGA 4LOTA 1POQA 3VBHC 4IEZA 4XFFA 4IEXA 1LNSA 3LKJA 3EXUA 3RQ0A 3P6BA 1VBC2 4GWIA 3VDDA 4DINB 1UL9A 4XPVA 2K0GA 4JRLA 3MDPA 4M0NA 4M3CA 3ZKYA 2ATFA 1RUH1 1ZX5A 4YZ5A 4W65A 1NA1C 1V6OA 3SITA 1KS4A 5JIAA 1KS5A 1LENA 4Q27A 4K20A 4GWJA 4JDOA 5JOWA 2XWBB 1KGYA 1HX6A 4QKNA 3H9AA 1LESA 1YIFA 3DYOA 2HWF1 3MLKA 1PMIA 4ZY9A 3CJIA 2D6PA 4I0AA 5C3OA 1EAH3 2VU9A 4NHKA 5LATA 1XB9A 4PHZA 3MICA 2XXZA 4HANA 5FMCA 4HVRA 4XVHA 3AKSA 5EQUA 3KCYA 3WCRA 1DU3D 3IIAA 1ND2B 1H8VA 1BKZA 2GP5A 1OBNA 2DV9A 4ET7A 5BNPA 1ZRDA 5I8SA 3RWNA 1MS5A 1TMF1 1WW5A 4CEYA 3I2GA 3M3CA 2ZKLA 2JG9A 2ARAA 2NQYA 2JE8A 1ZZ6A 1IS4A 5C5TA 1VBA1 3ELNA 5DZEA 1DZTA 1QF3A 4QX5A 3UV9A 1OLRA 2VZUA 3I8TA 2NN8A 2Y0OA 4XAEA 2FCUA 4FXGB 4JRAA 4D6RA 5J7MA 2WKKA 4LBKA 1O8PA 1ULFA 2DCYA 4N7IA 1N3QA 1AX0A 4NVPA 4XCBA 2YROA 4XFAA 2PHWA 1V9U1 1NX9A 3VKFC 4A7KA 3FHQA 1R1A2 1QIQA 5KHJA 4RS5B 3AP4A 4F7ZA 5D8AC 4YW5A 5FZAA 3AYCA 4JHTA 3MIBA 4FPEA 1AR61 2UU8A 3RRDA 4GIQA 1KJLA 2R042 2GH8A 3WZ1A 4LBQA 5AFEA 1L7RA 3MZHA 4IE5A 4OI4A 4GB33 4S2GA 4AEKA 3C7GA 4CP9B 3SXWA 3W21A 4XJAA 4JDNA 3J26N 2G1MA 2O0OA 1C8M2 4RHV1 4N53C 2E26A 1XSRA 4HVOA 1Y9QA 4OMDA 2OPWA 5EJZB 3U1XA 1VAVA 2HWD1 3WDWA 3RWKX 3J8F2 3WF4A 2DYCA 2HEVF 4MHUA 3S30A 1V6MA 4AEDA 5DAXA 3UJOA 1UKGA 1JZ8A 4LK6A 3WDUA 1W0NA 1FMD1 2XBO2 3FJSA 5LBBA 4NHMA 4S2DA 3AYEA 4FPJA 1S2BA 1OHFA 3T0DA 1ZZ7A 3VBHA 2ES3A 4CYDA 3KHCA 1GOGA 3USUA 3PTRB 3V0BB 4LUMA 4D0QA 3FUQA 1RMU3 2D3PA 4CDQA 2ZEWA 4XACA 1H4GA 3Q8EA 3FFZA 1WD4A 4YZ3A 3HWJA 5FZGA 3OCPA 3T1MA 2QQJA 1LRHA 1SBFA 1YI7A 1ND3A 2R1BA 2IVIB 2VPVA 2ZX3A 3FX3A 3NJZA 4XJZA 2HWC2 4FO9A 4JHZA 4P02B 1OT5A 3WW1A 3FE5A 1EV11 2YBSA 4OI0A 2HJIA 4E27A 3IB3A 3ZSKA 1DYPA 1MS4A 4WM7C 2HYKA 1T6BX 1JZ3A 4UI9L 2WS92 4FT8A 1J84A 1WW7A 1SLCA 1UOJA 2AGSA 3AZWA 3P3PA 1PO11 4JX0A 4MSVA 4UFHA 4X8NA 4YW7A 5KHHA 5JAXA 1JU4A 4QU1A 3N3HA 3T30A 1N1TA 1K5MC 3VD5A 1R083 5A3UA 5APAA 1D4M3 3CU7A 2WAOA 4QXHA 4K8RB 1ZBA3 3O0VA 3ZN5A 1WBFA 2OQ6A 5EIYB 1JHJA 2VMGA 5CVRA 4CU7A 1BEV2 4LHSA 4LA2A 5F8PA 2RJ2A 5JI9A 4PCRA 3GYDA 2PFWA 2Y6JA 3AJYA 4CDUC 1URXA 1CJPA 2LRPA 2XUEA 3PJQA 4IL7A 4MGIE 4Q4V2 1YQCA 3VDDB 1VBE3 4QGLA 2R32A 3KGZA 3SH4A 1RUOA 1MEC3 1TZOA 3GZUC 3D82A 1DYOA 3BN6A 3MFAA 4H55A 4M3CB 4L99A 2BOJA 5CIRA 3LE0A 3O1UA 3MF6A 4FPCA 4DZGA 3WNNA 3ETPA 2XQXA 4OUSA 4Y22A 1A78A 3UGHA 4BLIA 3MIFA 3AZVA 5FXWA 3S57A 1SFNA 4Q4Y2 3U14A 1O5LA 1QXRA 3PMEA 4B7EA 3CJIB 1NE6A 1VBB3 1ENXA 3JBG1 1W6PA 1QH6A 3VHRA 3RFRA 1HV0A 4V1PA 4ES8A 4YVSC 4IGQA 3KMHA 1EAH2 4LTAA 4XTPA 3RJRA 2J1TA 5FP9A 2VBBA 1V00A 1V6NA 4LKFA 5FAXA 2R30A 2Z4FA 1UF2C 2RM22 4QKDA 5JSRA 4HG6B 5BNPB 3ACFA 4I2OA 4XF9A 3SCGA 4CEYB 3ES1A 1VJ2A 2XMLA 3GNEA 3WUDA 4DO0A 2JG9B 5GZDA 1S4CA 5FK8A 1NYWA 5T54A 2PQSA 2EXHA 1RL3A 4GMP0 1F15A 4GJYA 1WMDA 2BEOA 3APBA 4W6WA 2VZSA 1YI9A 1HXS3 4NAOA 2ZHMA 5C8CC 3AL5A 5ERLA 3GXUA 1V0AA 4J1XA 4YM0A 5DUWA 3ZVXA 2FDKA 3LEIA 3VB9A 2B46X 2G9GA 4E2SA 2YDEA 4EZHA 2PAEA 2V09A 4CEWC 4AVCA 2EXKA 4CDWC 4AHXA 3MLLA 4XQWA 4W8JA 1H6YA 4HL0A 1BCXA 3A22A 3H7JA 1VIWB 1YLLA 5L36A 2J1SA 2YC4A 3A0NA 1COV3 4N9IA 4NE9A 5DG1A 2V73A 3OGSA 5BUVA 2YFZA 3GHMA 4M00A 1WMEA 3ZX7A 3MIHA 5FYYA 4BH9A 4UYBA 2W1UA 3SCHA 2IXLA 2P4EA 4LBQB 1E5HA 1HB2A 2EIDA 4BM8A 2UY8A 3BUCA 5E89A 4PQQA 4WM7A 1BXHA 4KBBA 1H2MA 3DECA 5LZ6A 2IXIA 1F4HA 1UMZA 5I0UA 1ENRA 5GLVA 3M3QA 1Z7S2 2E53A 3VBUC 3QLQA 5A7NA 1PMJX 3FL7A 4J6GA 4NMIA 4Y33A 4I30A 1JW6A 3OGJA 4QX0A 5KC5A 1HB3A 4CU8A 2CGOA 2O14A 2RR11 4AEDB 1OVPA 2EAKA 1G9FA 5CYYA 4QQHA 4IGOA 1SEFA 4K9SA 3SLIA 1RUNA 4NROA 3MPPG 3NQHA 3ZN4A 5T5OA 2VW1A 1DBNA 1OF4A 5DDJ3 5FPUA 3I2HA 2C4XA 1U5IA 2GP3A 5FBZA 1UMIA 1QJX3 5LW9A 1LOFA 2E7AA 3VBHB 2R041 5JIUA 3POGA 1GQPA 4G9SB 3USUB 3POEA 3LDRA 3SNMA 2MPFA 5JVVA 3HT1A 4UFIA 5A3WA 4E4SA 4URAA 4EYUA 1RMU2 2W9XA 2XLAA 3LFMA 4GWMA 1C8M1 3O1OA 4Q0UA 4DXTA 2QBXA 1LOAA 2CV6A 3DKQA 2YGLA 1UZYA 5FWEA 2GSYA 3BTAA 5A1FA 2DFCA 4AQ2A 3CMGA 3OEAA 4NIAA 2YGMA 1A8MA 2PXJA 3S0MA 5ABJA 2D43A 4C0HA 3B93A 2FMYA 2J1EA 2BFUS 3GZAA 3H42B 5C4WA 3RYKA 4D7YA 2XBO1 3RG0A 3X29B 1ZRIA 2AUYA 3RYPA 2DCTA 1UX6A 2DCZA 4YW4A 1VMFA 5F5CA 3RZLA 2QQWA 4GALA 4QXBA 4CSWA 1RUG3 2UURA 5FYIA 4ZXEA 5LRRA 5BV6A 2VMFA 5FZCA 2WN3A 2WZPP 1PGSA 4CU9A 1MS3A 1R082 1GNYA 4P9IA 1W6QB 3WUCA 1UY1A 5J48A 5C9AC 3I2KA 1ZBA2 2HWC1 3K75B 3ACHA 1U5XA 2V72A 3MEPA 3AP7A 3PMSA 1VB4A 4TTGA 1AR83 3LDBA 2WFF3 3M3OA 1ZRRA 4KL1A 3V65A 4INDA 1SLBA 1UY2A 1UZ0A 2WS91 2YPDA 4H3WA 4KG8A 5BNNC 2Y6HA 2V4AA 1VBE2 2JIJA 1MEC2 3LD8A 5FZ4A 5F32A 4Y22B 4A7YA 5H9PA 4ZHNA 3GALA 5TSWA 1YQ5A 2J1VA 5KR7A 1N47A 2WNVC 4IEWA 5FUNA 4L92A 5J96B 4JGZC 1IPKA 3AVSA 3B69A 1HRV1 2WC2A 2O1QA 3H3UA 3RI8A 2WRAA 3VKNA 3O0XA 1BEV1 4Z8BA 4YZ4A 4NPLA 1J3PA 1A34A 3IPVA 4KI5M 3POIA 5JOZA 2VUDA 3ORJA 4Q4V1 2ORXA 5FZ7A 1RUC3 4MYEA 4WM8A 1GV9A 4XXAA 3GJAA 1K42A 2A6VA 4R9CA 5D1IA 2WT2A 1XPWA 1NUKA 2TUNA 2DBNA 2CNAA 4YG0A 2BERA 3BIWE 4YM3A 5I8TA 2N7GA 1B35A 5DUUA 2W2IA 3M3IA 3PUSA 5T5LA 2Y6GA 3B9CA 4Q4Y1 4IE0A 1PIV1 2P17A 1S2EA 4QM9A 1F2NA 2WT1A 4QGNA 4AVVA 4CXYA 3DPRC 1CZTA 1PM4A 5A3LA 3C7FA 1VMJA 3VZMA 3LPFA 4AFAA 2JDAA 1ZYBA 4BIFA 3BIEA 3BU7A 3SQOA 5C3QA 3SKJE 2DVBA 2RM21 5GZFA 1W3XA 2VUJA 1COV2 4AXOA 4FP2A 4AEMA 4B7KA 5JOYA 1LAJA 1W04A 4WM7B 1FATA 5DAQA 4YZ1A 1J3QA 4RYDA 5C71A 1AXKA 2Y6FA 4FPGA 4KGQA 2I45A 3ZN6A 3EHKA 3W5MA 2EVXA 3OGRA 4L2NA 4MOAA 2P2KA 4QX8A 3ZM8A 1HQWA 1OUSA 1NCRA 1C8NA 1LHOA 2Y64A 4LULA 4XUOA 1C1FA 2YB7A 3PIGA 1PK6A 3TEXA 1IPJA 2Q1MA 3O1SA 2OQ7A 3HN3A 1IS3A 5EWSA 5JOXA 2YG0A 3INAA 4FXKB 4Q2FA 4DRVA 5KHIA 2JDYA 4YG6A 3B3QE 1EUUA 4B4QA 4YSFA 3MHZA 4FPKA 2ZHNA 4FTEA 4ITCA 5FMOL 1VBD3 4NRPA 3RPQA 5A6XA 2B39A 2VXJA 4LO5B 4ZPIA 3UGFA 2BBVA 2A3XA 5DDJ2 5FJHA 4JQRA 1BYHA 1AZDA 2X29A 1W3VA 4YM1A 4NIHA 4PLNA 2BV4A 3NNJA 3HMYA 3VBOC 1X7NA 5M0TA 3CLPA 1KDMA 5FLIA 3KS7A 4BZ4A 1Z7S1 3ZIWA 5H9QA 4BMEA 1AL21 2XKOA 1GWLA 2W0XA 4XDOA 2Y34A 3MW3A 4LMFA 4JAAA 4FBFA 2WNVA 4A3XA 2ET7A 5C4WB 2WQ8A 5FYHA 2Z2SB 3KB5A 3IIIA 1YHFA 4QQOA 1AR72 4GMP3 1RUJ2 4FSJA 4PLMA 3H8OA 4QHBA 5C6CA 2K9ZA 2ZJCA 4HBNA 3AMQA 1SDWA 4RN5A 4DPNA 5FCCA 3OUHA 3GBGA 3T2OA 2VO5A 1WA6X 2Z42A 4FPFA 2WL1A 5BXXA 4FFGA 4RFRB 4LBMA 4IV1A 1XU1A 1LHVA 3RZKA 4OLLA 3H1YA 1RMU1 2JB8A 1UXXX 3HEIA 4JTOA 2YUEA 4TLFA 1NQDA 1REFA 1YIPA 4QX3A 3J7MA 1TME2 4YW2A 1SLLA 4XFIA 4D94A 4MXVA 3NWKA 5C3RA 1HN0A 1O4TA 1ASJ1 3I54A 1N1SA 2FQPA 4XQDA 4PI2A 4AI3A 1I5PA 2VZ1A 3C2UA 4R4ZA 3L2HA 1AR82 1OKOA 2WFF2 3DF0A 4ZONA 4ATEA 3D4KA 1GR3A 3DPRA 1NCQC 3WNXA 1LECA 1OQEA 2BTVC 2WSUA 1W8WA 3SH5A 1SG3A 3FLRA 3WNOA 1JZ5A 5DG2A 2VE1A 1UAIA 4CVUA 4KNCA 2BUKA 4QMAA 1DGWX 5FOBB 1MS1A 3N9LA 1R081 5A3NA 2FMDA 1LKNA 2VCAA 2WDBA 4FQ4A 5LA1A 4XHXA 3ZLIA 1ZBA1 4ZXKA 4UBGA 5ACA3 4I02A 1J83A 1V6IA 4NO4A 1W8ZA 5CFDC 3NNFA 1S0IA 1F8VA 3IPVB 2J42A 3H1MA 1PGW2 3QBQA 2JIGA 4CCNA 1C4RA 5E6HA 5HBAA 1JU3A 2RMU2 1LGNA 5IVYA 4Y20A 5BPXA 1PVC1 3WD5A 3BTZA 2P1BA 1MZ5A 1MEC1 1RUE3 1XNAA 3LA7A 4BXFA 1I3HA 2R073 3J9SA 4PJYA 3I3EA 2FD8A 4Z1VA 1B35B 4KWUA 5FJKA 1DLCA 5GLTA 4HVQA 2LS6A 5GZGA 4OVEA 1EYBA 2J7MA 1KD7A 4AL9A 4B4RA 3FHAA 1JHNA 1H2LA 3KT1A 1IG0A 1ND2A 1N3OA 3IBMA 3R4DB 1ULOA 2VZRA 4K21A 4RQPC 2VQUA 5FYMA 3PVOA 1FPN3 2R1DA 4PI0A 1OF3A 1SFYA 3S7IA 2CGPA 1OH4A 1VPHA 1PZ9A 5FPLA 1YC61 2GZWA 3L9JT 5LA0A 4YLZA 3GBFA 3N7KA 4FPYA 4GH4C 4OZXA 1EP0A 2W5FA 3ME2A 2E32A 3JD73 2BZDA 4QT6A 1BVVA 4TWTA 4F3JA 4YWAA 3CQOA 5A7QA 1BK0A 2QNKA 2Y0IA 4HXCA 1FYUA 3ZN6B 1LOBA 4FFFA 4HONA 4BB3A 2G19A 2RE9A 1ZZCA 2VOTA 1FV3A 1GUIA 1NCRB 3ACIA 2E63A 1PK6B 2YBKA 1D2QA 1W8OA 1LGBA 5L73A 4QDRA 5A6ZA 1F4AA 2XHKA 4IEYA 3THTA 3UKVA 2DTYA 5IVJA 5KBFA 1GLHA 3T0BA 4A2UA 5C9AB 4CP9A 3BOPA 5F39A 5J37A 5AC93 1AR91 1O3QA 1QH7A 1FOD1 1YJKA 1R1ZA 4O9GA 1L7LA 1GWMA 2PAMA 5EJ3A 1COV1 1MR5A 2XL9A 4ORFA 2AC1A 4XOGA 4FTSA 1IGOA 1ULPA 1VBD2 1RXGA 1N1YA 1TG7A 2BBAA 5FTTC 4MO3M 1QNWA 4LITA 5CZKA 1KFUL 2ZX4A 4URTA 3T08A 4GAZA 1YYNA 3C7HA 2Y6KA 4LNVA 2H0VA 2ZMKA 1JYXA 1LHUA 2QE3A 3BB6A 4AR2A 1BVP1 4LXLA 2IZWA 5I0RA 2QUOA 3MGUA 1X8MA 1HB4A 3DXUA 5IAVA 4AI2A 2WNVB 1QOTA 2I74A 5CNAA 2DVFA 3GM8A 2ZAHA 2GMMA 4JGZB 3I2IA 3HIFA 3HT2A 3ZFFC 3V0BA 3UK9A 3SC7X 4YW1A 4OMCA 2JG8C 3PLQA 5FZFA 2MEV3 3EMRA 3VD9A 1KJRA 5IWFA 2VOXA 4QXKA 5GM0A 3WF0A 4D6SA 5JR2A 2KR2A 1HIXA 2X8KA 2XHNA 5JLVA 3EB7A 5DDJ1 5I0DA 4ATFA 2A75A 2W46A 3E5XA 5CKNA 1Q8VA 2BJSA 2R16A 4IV1B 3BPSA 4XFGA 5FYSA 1W05A 4XF3A 1S1AA 2JD9A 4QAWA 3OG2A 1QEXA 3H3ZA 3HR9A 2F6BA 5FLJA 4BHPA 3TN92 3M2MA 2OX0A 3AMMA 2CDPA 3KSCA 4BQ4A 1SBDA 2XVGA 2ZX2A 1GBGA 3NV2A 1AVBA 3K77A 5CG9A 1HQLA 2K46A 4V2VA 4Q4W3 4KH9A 5C3SA 4YGDA 1AR71 3ROUA 1RUJ1 5KXCA 5KWRA 3DPRB 2HWB3 3P1IA 2P37A 3PUQA 3NNGA 1AYM2 1RITA 4LBQD 2A3YA 1DLLA 5F5AA 1ALYA 5HCHA 4RQPA 2GH2A 1O7FA 2ZHLA 3VDCA 3D8CA 3R0RA 1IKQA 1DIWA 3CNAA 3NV1A 4FAHA 4ISQA 5DAPA 2GNDA 4Q1PA 1UWWA 4AVTA 2IXKA 1XNDA 5HCFA 4K40A 1D7PM 5KXDA 4LUKA 4NIGA 2DVAA 3ACGA 5FZIA 4N9HA 4YG3A 4M0HA 1AX2A 4Y3OA 1ONAA 1TME1 4DUWA 1QJY1 2A5ZA 3OBTA 2AACA 1FI2A 2A70A 1KEXA 3JZVA 5ACA2 2YBPA 1AR81 3I3QA 1UU6A 5JXHA 1GQHA 2YYOA 4YVWC 3WHTA 1OI6A 1S0BA 2ZABA 2QQMA 1YXWA 2C0ZA 5AVPA 4Y20B 3VKMA 1O3RA 2D44A 2EXIA 1KQRA 2ETEA 3CHXA 2IXCA 1GZWB 4DXSA 4NN0A 3LQCA 3QCWA 4LORA 1ZA7A 2FDJA 2VAUA 3HN1A 4HMZA 3NNLA 1RUE2 3C7EA 3FBYA 3OBAA 2R072 4META 3VBSC 4BOWA 4ZS2A 2V5DA 2CAVA 1CESA 1HKDA 1CPNA 1P8JA 2RS32 3IWZA 3I97A 4M4PA 4U2AA 1G9DA 1RIRA 1PO22 3ZXLA 3VBOB 1XRUA 4GZ9A 2XONA 3DYMA 3KCCA 1LHNA 5IVBA 5FY1A 3WF2A 3AZXA 4GKXA 5J09A 1PGW1 2WWSA 1F35A 1GOFA 2RMU1 4IE7A 1X9TA 3N7JA 4E2QA 4CUGA 1OLQA 4LO7A 2BOIA 5CBLA 5T50A 4FQZA 4CCCA 4E8DA 1HW5A 2WLQA 3ZFFA 4A44A 3WDXA 3KZ4C 3AJZA 2EF6A 2OPKA 2WZR3 4HK9A 5FYTA 3FWEA 1QJU3 5K0UC 4UBHA 4NUBA 2PQQA 4OI1A 1UY3A 4CE8A 3BTXA 1W28A 2SLIA 4QPIC 1WLWA 4PDWC 4QPGC 4U36A 3WW4A 2PHDA 3RZMA 1QQP1 2WA3A 3H1WA 3KCXA 1HV1A 3DUIA 3O14A 5EFUA 1AL0G 4A42A 5D21A 2XJUA 2Y38A 1XOYA 2JENA 2VBPA 3KQRA 1DHKB 1J3RA 3I7DA 4Q4X3 1IG3A 3WQ1A 2O8OA 5AC92 4OHVA 4MGZE 4UFJA 3EBRA 3K48A 4PIYA 5E8AA 4D69A 4O61A 4SBVA 3FC0A 1E5RA 1QWRA 3SKVA 5FO8B 5JZGA 1W9YA 2CYFA 1SDDB 1U0AA 1YQ2A 4XIOA 2F17A 2D97A 5F2SA 4CDXC 3V0AA 4LJHA 3I3DA 4D7TA 2MNGA 3ZSEA 2ZXQA 5GKAC 1OD3A 3V64A 1O59A 1JZ4A 3BTYA 1QJZA 1S0JA 5F3GA 2PHTA 3AKPA 2QQIA 4IV3C 1QJFA 4LPLA 4YRDA 1X33A 4HZFA 4DUXA 1RUI2 2QZ2A 5FPAA 2D6NA 4BXSV 1AHSA 3LCPA 5FO7B 2WSVA 2H6CA 4DIQA 4NHYA 4LE3A 1VBD1 1H4HA 1NA1A 2DBIA 2XB6C 2ZAAA 1FNYA 2ZBJA 4YVWA 2ARCA 2GC2A 5F7UA 1RHI3 2Z79A 3NL1A 1RUD2 5LB6A 2ZHKA 4AF9A 3DN7A 4OQ9A 3OY8A 3SCFA 4IETA 4IEUA 4KMQA 1XYPA 1SLTA 2PAKA 5CADA 3WF3A 3LPGA 2FDFA 1A3KA 4XF1A 3E1F1 1JXNA 3VLBB 5GZEA 4Q8LA 1SQ4A 1H30A 4IDZA 4CUBA 3RYRA 2VECA 1Y3TA 1TNRA 2DU0A 2WLPA 3MYXA 1GU3A 2PYTA 5E88A 1ZBE3 4GMP1 4RQPB 2P3KA 1DGLA 3NVCA 2IWGB 1CX4A 1W6QA 2DWRA 4Q29A 5GLUA 1QJEA 2VOWA 1PMHX 3ZMOA 1WUVA 2XJPA 4XAAA 3E6DA 3M7AA 2VMCA 4Y26A 4R52A 1UYPA 4JCKA 3TN91 3D3AA 2HEWF 3H0OA 3H7YA 4MLOA 2BQPA 2HEYF 1POV0 2JKXA 3OUIA 4H7LA 1JUHA 4X6QB 1K3IA 3N36A 4IESA 5H9SA 1OSGA 3BODA 2WT0A 1UYXA 4UW5A 3S7EA 4PBPA 5IVFA 4DS0A 5D8AA 4PDWA 1AYM1 1W6MA 3MIDA 4AWDA 2B42B 4R9DA 2Q8CA 1V6LA 4IEPA 3O0WA 1QMJA 1OQDA 1UKRA 2VGDA 4OHWA 3VN4A 1J58A 3WHUA 3EO6A 4YZ2A 3N35A 4HKOA 4FPOB 3IDCB 4CCJA 2QQPA 3KV4A 4N53A 3K51A 1OLME 2ENRA 4EV0A 4LBLA 1CZVA 2GNMA 1VBC1 5FQ0B 1RB8G 3UETA 2JDMA 2ZGTA 2ZTNA 4FFIA 2ZGMA 1H6XA 3E6BA 5FY8A 5JDBA 1OOPC 5ACA1 1IKPA 1S2KA 4CTEA 1X82A 1YQ8A 5F1RA 3RMXA 4C8DA 1W99A 3IDBB 2CAUA 1QDOA 2NP0A 2RS53 1OA2A 5FMBA 3N9PA 3AYAA 5CKQA 1AXZA 3O1PA 3ZFFB 1HLCA 2CWMA 1FAYA 1YFUA 1Z0HA 1E5SA 2ZEXA 3MPBA 2JG8B 5FUIA 2VMDA 5FYZA 1RUE1 5FYCA 2D7FA 3AK0A 3KLSA 5C70A 5I93A 4OCTA 2JKBA 4C90A 2RS31 4QWNA 2RS13 3U11A 1DP0A 2YXSA 3ZPYA 3NSTA 1DQ1A 1CAXA 1PO21 1SLIA 1WWYA 3THDA 1UW8A 1XQNA 2GN3A 2PMWB 4LR4A 2ARBA 4MXWA 1LOEA 3KHBA 3VD7A 2RG4A 1UN1A 3CL1A 3GCXA 3LEGA 3ZFEC 3KGLA 4Y1UA 2D6MA 4GB32 2XH6A 3AP6A 5C8WA 3BVCA 2Q1ZB 4FFHA 4B1LA 4KU7A 1BBT3 1U12A 3ECQA 1ZVFA 2D6KA 1WCSA 2GDFA 1US3A 4HKLA 2FDIA 1K5MA 3AKTA 2WINB 4AEJA 2DFBA 2F4LA 4QXCA 1FX5A 2TNFA 1X36A 4H7MA 5JZGB 4K3UA 1ZA4A 1PNFA 3VBRC 4Q26A 4QKBA 1R1A1 4ASMB 4AOCA 3V0AB 2WUHA 2YU2A 4PF1A 3OPTA 1OLMA 3ZOIA 2PN5A 2B9VA 4TLGA 4HN1A 1RUF3 3MFCA 4JDMA 3N4MA 2QVSB 5F3EA 2PHRA 2P3YA 5FYVA 4CDUA 3WG4A 3UYJA 2VW0A 2LW8A 4GD4A 3MF9A 4RL7A 2LALA 5FK7A 3VDAA 3SEPA 3ZSLA 1OFNA 5CISA 3W20A 5FZ8A 1OA4A 4CXWA 4DB5A 2H6BA 1HB1A 2WBKA 3JUUA 3GCWA 4LBNA 3NO8A 4XEZA 4BJ0A 5AC91 5FP8A 1J59A 1NA1B 2F4PA 1G8WA 4XTMA 1OXCA 3NKGA 4XURA 4YVWB 3J8F1 1F31A 4GJZA 2X10A 3T4HB 4EQVA 3NJYA 3AMPA 1DZQA 2VZVA 5FZBA 3K3NA 1RINA 5DABA 2VVDA 5FZ9A 3OY8B 4MGTA 4HSLA 4A4AA 2GMEA 1XNKA 4RGAA 2ARXA 1DG6A 2B45X 4IEOA 4CP2A 3E6CC 5FMDA 1GP6A 5IUQA 4QDSA 4YVSA 3THPA 5LY2A 4AE2A 3A23A 4F83A 4XZUG 3AVRA 4Z2WA 2YC2A 2JWPA 3T2QA 3O1RA 1RUI1 4FVVA 1D4M2 3PVEA 5BYNA 1OOPA 2PLV3 1K5JA 5FMOS 1JH5A 4FTBA 1UYYA 3D6EA 2W3JA 4YGEA 3WNLA 2A6ZA 1RC6A 2KA3A 5C8CA 1RUD1 1ZM1A 4AHZA 3QH6A 2ZGKA 1C3HA 3PU3A 2AENA 2BGPA 1W6NB 2R0FA 2VBDA 3HNBM 4N43C 4W6XA 4XUTA 4PIXA 1QKQA 5GALA 4CEWA 4EWEA 1WW4A 2VZPA 5AVAA 5IJRA 4CDWA 1U5YA 5FDBA 5D8AB 4Q1RA 1NE4A 1GMMA 4ISRA 4XIKA 4COUA 4PDWB 4NAMA 4QPGB 4XDPA 5KXBA 2GU9A 1W6MB 3DCQA 1ST8A 4JKLA 3HPNA 3QACA 4MUVA 3OD0A 4W50A 2YC0A 1OA3A 5LA2A 2HWE3 2PA7A 4KGGA 3V56A 4CCKA 3Q9OA 3SMHA 2CU5A 2B7YA 5HV4A 1CAUA 1VBB2 1XXNA 2FHRA 3WOGA 4EWDA 1X50A 4N53B 1LCLA 3VZNA 2HWF3 3VBUA 5EHDA 4BQWA 4BLJA 1SPPA 3AFKA 4C91A 5GJ6A 3HAGA 4HOOA 4QX1A 5BNOC 3AP5A 1CAWA 4QQ2A 3UT0A 2OXBA 4CCLA 5F3CA 1SCRA 2XWJB 1DFQA 1LODA 5L7OC 3N9OA 4CDXB 2D93A 3FLPA 4DUVA 3HD8B 4X6RB 2HYXA 3CJXA 4YW6A 3PNAA 3W58A 2VD7A 1TMF3 1CX1A 1DGRA 1RYYA 1W2TA 2RV9A 1HXS2 2CL2A 2DCKA 5C7GA 5EYYA 2ZZQA 3WV6A 3H8UA 3ETQA 5A32A 4YPJA 3DYPA 3K2OA 5F6KA 1VAKA 4QB6A 3CBNA 3LB9A 3BKZA 1JI6A 1EAH1 3VL8A 3VBFC 4IXLA 1CAXB 1SHWB 1WLCA 2RS12 3ZYPA 4Z2AA 2WABA 4MXWB 4QX2A 1H0BA 3GZTB 3AZYA 2ZGUA 1OKQA 1CWPA 5LWBA 4YW3A 4JKKA 1HJFA 4E9KA 1NXMA 2WO3A 4MHRA 4RGKA 4EWAA 2BWCA 2EALA 4NHLA 1IHMA 2GC0A 4OQ8A 4D3WA 5K4LA 4ASLA 1AR63 2ZGQA 2PHXA 2BYVE 3CF6E 3ZO0B 3ZSJA 3O1MA 3POWA 5FZ0A 1S55A 4AAPA 1G9BA 1K5MB 4P08A 1YWKA 3ZXJA 3CZJA 3POSA 5DAWA 3ZR5A 1POV3 4Y1VA 3T0AA 3WEZA 1E57A 3OYWB 4RHV3 1UU5A 5SV8A 2OW4A 3MIEA 5CKMA 1SMVA 3RMYA 5C9AA 1FT9A 2C1FA 5IK8A 4P14A 2BNOA 3C7OA 2GNBA 3VL9A 3USSA 3OTFA 2W92A 2WNEA 2BFUL 2XJVA 3LEKA 4CDUB 3PDQA 2IXHA 1DZRA 2ZMLA 3RS6A 1QJX2 2W1QA 4UXAA 1FMD3 3WCSA 4N43A 1UO9A 5BNNA 1CJDA 1W03A 2JX9A 2ZA9A 4GB31 2AREA 1OFSA 3U10A 2VMIA 5IYYA 3PUHA 1DQ4A 1RTVA 3H8RA 3ATGA 2JDHA 3OJBA 2ORZA 3KQ4B 4CUAA 2VC9A 5FXVA 3WQ0A 3DGTA 3ZYBA 1Y43B 5LEKA 3ITQA 3LOBA 4H14A 2VCCA 3GF6A 4JGZA 4KWLA 4AZZA 1NLRA 2FDGA 4AQTA 5JSPA 4CCDA 2JDNA 4W6YA 2DVGA 5FZEA 1EV13 1MACA 4L97A 5EJ1B 2IUWA 4AGVA 4YVSB 4NPMA 2EXJA 4BPZA 2RVAA 1LGCA 2JICA 2KD7A 1O8SA 4NRMA 2VMEA 1JS9A 2JEMA 4BISA 1RUG2 4DRRA 1MS8A 5BNOA 2UYAA 2AH2A 3AB0A 1PO13 1REDA 2J1RA 5FP4A 4FOWA 5L7OA 2FCTA 4LLOA 1OOPB 1NG0A 4MADA 4UW6A 1WA4A 3K4AA 4O9EA 3U4SA 5IK7A 4Y5SA 4AFCA 2PLV2 3ENRA 5JCTA 1AXYA 5C8CB 1ZRFA 4QHOA 2Q1FA 1GZTA 1CAVA 1MS9A 1GYKA 1ZZ8A 5A7SA 3IM0A 5EYXA 3FMGA 4RS5C 5CFCC 2YZ4A 1MZEA 4RGGA 3GJBA 2AYHA 2D6LX 4CEWB 2A1XA 3POYA 2RDQA 4I0BA 4CDWB 4UFMA 1WMFA 1F9KA 4NJ4A 5I91A 3M4FA 3C3VA 5A7WA 3VBFA 4WVMA 3WP4A 2JDZA 2K2SA 3NV4A 3P3NA 4GKYA 3RJ2X 3WP3A 3WP6A 2VTFA 3KF3A 2E6VA 2P3IA 1D4M1 2BVVA 3K46A 3MO4A 4OUMA 2ZGRA 1NQJA 4LIUA 4XBNA 3ZFEB 2D5FA 4X8PA 2X09A 1CAUB 2HWE2 3ASIA 1UQXA 4AVBA 5IVVA 5DAVA 3HBKA 3VBUB 1KRIA 2QKDA 1SPPB 4K1YA 1J1TA 3JBG3 3C8XA 4LO8A 5I0TA 2GAUA 2HWF2 4IERA 1CAWB 4DEVA 2XVKA 1VBE1 4XMIA 1RUC2 2L9LA 4DEQA 2B8MA 1GZWA 4AI1A 4P9GA 3OBZA 2QQVA 5FZ6A 3T3YA 3JU9A 2W39A 5HV0A 5JUVA 4OI2A 5IVCA 1ZZBA 1UZWA 1MZ6A 1C1LA 2W68A 1H8TC 5JMCA 2CY6A 1UD1A 2QCSB 2XGXA 5LBCA 2SBAA 4XUPA 4MH0E 2WNUC 5ANNA 4AI0A 3BALA 2AEYA 2TBVA 5JXIA 1YQ6A 2A7AA 2H0BA 2JD4A 5A32B 3VBOA 4YGCA 5F3IA 4XFBA 1VBB1 3ZYJB 4P9YA 1W90A 1SCSA 1ZNPA 2QQUA 5HXMA 1NZCA 4GXLA 1JOPA 3LGRA 4CPBA 3THCA 1NKGA 5IATA 1W8FA 4HT1T 1KITA 2R49A 4CP0A 5IK4A 1ZRCA 4LBOA 1WD3A 2QQKA 1YEWA 2JE9A 4L11A 4XJWA 2XJTA 2XLFA 4J1WA 3AZZA 4Y5TA 4P5HA 3WXPA 3G6JB 4FOYA 3N9MA 4AFMA 1HXS1 5FXZA 3LIGA 4XW3A 2E51A 5EV7A 4Y4YA 1Y7BA 2P5BA 1UIKA 1X9PA 3BYWA 3CKHA 2W1SA 1W9WA 3OB8A 5LBFA 1STMA 2JDPA 5F6LB 2W91A 3W9AA 1GNHA 2RS11 1PGL2 4J25A 3NJXA 2RR13 1CZSA 3KT4A 4Y24A 2Y8KA 2TEPA 4QM8A 2FZ1A 5DMYA 4N43B 2ZEYA 5BNNB 2D5HA 2VVFA 3TEZA 1MVQA 1V70A 3WG3A 4OHXA 2LROA 4IQPA 1NCQA 3R4SA 1QOSA 3A7QA 1SBEA 5EPAA 3VD4A 2A71A 5B4NA 4Z92B 2ZPXA 2Q8EA 4QX7A 4DMIA 3OOXA 3WG2A 1I6XA 1JYIA 2GNTA 1V6KA 3WR0A 1LR5A 1C8M3 4QHZA 1Q8PA 2Q4SA 2KM2A 1JMUB 5DUVA 3RDIA 1FV2A 2ZMNA 4YARA 3LDKA 4IEQA 1UNBA 2P34A 3ILFA 1M06G 5CFDA 4RD7A 1LULA 2QQLA 3DKWA 4KWKA 1QJX1 1PHMA 5J98B 2DUPA 2JG9C 3P5BA 4MGKE 4DOUA 4XHBA 5BNOB 5JWPA 4UFKA 5A7PA 4AI8A 1D2SA 2ZGNA 5L7OB 3CIHA 3ACLA 1HRI3 3EJKA 3TAYA 3ILRA 4QU2A 1Y4WA 5DXDA 1PO12 2B4KA 2RHPA 5KHGA 1RGSA 4KBZA 3BCWA 5FZ1A 3AC0A 4QB1A 4ZU7A 1IS5A 2IFWA 3R4UA 3AMHA 1CAVB 4GQ7A 2CWSA 4EN7B 2XJRA 3M8LA 5FREA 5HPOA 3ZXEA 1A8DA 2WNUA 4BQXA 5FPXA 1U5ZA 2HWC3 5DUXA 3OSDA 3T09A 1I5ZA 3MLJA 5IW0A 4DNYA 4QQPA 3JXSA 2VG9A 4BMBA 1TQ5A 1UOGA 3AKRA 5A7WB 3PTYA 4RSUA 3VBFB 1VLNA 4WVMB 4XF0A 4R9AA 3POJA 3FFQA 1DGRN 1BJQA 1OVSA 1RUG1 4LK7A 2ZGLA 4TXWA 2A73B 1LEDA 4GH4A 1W2OA 2UYBA 3AMNA 5FY4A 2X05A 3TB0A 5K8SA 1NOVA 4UW3A 1I9RA 4HLTA 4BA6A 2E9QA 2WNOA 4JTNA 3WSOA 3J7NA 2C9KA 2CGNA 4HPKA 3ALQA 3WQ7A 2EIEA 3TEYA 5A1AA 2RDNA 3TNQA 4QQLA 4AEDC 1H2KA 2E33A 1UOBA 2NZ9A 1HRV3 2WFF1 3L2YA 2UWCA 3PUIA 4D6QA 2G4IA 4COVA 2QJVA 1QY4A 1BEV3 3KVBA 3EQEA 3JBG2 3TRSB 2R6QA 4DXRA 2VOKA 3A0KA 1H9WA 5LY1A 2OZ6A 5FLHA 1OC1A 2VW2A 5FZKA 4JVAA 3RNSA 5LK7B 1JOBA 3VV1A 2QDNA 2PTMA 4CDQC 2ZCWA 3WX5A 1XYNA 5DZGA 2WYFA 4HKWA 2VMHA 5FQ0A 5FY0A 5FPZA 1Q56A 1ND3C 2HBTA 2HWE1 1BK1A 2RJKA 4Q4Y3 1PIV3 5K7PA 3I2JA 5KHKA 2DURA 1OH3A 4QKFA 1FPN2 1UCXA 2VUCA 1XBFA 3AYDA 2J1UA 4GULA 5FZ3A 1RUC1 2XL7A 4LKSA 2BWAA 4JV4A 4YYOA 3VUOA 1YNAA 3JD72 2JG8A 2RM23 4AYUA 2EAAA 3RVHA 2W47A 2XOMA 4MV2A 2JDKA 3OUJA 3WT3A 4S2HA 5A7OA 1UY0A 2UWAA 2YFUA 3MBWA 3VZJA 4OFGA 3WP5A 4BK5A 1VALA 5L9RA 1WMXA 2HLEA 3SISA 4EN8B 3PVNA 1LJ7A 4ES9A 4XE9A 5JMOA 1T6GC 3B7MA 3NW4A 5H9RA 5L9VA 1UPIA 2ILMA 5FR3A 3ZXKA 3QH7A 4LOSA 3RZGA 1US2A 5LEJA 2J22A 3WW3A 5GZCA 2NMOA 3VZOA 1XC6A 4M01A 1UYZA 1OMIA 2RR12 2WO1A 1YFXA 1TEIA 4UFLA 5CAZA 4NIDA 2HH9A 1HDKA 5CFCB 1G6NA 3O1TA 4AQSA 1NCQB 1C5HA 1W9FA 3N7LA 2P3JA 1W2AX 2BP6A 1PZ7A 2WWJA 4I0WB 4XJ8A 1A6CA 1G9CA 4QPYA 4BYYA 3VHOA 4LQRA 4CCEA 2IVJA 4YFWA 3BGAA 3T2TA 2ZGSA 3FN9A 3VZLA 4CZSA 5HCAA 1O3TA 3KV9A 1POV1 1Z7S3 3E97A 1S0FA 1AL23 4IEVA 4LBJA 3ZDSA 4OYUA 4COZA 4B29A 2DVDA 1QNYA 3FBMA 1O91A 1K45A 2O8QA 4WV8A 4XF4A 4IE4A 1PGL1 2NMNA 3MUZ1 3WY6A 2IC1A 2VZTA 2C6SA 4CRQA 5AFBA 5CFDB 1JZ2A 3VGIA 2MEV2 2ZX1A 3WDTA 1YRZA 2BNMA 3J7HA 2VXRA 3QOPA 5A3TA 4MGYE 4AW7A 4BE3A 4MVTA 4OZOA 1YJLA 5FOJB 1PX4A 3HQXA 2LUWA 3CO2A 5FYBA 3BI3A 2GN7A 4COWA 5CU1A 1PNGA 3B5LB 4NR1A 3F2ZA 2LM3A 3NJVA 3NMBA 1LU2A 1Z78A 2GMPA 3U37A 1QOOA 5LA9A 1VRH3 4HK8A 5F5IA 1DQ2A 1HRI2 3I3MA 2VNRA 3PJYA 3ABZA 3J7LA 2W87A 3MIGA 1OQ1A 4N90A 3IN9A 3VBSA 3M3EA 2G9ZA 1H8TB 3I2DA 4AAXA 1PX3A 3NKTA 2VQTA 2WNUB 3K4DA 3U75A 5HI0A 2WJSA 3POFA 1R093 4Q4W2 1NZIA 2W52A 4KG0A 2R0HA 2JB4A 2NYYA 1ASJ3 3IZOA 4FCAA 4IW3A 2R063 2VULA 4UW4A 2HWB2 2YHJA 1VMHA 3ZYHA 1DYKA 4Q0PA 3TYJA 4WZFA 3O1VA 2P6CA 1OUXA 3DV8A 3HNYM 4AHYA 3LA3A 1Q8QA 4GH4B 4JKMA 3SH3A 1NT0A 3LEMA 1H1MA 4ARYA 1ZREA 3VKOA 4JGYC 2WO7A 3WVJA 2J1AA 3NV3A 4KQ7A 3O5SA 1IPSA 1UZZA 1AUYA 1W6NA 3D5OA 4YNIA 2VNOA 1H9PA 5FRAA 1W6OA 4HPKB 2OYZA 2OT7A 1ODMA 1CPMA 2VL4A 3WDVA 5K0UA 1KDKA 1R64A 2OKXA 1ENQA 5JSOA 2BU9A 5FZDA 1BLZA 4QPIA 2Q8DA 4DFSA 4WVWA 4NHXA 1AYN3 2XDVA 4QPGA 4WZCA 3ZYFA 1HRV2 1JYCA 2CTVA 2YV8A 1XU2A 3HJRA 2BGOA 4AHWA 1AJKA 1LOFC 3JB4C 3OF1A 5T52A 3ST7A 4BIOA 2C9AA 5IK5A 3PURA 2BGCA 3IMMA 1JYTA 2R7EB 1APNA 5F5QA 1DQ5A 2AEZA 1PVC3 2B5HA 2VQAA 2ZKNA 4CUCA 4UOJA 1OPMA 2Q30A 2RDRA 2WYSA 4Q8KA 5JXGA 3HVDA 5FWJA 1V6JA 1CQ9A 3AXEA 4DY5A 1XNBA 2WQ4A 5IHRA 1LOCA 1LOGA 2PELA 4CDXA 3S5QA 5ABJC 1RXFA 1PIV2 1Q3EA 2PHLA 3HOBA 5C4WC 5B4XA 1MQTC 5JPMB 2ZEZA 3A21A 2QQOA 4MX3A 3ZSMA 4AK3A 3R05A 4IV3A 2W1WA 5FKBA 1CD3G 1UZVA 2AR6A 2I07B 5HXVA 5C5UA 1GQGA 1RVF3 4R4XA 5J1XA 3ZIXA 3RZHA 5E16A 4XJUA 1G86A 2R071 5FY5A 4Z07A 3OPZA 3N9NA 4TSVA 2WZR2 4QB2A 1WCDJ 3KV6A 4XFHA 4B1MA 1QJU2 1DQ0A 2WN2A 1BHGA 5LBEA 3GGLA 5FKCA 4BK4A 4XC9A 1XJAA 3IAQA 4JQTA 2OZJA 3MV11 5T3NA 5A33A 2EA7A 3WDYA 5LK5A 1ULDA 1FPN1 3AKQA 3WNPA 3GHNA 4L0PA 5K9YA 1ULCA 1BZWA 1CGPA 4HSJA 5LASA 1WCUA 1GP5A 2X5IC 2XR4A 4Q4X2 3JD71 1GNZA 3BPZA 1H2NA 4W4ZA 4E2GA 1AR93 4MG2A 1FOD3 5LRSA 4XZPA 3AM2A 1D4VB 1MZFA 3OYWA 4ZU4A 4BCUA 2D40A 1NXD1 5EZWA 5FZLA 1Q8SA 2Y33A 4XCAA 4C1WA 2JJ6A 1NY72 5T55A 2HKXA 5IAXA 4O65A 3FLTA 3OD4A 1DQ6A 5F2WA 1N3PA 3M70A 2KXLA 3WNMA 5BY5A 4JGYA 1W8UA 4BQYA 4YFZA 3Q8AA 3I2OA 4HFSA 4XBLA 1AL22 3AL6A 1O4ZA 5C33A 3N7MA 5FFOC 2VVEA
chains in the Genus database with same CATH topology
4FPHA 4WM8C 1XNCA 3B00A 1DDLA 4RA0A 4XYXA 2DUOA 3CEWA 3KM5A 2VH9A 4E4DX 1B35C 1RHI2 2BW8A 1LB2A 4LHLA 2ZZJA 1MS0A 3VBSB 1VRH2 4CDQB 3ZFGC 5T5PA 4OHYA 3RI9A 4D7SA 5J3UA 1BMV2 4XDQA 1CN1A 1ND3B 2A6WA 2YY1A 1W2UA 4AFDA 1R092 3AP9A 1CR7A 2MEV1 4RR3C 1ASJ2 1ZBE2 4LEJA 3RSJA 2R062 4R8HA 2NPIA 2OIIA 1AR73 1RUJ3 3LSDA 3E5QA 4EN6B 2BVBA 1IQAA 1MQTA 5CA6A 2B9UA 3ZYRA 5A3MA 3URFA 2D98A 4ZU5A 1QXPA 1C28A 1IZ3A 1EPZA 1HRI1 3LAGA 4PIZA 1BQPA 1B09A 1W6OB 1NCRC 3IKWA 3KD4A 4COYA 2I2SA 3B9IA 1H1IA 1PK6C 1WLDA 4ZKTB 5K0UB 3T1LA 1S0DA 1S0GA 4QPIB 4XXPA 1TME3 2Q8OA 1QJY3 2FZ2A 1JUIA 2OUHA 4Q4W1 4C0BA 1JTZX 3H50A 1XE8A 4LO6B 1RUH3 1AYN2 2HWB1 2YPJA 4NWWA 5F9TA 1GICA 3TNPB 3UKNA 3WW2A 3ZFEA 2Q0AA 3NAPC 3ZYGA 1W0PA 1REEA 4C1XA 1M4WA 1F5FA 5CB7A 1PVC2 1Q43A 2X5IA 4P9LA 2ET1A 1C5IA 1QGLA 4L8QA 4LO4B 2QFEA 1GFF2 2WA4A 3VBRA 1YO8A 4I09A 1LU1A 1XYOA 1ULGA 3MW2A 2PHFA 4NWVA 1FNZA 1AF9A 1W6PB 4IV3B 2GC1A 3ZXFA 2RS52 2OVUA 4B3NA 3OBRA 1VBA3 2RMU3 1WCKA 2DTWA 1DGWA 1KXGA 1RVF2 1L3JA 4IV1C 1GZCA 2C5DA 3JQXA 4E4ZA 5CG8A 2XJSA 3ZXAC 1V9U3 3I59A 1SLAA 5JR7B 5A33B 2XJQA 4WBBA 2WQZC 3LWCA 5J36A 3S6PA 1QQP3 1W39A 2JECA 3I4IA 3O12A 2OA2A 4AGGA 4Y1XA 3ZFGA 3M1HA 4BWOA 4DXZA 4G4FA 4GA9A 4KU8A 1H1AA 3B02A 3PVBB 4XETA 4L9BA 1BBT2 1QXJA 1CIWA 4YM2A 2XG3A 4TZDA 3VKLA 3O7OA 1AR92 5GLZA 1FOD2 3W59A 4RR3A 2WZR1 3U0ZA 3TWIA 2HWD3 1QJU1 1IOAA 4I3GA 1O5UA 2JXAA 2EIGA 3BOWA 1RUF2 4PQ9A 4JGYB 4LA3A 2XKPA 3ES4A 4AQ6A 1J1LA 2D3SA 2BPA2 2ZGPA 4FPLA 5DZFA 3LSEA 2NM1A 1G9AA 2E7TA 4Q4X1 2XPJA 1OD5A 5B2GB 2GC3A 1O3SA 3VZKA 1LTEA 1NLSA 1YFWA 2Y26A 4ONUA 4XMAA 4DQAA 4EJRA 5L19A 4NOTA 2ERFA 1G7YA 3FHIB 4KWJA 1XE7A 4AG4A 1NY71 4K7JA 5KXEA 4B8EA 3NAPA 3ZMNA 4WVVA 1ND2C 1D0HA 1ENSA 2YMZA 1QHDA 1MVEA 1O4YA 1VAMA 4K8FA 3VHPA 1YFYA 1CONA 2FBEA 3D0JA 1JOJA 4PLOA 4AVAA 5ABJB 1X8EA 4JC1A 3G7DA 4G3YC 1MQTB 3UL2A 5I8YA 4R9BA 2QZ3A 1UIJA 1HQNA 3ZXGA 1RHI1 1I1EA 2UY9A 1GKBA 3RZZA 2VQ0A 5EXOA 3U07A 2ZGOA 1VRH1 3QD6A 3TN93 4EROA 5I0SA 2V5YA 1WLTA 1BMV1 3A4UA 1VB2A 2IFRA 1R091 4XBQA 1QJY2 4CP1A 1ZBE1 2ZOEB 2A6XA 2R061 1RUH2 2UWBA 2Z5WA 4M3CF 4K6BA 1AYM3 2Z69A 2Q5TA 3R6SA 2WFPA 2X5IB 3OGGA 1GZ9A 1QDCA 3WINE 3LOIA 3VBRB 3IMNA 2G9FA 4Q0SA 2XVLA 1GSLA 1VBC3 5BNQA 4FAGA 5JI7A 4XILA 4PF5A 2LTNA 1AYN1 5HCBA 4SLIA 1DF0A 2E7QA 1TMF2 2PHUA 2RJLA 4LE4A 2DU1A 2XUMA 1W0OA 3IT8A 4S2FA 3AFGA 2D6OX 1VBA2 3JQWA 2GALA 1KFXL 3B01A 4WM8B 2OUJA 4F8AA 3ILNA 5KC6A 1ZZ9A 2A3WA 3UKTA 4MZUA 1UU4A 3I59B 3AX4A 3AXDA 2IXJA 2RS33 2DUQA 1LHWA 1V9U2 4FOVA 4NPRA 1YUDA 2D3RA 3J4UH 1EPWA 4I3PA 4BQ1A 2ZACA 1PO23 4EN0A 1RJ8A 3ZFGB 4OHZA 1ULEA 1QQP2 1VR3A 2RS51 1AR62 2ZX0A 3GBWA 4AFBA 1QU0A 2X53S 3ZXDA 1S0CA 2WIIB 1RVF1 2MHFA 4XQ4A 4RR3B 4LT5A 4Y5Z0 2VOVA 4WVZA 1VP6A 4RHV2 2VUAA 5E1RA 3FUOA 3U4XA 3VDDC 4Y1ZA 3D0SA 2HWD2 4YGBA 1R1A3 1WBLA 4QD2A 5IT6A 1S0EA 1AJOA 5SV5A 4N7UA 3LA2A 1EY2A 4RS5A 5CFCA 1TE1B 1FMD2 4B4PA 2R043 1Q5OA 4P9JA 2AZ5A 1JN2P 3WLUA 1BBT1 3ZYIB 4QGMA 4LHKA 4Y1YA 3CJIC 1OPOA 4TYSA 1C57A 4K1ZA 2QDRA 1GANA 2BNNA 3DL3A 5JPNB 3J8F3 5T5JA 3JCIA 3NAPB 2VY0A 1RUF1 4HETA 4FOQA 3VHNA 5BNPC 1EV12 4HN0A 4CEYC 3TOJA 2XBO3 1IS6A 3HBZA 4Q0VA 1UPSA 2DCJA 4M3CE 3KT7A 2XLGA 5GLWA 4OULA 1WW6A 4P9WA 1JBCA 4EN9B 3PHMA 1RUI3 2JE7A 1PZ8A 4Z82A 4AGRA 4A7ZA 1H8TA 3WG1A 1LEMA 2ZS6B 4GWNA 1D0GA 1YCIA 2W08A 2A6YA 1AX1A 1RUD3 4LHNA 3IDEA 3JB8A 3FZ3A 2WS93 1N1VA 1CVNA 3E5UA 4XJ9A 4DY3A 4LLFA 4RFT0 1SACA 2DF7A 1Q8OA 5FO9B 4PBOA 4FP3A 4XFCA 1WGPA 2NLRA 2PLV1 4P9XA 3MW4A 3LZZA 5JZGC 4I01A 3MI8A 1FXZA 1F5JA 1TNFA 3B94A 3TBDA 1PM7A 4AVSA 3SHRA 4Q4V3 3UJQA 1RJ7A 1PVXA 2VNGA 3VBHC 4IEZA 4XFFA 4IEXA 3LKJA 3EXUA 3RQ0A 3VDDA 1VBC2 4DINB 1UL9A 4XPVA 2K0GA 4JRLA 3MDPA 4M0NA 4M3CA 2ATFA 1RUH1 1ZX5A 4YZ5A 4W65A 1NA1C 1V6OA 3SITA 1KS4A 5JIAA 1KS5A 1LENA 4Q27A 4K20A 4JDOA 5JOWA 2XWBB 1HX6A 3H9AA 1LESA 1YIFA 3MLKA 2HWF1 1PMIA 3CJIA 2D6PA 4I0AA 1EAH3 2VU9A 4NHKA 3MICA 4HANA 4HVRA 3AKSA 3KCYA 3WCRA 1DU3D 3IIAA 1ND2B 1H8VA 1BKZA 1ZRDA 5BNPA 2DV9A 5I8SA 3RWNA 1MS5A 1TMF1 1WW5A 4CEYA 3M3CA 2ZKLA 2JG9A 2NQYA 1ZZ6A 1IS4A 1VBA1 3ELNA 5DZEA 1DZTA 1QF3A 4QX5A 3UV9A 1OLRA 3I8TA 2NN8A 2Y0OA 4FXGB 4JRAA 5J7MA 2WKKA 4LBKA 1ULFA 2DCYA 4N7IA 1N3QA 1AX0A 4NVPA 2YROA 4XFAA 2PHWA 1V9U1 3VKFC 4A7KA 1R1A2 5KHJA 4RS5B 3AP4A 4F7ZA 5D8AC 4YW5A 3AYCA 3MIBA 4FPEA 1AR61 2UU8A 3RRDA 4GIQA 1KJLA 2R042 2GH8A 3WZ1A 4LBQA 5AFEA 3MZHA 4OI4A 4GB33 4S2GA 4AEKA 3SXWA 4XJAA 4JDNA 3J26N 2O0OA 1C8M2 4RHV1 4N53C 4HVOA 1Y9QA 3WDWA 1VAVA 2HWD1 3J8F2 2DYCA 2HEVF 3S30A 1V6MA 4AEDA 3UJOA 1UKGA 3WDUA 1FMD1 2XBO2 3FJSA 4NHMA 4S2DA 3AYEA 4FPJA 1S2BA 1OHFA 1ZZ7A 3VBHA 2ES3A 4CYDA 3USUA 3V0BB 4LUMA 3FUQA 1RMU3 2D3PA 4CDQA 1H4GA 3FFZA 1WD4A 4YZ3A 3HWJA 3OCPA 3T1MA 1LRHA 1SBFA 1YI7A 1ND3A 2VPVA 2R1BA 2ZX3A 3NJZA 3FX3A 4XJZA 3WW1A 2HWC2 4FO9A 3FE5A 1EV11 4OI0A 2HJIA 4E27A 3ZSKA 1DYPA 1MS4A 4WM7C 2HYKA 2WS92 4FT8A 1WW7A 2AGSA 1SLCA 3AZWA 3P3PA 4Q0QA 4X8NA 1PO11 4MSVA 5KHHA 5JAXA 3N3HA 1N1TA 1K5MC 1R083 1D4M3 3CU7A 1ZBA3 3O0VA 3ZN5A 1WBFA 2VMGA 5CVRA 1BEV2 4LA2A 5JI9A 4PCRA 3GYDA 2PFWA 3AJYA 4CDUC 1URXA 1CJPA 4IL7A 3PJQA 4MGIE 4Q4V2 3VDDB 1VBE3 4QGLA 2R32A 3KGZA 3SH4A 1RUOA 1MEC3 3GZUC 3MFAA 3D82A 4H55A 4M3CB 5CIRA 4L99A 3MF6A 4FPCA 4DZGA 4Y22A 4OUSA 4BLIA 1A78A 3MIFA 3AZVA 1SFNA 4Q4Y2 1O5LA 1QXRA 3PMEA 4B7EA 3CJIB 1NE6A 1VBB3 1ENXA 3JBG1 1W6PA 1QH6A 3VHRA 1HV0A 4V1PA 4ES8A 4YVSC 3KMHA 1EAH2 4LTAA 4XTPA 3RJRA 1V00A 1V6NA 5FAXA 5JSRA 2R30A 1UF2C 2RM22 5BNPB 4I2OA 4XF9A 3SCGA 4CEYB 3ES1A 1VJ2A 3GNEA 3WUDA 2JG9B 5GZDA 1NYWA 5T54A 2EXHA 1RL3A 4GMP0 1WMDA 2BEOA 3APBA 4W6WA 1YI9A 1HXS3 2ZHMA 5C8CC 4J1XA 4YM0A 5DUWA 3ZVXA 2B46X 2G9GA 4E2SA 2YDEA 2PAEA 2V09A 4CEWC 4AVCA 2EXKA 4CDWC 4AHXA 3MLLA 4XQWA 4HL0A 1BCXA 5L36A 3H7JA 1VIWB 1YLLA 4N9IA 3A0NA 1KRIA 1COV3 5DG1A 2V73A 5BUVA 3GHMA 4M00A 1WMEA 3ZX7A 3MIHA 4BH9A 3SCHA 2IXLA 4LBQB 4BM8A 2UY8A 5E89A 4WM7A 1BXHA 4KBBA 1H2MA 2IXIA 1UMZA 5I0UA 1ENRA 5GLVA 3M3QA 1Z7S2 2E53A 3VBUC 3QLQA 4J6GA 4I30A 1JW6A 3OGJA 5KC5A 2CGOA 2RR11 4AEDB 2EAKA 1G9FA 4QQHA 1SEFA 4K9SA 3SLIA 1RUNA 3MPPG 3ZN4A 5T5OA 2VW1A 1DBNA 5DDJ3 1U5IA 5FBZA 1QJX3 1LOFA 2E7AA 3VBHB 2R041 5JIUA 4G9SB 3USUB 3SNMA 2MPFA 5JVVA 3HT1A 4E4SA 1RMU2 2XLAA 4GWMA 1C8M1 4Q0UA 1LOAA 2CV6A 2YGLA 1UZYA 2GSYA 3BTAA 2DFCA 4AQ2A 2YGMA 1A8MA 3S0MA 5ABJA 2D43A 4C0HA 3B93A 2FMYA 3GZAA 2BFUS 5C4WA 3RYKA 4D7YA 2XBO1 3RG0A 3X29B 2AUYA 3RYPA 2DCTA 1UX6A 2DCZA 4YW4A 4GALA 1RUG3 2UURA 5LRRA 5BV6A 2WZPP 1PGSA 1MS3A 1R082 4P9IA 3WUCA 1W6QB 5J48A 5C9AC 1ZBA2 2HWC1 1U5XA 3MEPA 3AP7A 3PMSA 1VB4A 1AR83 2WFF3 3M3OA 1ZRRA 4KL1A 3V65A 4INDA 1SLBA 2WS91 4H3WA 5BNNC 4KG8A 1VBE2 1MEC2 4Y22B 4A7YA 5H9PA 3GALA 5TSWA 1N47A 2WNVC 4IEWA 4L92A 5J96B 4JGZC 1IPKA 3B69A 1HRV1 2WC2A 2O1QA 3H3UA 3RI8A 3VKNA 3O0XA 1BEV1 4Z8BA 4YZ4A 1J3PA 3IPVA 5JOZA 4Q4V1 1RUC3 4MYEA 4WM8A 1GV9A 4XXAA 2A6VA 4R9CA 5D1IA 2WT2A 2TUNA 2CNAA 4YG0A 3BIWE 4YM3A 5I8TA 2N7GA 1B35A 5DUUA 3M3IA 5T5LA 3B9CA 4Q4Y1 4QM9A 1PIV1 2P17A 1F2NA 2WT1A 4QGNA 4AVVA 3DPRC 5A3LA 3VZMA 4AFAA 1ZYBA 4BIFA 3BU7A 2DVBA 2RM21 5GZFA 2VUJA 1COV2 4AXOA 4FP2A 4AEMA 4B7KA 5JOYA 4WM7B 1FATA 4YZ1A 1J3QA 1AXKA 4FPGA 4KGQA 2I45A 3ZN6A 3EHKA 2EVXA 4L2NA 2P2KA 1HQWA 4LULA 1NCRA 1C8NA 1LHOA 1C1FA 1PK6A 1IPJA 2Q1MA 1IS3A 5EWSA 5JOXA 3INAA 4FXKB 4Q2FA 4DRVA 5KHIA 4YG6A 3B3QE 4B4QA 4YSFA 4FPKA 2ZHNA 4FTEA 4ITCA 5FMOL 1VBD3 3RPQA 2B39A 4LO5B 2BBVA 2A3XA 5DDJ2 4JQRA 1BYHA 1AZDA 2X29A 4YM1A 4PLNA 3HMYA 3VBOC 1X7NA 3CLPA 1KDMA 5FLIA 3KS7A 4BZ4A 1Z7S1 3ZIWA 5H9QA 4BMEA 1AL21 2XKOA 2W0XA 3MW3A 4JAAA 4FBFA 2WNVA 4A3XA 2ET7A 5C4WB 2Z2SB 3KB5A 4QQOA 1YHFA 1AR72 4GMP3 1RUJ2 4FSJA 4PLMA 4QHBA 5C6CA 2K9ZA 2ZJCA 4HBNA 3AMQA 1SDWA 4DPNA 5FCCA 3GBGA 2Z42A 4FPFA 2WL1A 5BXXA 4LBMA 4IV1A 1XU1A 1LHVA 4OLLA 3H1YA