3AYWB

Crystal structure of human nucleosome core particle containing h3k56q mutation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aywB00
4ZUXC 5AY8B 5B1LA 1WWIA 3MGRB 5CP6D 3TU4B 3MGQB 4WU9D 3AYWA 3V9RB 3AZEA 3B6FB 3W96B 5B0YC 1TAFA 4LD9B 2FJ7A 4CAYA 5B24C 4YS3A 5B1MC 5GT0C 3AZLA 3C1CB 5AV8B 1ID3A 5KDMA 2YFVA 3X1VD 3WKJB 3B0DC 5DNND 3X1TB 4J8WB 5GT3C 2HIOD 5FUGA 3A6NA 3AZHB 2NQBD 4KGCA 2HUEC 5G49A 1P3MA 3LZ1A 3AZND 5DNNC 3W98B 2AROB 2NQBC 1H3OA 5AV6A 5B33C 5GSUC 4H9OB 5AVCB 5B40D 3MGSA 4CSRB 1KX3A 2YFWA 5AV5B 1JFIA 4JJNA 5E5AA 1HQ3D 3WAAD 5B40C 1ZLAD 3UTBB 1KX4D 2F8NA 1TZYA 3REHB 4J8UC 3TU4D 3MGQD 1KX5D 3X1SA 1HQ3C 4YM6B 2RVQC 3WAAC 1ZLAC 1R4VA 5AVBB 4H9SC 4X23B 1S32A 2NZDA 4R8PB 3AFAA 3MNNB 5JRGB 5B32A 5BS7A 1P3BB 1KX5C 5GXQB 3LJAC 1U35D 5BNXB 1ULYA 3MVDB 3LELC 3AZFA 5AV8D 2CV5D 4Z5TB 4ZBJB 5C3IB 1U35C 3KWQD 4KGCC 2PYOB 3AZMA 3X1UA 4KUDC 1AOIC 3UT9B 4ZUXA 3NQUA 1P3KD 3KUYB 3X1TD 4NFTA 4H9QA 5AV6C 5F99D 3AZJC 3KWQC 1P3OB 3KXBB 3MGPA 3AV2D 3REIB 5B2IC 1B67A 5B0YA 3VH5A 3UTAC 3AZID 1BH9A 5F99C 4J8VD 1P34B 3AV2C 5B24A 3LZ0C 3B6GB 5B1MA 5GT0A 3REKB 4H9NA 3WA9B 5AV5D 3NQJB 3AZIC 4J8VC 4EO5C 3WTPB 1P3FC 3AN2D 3UTBD 3O62C 1F66C 3R45A 4WNNB 1S32C 3W99D 2NZDC 4J8XD 1P3AC 4HGAB 3AZKB 5AV9D 5GT3B 3AN2C 2BYKB 1P3IC 1M1AB 3C1BB 5AVBD 4X23D 3W99C 3X1VA 3AZFC 4UUZA 2F8NH 5CPIB 5JRGD 5DNNA 5CPJB 5BO0B 2NQBA 4G91C 4QLCD 5AV9C 3W97D 5B33B 5GSUB 1EQZD 4Z2MG 5DNMC 4WU8D 5BT1D 5B1LB 5CHLB 4QLCC 5B0ZC 3MGPC 1Q9CA 5B40A 1P3PD 3W97C 1P3LC 1EQZC 1M18D 3AYWB 3KUYD 3AZEB 4WU8C 5CP6C 4J8UA 4WU9C 1P3OD 1HQ3A 3AZGB 3WAAA 1P3PC 1ZLAA 1TAFB 2FJ7B 4H9SA 3RELD 4CAYB 3VH5W 1M18C 4YS3B 3AZLB 3VH6A 1KX5A 3LJAA 1HTAA 1ID3B 4XZQD 4G92B 3LELA 3B6GD 3WA9D 4NE5A 5KDMB 2YFVB 4Z66D 1M19D 1U35A 4H9PA 3WTPD 3KSYA 5FUGB 3A6NB 4DRBA 4KUDA 5G49B 1P3GB 1AOIA 3X1VC 1P3MB 4XUJD 3LZ1B 2CV5A 4E45A 2HIOC 4KHAA 3AZJA 3AZKD 1M19C 3KWQA 5B31D 1H3OB 5B2IA 3REJD 3MGSB 3AZNC 4XUJC 1P3KA 1KX3B 3UTAA 2YFWB 1JFIB 5F99A 4JJNB 2BYMA 5E5AB 3AV1D 3AV2A 5B2JD 3LZ0A 3REJC 4WV4B 2F8NB 5AY8D 4AWLB 3MGRD 1TZYB 3AZIA 4J8VA 1P3FA 3AV1C 1KX4C 3X1SB 1BH8A 5B2JC 3O62A 1F66A 3B6FD 5AY8C 3AYWD 3W96D 1N1JA 3MGRC 3AZED 1S32B 1P3AA 3TU4C 2NZDB 3AFAB 3MGQC 5B32B 4LD9D 3AZGD 3AN2A 1P3IA 2FJ7D 3W99A 2IO5B 3C1CD 3VH6W 4J8XA 4YS3D 3AZFB 5BNVA 5CPKB 3VH5T 4LD9C 5AV9A 1ID3D 3AZMB 3X1UB 3WKJD 5AV8C 5DNMA 2CV5C 4ZUXB 3NQUB 4J8WD 3AZHD 4QLCA 5B0ZA 3W97A 4H9QB 5B31G 1P3GD 3MGPB 1P3LA 1EQZA 1P3KC 3LZ1D 4WU8A 3W98D 5CP6A 3X1TC 2AROD 4J8WC 1BFMA 5B0YB 4WU9A 5AVCD 1BH9B 1P3PA 2LY8A 5B24B 1M18A 3W98C 5B1MB 5GT0B 4H9NB 5AVCC 5E5AD 3RELA 5AV5C 3R45B 3WTPE 3REHD 3B0DB 4YM6D 4XZQA 3UTBC 2HUEB 4R8PD 4J8XC 5JA4A 3MNND 3X1VB 4Z66A 1P3BD 4UUZB 3AFAD 2HIOA 5GXQD 5DNNB 5B32D 1M19A 4DRAA 4YM6C 3WTPA 2NQBB 5AVBC 4X23C 3MVDD 2JSSA 4R8PC 3AZNA 4XUJA 5JRGC 1B6WA 4Z5TD 1P3BC 3B0CW 5GXQC 4M6BA 5CPKD 2PYOD 3VH6T 5B31A 4H9RA 3MVDC 3REJA 3AZMD 5B40B 3UT9D 5BT1C 4Z5TC 2CWEA 4NE3A 4ZUXD 5C3IC 4J8UB 3KXBD 3AV1A 1KX4A 3REID 1HQ3B 5B2JA 3WAAB 1ZLAB 3UT9C 5AY8A 3KUYC 3MGRA 3TU4A 3MGQA 1P3OC 5B0YD 1P34D 3KXBC 1KX5B 3LJAB 3REIC 3V9RA 3RELC 3B6FA 3REKD 5B24D 3W96A 3LELB 2L5AA 2F8NG 5B1MD 5GT0D 4LD9A 3AZGA 4XZQC 1P34C 1U35B 4H9PB 4KGCB 3B6GC 3REKC 3WA9C 3C1CA 5AV8A 4KUDB 1AOIB 4Z66C 2CV5B 3WTPC 4KHAB 5GT3D 5B32G 5AV6B 3AZJB 1M1AD 3KWQB 3C1BD 3WKJA 5B2IB 5CPID 5CPJD 4HGAC 3X1TA 4J8WA 1P3KB 3AZKC 3AZHA 3UTAB 5B31C 1M1AC 5F99B 1WWSA 1KU5A 2BYMB 5GSUD 5B33D 3C1BC 1P3GA 3AV2B 5CPIC 3LZ0B 3W98A 5CPJC 2AROA 5B1LD 3AZIB 4H9OA 5AVCA 3B0CT 4CSRA 4EO5B 4J8VB 1P3FB 1BH8B 3O62B 5AV5A 1F66B 1F1EA 5B1LC 1N1JB 1P3AB 4J8UD 3UTBA 2RVQD 3B6FC 3AN2B 1P3IB 3W96C 3AYWC 3REHA 3AZEC 3AZLD 3W99B 4J8XB 4YM6A 3AZGC 4NE6A 5BNVB 3LJAD 4G91B 5AV9B 2FJ7C 5AVBA 4X23A 4R8PA 3C1CC 4E44A 4YS3C 3MNNA 5JRGA 3LELD 3AZLC 1P3BA 5GXQA 5DNMB 5BNXA 1ID3C 3A6ND 4G92C 4QLCB 5B0ZB 4KGCD 3MVDA 3W97B 1P3MD 3WKJC 4KUDD 1AOID 1P3LB 4Z5TA 1EQZB 3AZHC 4WU8B 5CPKA 5CP6B 2PYOA 3A6NC 3AZJD 5AV6D 1A7WA 4WU9B 1P3GC 3MGSD 1P3MC 3UT9A 1P3PB 2F8NK 5B2ID 3KUYA 1KX3D 3LZ1C 1M18B 2AROC 1P3OA 3UTAD 4JJND 3KXBA 3REIA 3MGSC 2F8ND 1KX3C 3LZ0D 3RELB 1TZYD 4Z2MH 4JJNC 5E5AC 1P34A 3B0BA 3X1SD 4XZQB 3B6GA 1P3FD 3REKA 3WA9A 4AWLC 3O62D 3REHC 1S32D 1F66D 1TZYC 3NQJA 2NZDD 5JA4B 4Z66B 1P3AD 2HIOB 1M19B 3X1SC 4WNNA 1P3ID 3MNNC 3AZNB 3AZFD 4XUJB 3AFAC 5B32C 3AZKA 5BS7C 5GT3A 1M1AA 2BYKA 3C1BA 5B31B 4H9RB 3X1UD 2IO5C 3REJB 5CPIA 5CPJA 4ZBJC 5BO0A 4WZSB 5DNMD 5CPKC 2PYOC 5B33A 5B0ZD 5GSUA 3AZMC 3MGPD 3X1UC 3AV1B 1KX4B 5B2JB 1P3LD
chains in the Genus database with same CATH superfamily
2Y2QA 4ZUXC 5AY8B 5B1LA 1WWIA 3MGRB 5CP6D 3TU4B 3MGQB 4WU9D 3EPLA 3AYWA 3V9RB 3AZEA 3B6FB 3W96B 5B0YC 1TAFA 4LD9B 2FJ7A 4CAYA 5B24C 4YS3A 5B1MC 5GT0C 3AZLA 3C1CB 5AV8B 1ID3A 2XD1A 5KDMA 3EPKA 2YFVA 3X1VD 3WKJB 2VQRA 3B0DC 5DNND 3X1TB 4J8WB 5GT3C 2HIOD 5FUGA 3A6NA 3AZHB 2NQBD 4KGCA 2HUEC 5G49A 1P3MA 3LZ1A 3AZND 5DNNC 3W98B 2AROB 3EPHA 2NQBC 1H3OA 5AV6A 5B33C 5GSUC 4H9OB 5AVCB 5B40D 3MGSA 4CSRB 1KX3A 2YFWA 5AV5B 1JFIA 4JJNA 5E5AA 1HQ3D 3WAAD 5B40C 1ZLAD 3UTBB 1KX4D 2F8NA 1TZYA 3REHB 4J8UC 3TU4D 3MGQD 1KX5D 3X1SA 1HQ3C 4YM6B 2RVQC 3WAAC 1ZLAC 1R4VA 5AVBB 4H9SC 4X23B 1S32A 2NZDA 4R8PB 3AFAA 3MNNB 5JRGB 5B32A 5BS7A 1P3BB 1KX5C 5GXQB 3LJAC 1U35D 5BNXB 1ULYA 2XD5A 3MVDB 3LELC 3AZFA 5AV8D 2CV5D 4Z5TB 4ZBJB 5C3IB 1U35C 3KWQD 4KGCC 2PYOB 3AZMA 3X1UA 4KUDC 1AOIC 3UT9B 4ZUXA 3NQUA 1P3KD 3KUYB 3X1TD 4NFTA 4H9QA 5AV6C 5F99D 3AZJC 3KWQC 1P3OB 3KXBB 3MGPA 3A1IA 3AV2D 3REIB 5B2IC 2Y2KA 1B67A 2UWXA 5B0YA 3VH5A 3UTAC 3AZID 1BH9A 5F99C 4J8VD 1P34B 3AV2C 5B24A 3LZ0C 3B6GB 5B1MA 5GT0A 3REKB 4H9NA 3WA9B 5AV5D 3NQJB 3AZIC 4J8VC 4EO5C 3WTPB 1P3FC 3AN2D 3UTBD 3O62C 1F66C 3R45A 4WNNB 1S32C 3W99D 2NZDC 4J8XD 1P3AC 4HGAB 3AZKB 3H0LC 5AV9D 5GT3B 3AN2C 2BYKB 1P3IC 1M1AB 3C1BB 5AVBD 4X23D 3W99C 3X1VA 3AZFC 4UUZA 2F8NH 5CPIB 2W8SA 5JRGD 5DNNA 5CPJB 5BO0B 2NQBA 4G91C 4QLCD 5AV9C 3W97D 5B33B 5GSUB 1EQZD 4Z2MG 5DNMC 4WU8D 5BT1D 5B1LB 5CHLB 4QLCC 5B0ZC 3MGPC 1Q9CA 5B40A 1P3PD 3W97C 1P3LC 1EQZC 1M18D 3AYWB 3KUYD 3AZEB 4WU8C 5CP6C 4J8UA 4WU9C 1P3OD 1HQ3A 3AZGB 2RIQA 3WAAA 1P3PC 1ZLAA 1TAFB 2FJ7B 4H9SA 3RELD 4CAYB 3VH5W 1M18C 4YS3B 3AZLB 3VH6A 2JCHA 1KX5A 3LJAA 1HTAA 1ID3B 4XZQD 4G92B 3LELA 3B6GD 3WA9D 4NE5A 5KDMB 2YFVB 4Z66D 1M19D 2ZY3A 1U35A 4H9PA 3WTPD 3KSYA 5FUGB 3A6NB 2F2AC 4DRBA 5G49B 1P3GB 1AOIA 4KUDA 3X1VC 1P3MB 4XUJD 3LZ1B 2CV5A 4E45A 2HIOC 4KHAA 3AZJA 3AZKD 1M19C 3KWQA 5B31D 1H3OB 3P5JB 5B2IA 2Y2NA 3REJD 3MGSB 3AZNC 4XUJC 1P3KA 1KX3B 3UTAA 2YFWB 1JFIB 5F99A 4JJNB 2BYMA 5E5AB 3AV1D 3AV2A 5B2JD 3LZ0A 3REJC 4WV4B 2F8NB 5AY8D 4AWLB 3MGRD 1TZYB 3AZIA 4J8VA 1P3FA 3AV1C 1KX4C 3X1SB 1BH8A 4DQYB 5B2JC 3O62A 1F66A 3B6FD 2Y2OA 5AY8C 3AYWD 3W96D 1N1JA 3MGRC 3AZED 1S32B 1P3AA 2Y2IA 3TU4C 2NZDB 3AFAB 3MGQC 5B32B 4LD9D 3AZGD 3AN2A 1P3IA 2FJ7D 3W99A 2IO5B 3C1CD 3VH6W 4J8XA 4YS3D 3AZFB 5BNVA 5CPKB 3VH5T 4LD9C 5AV9A 1ID3D 2J8PA 2JE5A 3AZMB 3X1UB 3WKJD 5AV8C 5DNMA 2CV5C 4ZUXB 3NQUB 4J8WD 3AZHD 4QLCA 5B0ZA 3W97A 4H9QB 5B31G 1P3GD 3MGPB 1P3LA 1EQZA 1P3KC 3F6TA 3LZ1D 4WU8A 3W98D 5CP6A 3X1TC 2AROD 4J8WC 1BFMA 5B0YB 4WU9A 5AVCD 1BH9B 2ZY4A 2G5HC 1P3PA 3A1KA 3EG5B 2LY8A 5B24B 1M18A 3W98C 5B1MB 5GT0B 4H9NB 2Y2MA 5AVCC 5E5AD 2G5IC 3RELA 5AV5C 3R45B 3WTPE 3EPJA 3REHD 3B0DB 4YM6D 4XZQA 3UTBC 2HUEB 4R8PD 4J8XC 5JA4A 3MNND 3X1VB 4Z66A 1P3BD 4UUZB 3AFAD 2HIOA 5GXQD 5DNNB 5B32D 1M19A 4DRAA 4YM6C 3WTPA 2NQBB 5AVBC 4X23C 3MVDD 1W2EA 2JSSA 4R8PC 3AZNA 4XUJA 5JRGC 1B6WA 4Z5TD 1P3BC 3B0CW 5GXQC 4M6BA 5CPKD 2PYOD 3VH6T 5B31A 4H9RA 3MVDC 3REJA 3AZMD 5B40B 3UT9D 5BT1C 4Z5TC 2CWEA 4UPKA 4NE3A 4WJ3C 4ZUXD 5C3IC 4J8UB 3KXBD 3AV1A 1KX4A 3REID 1HQ3B 5B2JA 3WAAB 1Z2CB 1ZLAB 3UT9C 5AY8A 3KUYC 3MGRA 2FFFB 3TU4A 3MGQA 1P3OC 5B0YD 1P34D 3KXBC 1KX5B 3LJAB 3REIC 3V9RA 3RELC 3B6FA 3REKD 3AL0C 5B24D 3W96A 3LELB 2L5AA 2F8NG 5B1MD 5GT0D 4LD9A 3AZGA 4XZQC 1P34C 1U35B 2Y2GA 4H9PB 4KGCB 3B6GC 3REKC 3WA9C 3H0RC 3C1CA 5AV8A 4KUDB 1AOIB 4Z66C 2CV5B 3WTPC 2ZY5A 4KHAB 5GT3D 5B32G 5AV6B 3AZJB 1M1AD 3KWQB 3FDDA 3C1BD 3WKJA 5B2IB 5CPID 5CPJD 4HGAC 3X1TA 4J8WA 1P3KB 3AZKC 3AZHA 3UTAB 5B31C 1M1AC 5F99B 1WWSA 3H0MC 1KU5A 2BYMB 5GSUD 5B33D 3C1BC 1P3GA 3AV2B 5CPIC 3LZ0B 3W98A 5CPJC 2ZY2A 2AROA 5B1LD 3AZIB 2Y2JA 4H9OA 5AVCA 3B0CT 4CSRA 4EO5B 4J8VB 1P3FB 1BH8B 3O62B 5AV5A 1F66B 2DQNC 1F1EA 5B1LC 1N1JB 1P3AB 4J8UD 3UTBA 2RVQD 3B6FC 3AN2B 1P3IB 3W96C 3AYWC 3REHA 3AZEC 3AZLD 3W99B 4J8XB 4YM6A 3AZGC 4NE6A 5BNVB 3LJAD 4G91B 5AV9B 2FJ7C 5AVBA 4X23A 4R8PA 3C1CC 4E44A 4YS3C 3MNNA 5JRGA 3LELD 3AZLC 1P3BA 5GXQA 3IP4C 5DNMB 5BNXA 1ID3C 2Y2LA 3A6ND 2ZM5A 4G92C 4QLCB 5B0ZB 4KGCD 3MVDA 2DF4C 3W97B 1P3MD 3WKJC 4KUDD 1AOID 1P3LB 4Z5TA 2Y2PA 1EQZB 3AZHC 4WU8B 5CPKA 5CP6B 2PYOA 3A6NC 3AZJD 5AV6D 1A7WA 4WU9B 3KFUG 1P3GC 3MGSD 1T3UA 3UT9A 1P3MC 1P3PB 2F8NK 5B2ID 3KUYA 1KX3D 3LZ1C 1M18B 2AROC 1P3OA 3UTAD 4JJND 3KXBA 3REIA 3MGSC 2F8ND 1KX3C 3LZ0D 3RELB 1TZYD 4Z2MH 4JJNC 5E5AC 1P34A 3B0BA 2BG1A 3X1SD 4XZQB 3B6GA 1P3FD 3REKA 3WA9A 4AWLC 3O62D 3REHC 1S32D 1F66D 1TZYC 3NQJA 2NZDD 5JA4B 4Z66B 1P3AD 2Y2HA 2HIOB 1M19B 3X1SC 4WNNA 1P3ID 3MNNC 3AZNB 3AZFD 4XUJB 3AFAC 1PZRA 5B32C 3AZKA 5BS7C 5GT3A 1M1AA 2BYKA 3C1BA 5B31B 4H9RB 3X1UD 2IO5C 3REJB 5CPIA 5CPJA 4ZBJC 5BO0A 4WZSB 5DNMD 5CPKC 2PYOC 5B33A 5B0ZD 5GSUA 3AZMC 3MGPD 3X1UC 3AV1B 1KX4B 5B2JB 1P3LD
chains in the Genus database with same CATH topology
2Y2QA 4ZUXC 5AY8B 5B1LA 1WWIA 3MGRB 5CP6D 3TU4B 3MGQB 4WU9D 3EPLA 3AYWA 3V9RB 3AZEA 3B6FB 3W96B 5B0YC 1TAFA 4LD9B 2FJ7A 4CAYA 5B24C 4YS3A 5B1MC 5GT0C 3AZLA 3C1CB 5AV8B 1ID3A 2XD1A 5KDMA 3EPKA 2YFVA 3X1VD 3WKJB 2VQRA 3B0DC 5DNND 3X1TB 4J8WB 5GT3C 2HIOD 5FUGA 3A6NA 3AZHB 2NQBD 4KGCA 2HUEC 5G49A 1P3MA 3LZ1A 3AZND 5DNNC 3W98B 2AROB 3EPHA 2NQBC 1H3OA 5AV6A 5B33C 5GSUC 4H9OB 5AVCB 5B40D 3MGSA 4CSRB 1KX3A 2YFWA 5AV5B 1JFIA 4JJNA 5E5AA 1HQ3D 3WAAD 5B40C 1ZLAD 3UTBB 1KX4D 2F8NA 1TZYA 3REHB 4J8UC 3TU4D 3MGQD 1KX5D 3X1SA 1HQ3C 4YM6B 2RVQC 3WAAC 1ZLAC 1R4VA 5AVBB 4H9SC 4X23B 1S32A 2NZDA 4R8PB 3AFAA 3MNNB 5JRGB 5B32A 5BS7A 1P3BB 1KX5C 5GXQB 3LJAC 1U35D 5BNXB 1ULYA 2XD5A 3MVDB 3LELC 3AZFA 5AV8D 2CV5D 4Z5TB 4ZBJB 5C3IB 1U35C 3KWQD 4KGCC 2PYOB 3AZMA 3X1UA 4KUDC 1AOIC 3UT9B 4ZUXA 3NQUA 1P3KD 3KUYB 3X1TD 4NFTA 4H9QA 5AV6C 5F99D 3AZJC 3KWQC 1P3OB 3KXBB 3MGPA 3A1IA 3AV2D 3REIB 5B2IC 2Y2KA 1B67A 2UWXA 5B0YA 3VH5A 3UTAC 3AZID 1BH9A 5F99C 4J8VD 1P34B 3AV2C 5B24A 3LZ0C 3B6GB 5B1MA 5GT0A 3REKB 4H9NA 3WA9B 5AV5D 3NQJB 3AZIC 4J8VC 4EO5C 3WTPB 1P3FC 3AN2D 3UTBD 3O62C 1F66C 3R45A 4WNNB 1S32C 3W99D 2NZDC 4J8XD 1P3AC 4HGAB 3AZKB 3H0LC 5AV9D 5GT3B 3AN2C 2BYKB 1P3IC 1M1AB 3C1BB 5AVBD 4X23D 3W99C 3X1VA 3AZFC 4UUZA 2F8NH 5CPIB 2W8SA 5JRGD 5DNNA 5CPJB 5BO0B 2NQBA 4G91C 4QLCD 5AV9C 3W97D 5B33B 5GSUB 1EQZD 4Z2MG 5DNMC 4WU8D 5BT1D 5B1LB 5CHLB 4QLCC 5B0ZC 3MGPC 1Q9CA 5B40A 1P3PD 3W97C 1P3LC 1EQZC 1M18D 3AYWB 3KUYD 3AZEB 4WU8C 5CP6C 4J8UA 4WU9C 1P3OD 1HQ3A 3AZGB 2RIQA 3WAAA 1P3PC 1ZLAA 1TAFB 2FJ7B 4H9SA 3RELD 4CAYB 3VH5W 1M18C 4YS3B 3AZLB 3VH6A 2JCHA 1KX5A 3LJAA 1HTAA 1ID3B 4XZQD 4G92B 3LELA 3B6GD 3WA9D 4NE5A 5KDMB 2YFVB 4Z66D 1M19D 2ZY3A 1U35A 4H9PA 3WTPD 3KSYA 5FUGB 3A6NB 2F2AC 4DRBA 5G49B 1P3GB 1AOIA 4KUDA 3X1VC 1P3MB 4XUJD 3LZ1B 2CV5A 4E45A 2HIOC 4KHAA 3AZJA 3AZKD 1M19C 3KWQA 5B31D 1H3OB 3P5JB 5B2IA 2Y2NA 3REJD 3MGSB 3AZNC 4XUJC 1P3KA 1KX3B 3UTAA 2YFWB 1JFIB 5F99A 4JJNB 2BYMA 5E5AB 3AV1D 3AV2A 5B2JD 3LZ0A 3REJC 4WV4B 2F8NB 5AY8D 4AWLB 3MGRD 1TZYB 3AZIA 4J8VA 1P3FA 3AV1C 1KX4C 3X1SB 1BH8A 4DQYB 5B2JC 3O62A 1F66A 3B6FD 2Y2OA 5AY8C 3AYWD 3W96D 1N1JA 3MGRC 3AZED 1S32B 1P3AA 2Y2IA 3TU4C 2NZDB 3AFAB 3MGQC 5B32B 4LD9D 3AZGD 3AN2A 1P3IA 2FJ7D 3W99A 2IO5B 3C1CD 3VH6W 4J8XA 4YS3D 3AZFB 5BNVA 5CPKB 3VH5T 4LD9C 5AV9A 1ID3D 2J8PA 2JE5A 3AZMB 3X1UB 3WKJD 5AV8C 5DNMA 2CV5C 4ZUXB 3NQUB 4J8WD 3AZHD 4QLCA 5B0ZA 3W97A 4H9QB 5B31G 1P3GD 3MGPB 1P3LA 1EQZA 1P3KC 3F6TA 3LZ1D 4WU8A 3W98D 5CP6A 3X1TC 2AROD 4J8WC 1BFMA 5B0YB 4WU9A 5AVCD 1BH9B 2ZY4A 2G5HC 1P3PA 3A1KA 3EG5B 2LY8A 5B24B 1M18A 3W98C 5B1MB 5GT0B 4H9NB 2Y2MA 5AVCC 5E5AD 2G5IC 3RELA 5AV5C 3R45B 3WTPE 3EPJA 3REHD 3B0DB 4YM6D 4XZQA 3UTBC 2HUEB 4R8PD 4J8XC 5JA4A 3MNND 3X1VB 4Z66A 1P3BD 4UUZB 3AFAD 2HIOA 5GXQD 5DNNB 5B32D 1M19A 4DRAA 4YM6C 3WTPA 2NQBB 5AVBC 4X23C 3MVDD 1W2EA 2JSSA 4R8PC 3AZNA 4XUJA 5JRGC 1B6WA 4Z5TD 1P3BC 3B0CW 5GXQC 4M6BA 5CPKD 2PYOD 3VH6T 5B31A 4H9RA 3MVDC 3REJA 3AZMD 5B40B 3UT9D 5BT1C 4Z5TC 2CWEA 4UPKA 4NE3A 4WJ3C 4ZUXD 5C3IC 4J8UB 3KXBD 3AV1A 1KX4A 3REID 1HQ3B 5B2JA 3WAAB 1Z2CB 1ZLAB 3UT9C 5AY8A 3KUYC 3MGRA 2FFFB 3TU4A 3MGQA 1P3OC 5B0YD 1P34D 3KXBC 1KX5B 3LJAB 3REIC 3V9RA 3RELC 3B6FA 3REKD 3AL0C 5B24D 3W96A 3LELB 2L5AA 2F8NG 5B1MD 5GT0D 4LD9A 3AZGA 4XZQC 1P34C 1U35B 2Y2GA 4H9PB 4KGCB 3B6GC 3REKC 3WA9C 3H0RC 3C1CA 5AV8A 4KUDB 1AOIB 4Z66C 2CV5B 3WTPC 2ZY5A 4KHAB 5GT3D 5B32G 5AV6B 3AZJB 1M1AD 3KWQB 3FDDA 3C1BD 3WKJA 5B2IB 5CPID 5CPJD 4HGAC 3X1TA 4J8WA 1P3KB 3AZKC 3AZHA 3UTAB 5B31C 1M1AC 5F99B 1WWSA 3H0MC 1KU5A 2BYMB 5GSUD 5B33D 3C1BC 1P3GA 3AV2B 5CPIC 3LZ0B 3W98A 5CPJC 2ZY2A 2AROA 5B1LD 3AZIB 2Y2JA 4H9OA 5AVCA 3B0CT 4CSRA 4EO5B 4J8VB 1P3FB 1BH8B 3O62B 5AV5A 1F66B 2DQNC 1F1EA 5B1LC 1N1JB 1P3AB 4J8UD 3UTBA 2RVQD 3B6FC 3AN2B 1P3IB 3W96C 3AYWC 3REHA 3AZEC 3AZLD 3W99B 4J8XB 4YM6A 3AZGC 4NE6A 5BNVB 3LJAD 4G91B 5AV9B 2FJ7C 5AVBA 4X23A 4R8PA 3C1CC 4E44A 4YS3C 3MNNA 5JRGA 3LELD 3AZLC 1P3BA 5GXQA 3IP4C 5DNMB 5BNXA 1ID3C 2Y2LA 3A6ND 2ZM5A 4G92C 4QLCB 5B0ZB 4KGCD 3MVDA 2DF4C 3W97B 1P3MD 3WKJC 4KUDD 1AOID 1P3LB 4Z5TA 2Y2PA 1EQZB 3AZHC 4WU8B 5CPKA 5CP6B 2PYOA 3A6NC 3AZJD 5AV6D 1A7WA 4WU9B 3KFUG 1P3GC 3MGSD 1T3UA 3UT9A 1P3MC 1P3PB 2F8NK 5B2ID 3KUYA 1KX3D 3LZ1C 1M18B 2AROC 1P3OA 3UTAD 4JJND 3KXBA 3REIA 3MGSC 2F8ND 1KX3C 3LZ0D 3RELB 1TZYD 4Z2MH 4JJNC 5E5AC 1P34A 3B0BA 2BG1A 3X1SD 4XZQB 3B6GA 1P3FD 3REKA 3WA9A 4AWLC 3O62D 3REHC 1S32D 1F66D 1TZYC 3NQJA 2NZDD 5JA4B 4Z66B 1P3AD 2Y2HA 2HIOB 1M19B 3X1SC 4WNNA 1P3ID 3MNNC 3AZNB 3AZFD 4XUJB 3AFAC 1PZRA 5B32C 3AZKA 5BS7C 5GT3A 1M1AA 2BYKA 3C1BA 5B31B 4H9RB 3X1UD 2IO5C 3REJB 5CPIA 5CPJA 4ZBJC 5BO0A 4WZSB 5DNMD 5CPKC 2PYOC 5B33A 5B0ZD 5GSUA 3AZMC 3MGPD 3X1UC 3AV1B 1KX4B 5B2JB 1P3LD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUX C;  5AY8 B;  5B1L A;  1WWI A;  3MGR B;  5CP6 D;  3TU4 B;  3MGQ B;  4WU9 D;  3AYW A;  3V9R B;  3AZE A;  3B6F B;  3W96 B;  5B0Y C;  1TAF A;  4LD9 B;  2FJ7 A;  4CAY A;  5B24 C;  4YS3 A;  5B1M C;  5GT0 C;  3AZL A;  3C1C B;  5AV8 B;  1ID3 A;  5KDM A;  2YFV A;  3X1V D;  3WKJ B;  3B0D C;  5DNN D;  3X1T B;  4J8W B;  5GT3 C;  2HIO D;  5FUG A;  3A6N A;  3AZH B;  2NQB D;  4KGC A;  2HUE C;  5G49 A;  1P3M A;  3LZ1 A;  3AZN D;  5DNN C;  3W98 B;  2ARO B;  2NQB C;  1H3O A;  5AV6 A;  5B33 C;  5GSU C;  4H9O B;  5AVC B;  5B40 D;  3MGS A;  4CSR B;  1KX3 A;  2YFW A;  5AV5 B;  1JFI A;  4JJN A;  5E5A A;  1HQ3 D;  3WAA D;  5B40 C;  1ZLA D;  3UTB B;  1KX4 D;  2F8N A;  1TZY A;  3REH B;  4J8U C;  3TU4 D;  3MGQ D;  1KX5 D;  3X1S A;  1HQ3 C;  4YM6 B;  2RVQ C;  3WAA C;  1ZLA C;  1R4V A;  5AVB B;  4H9S C;  4X23 B;  1S32 A;  2NZD A;  4R8P B;  3AFA A;  3MNN B;  5JRG B;  5B32 A;  5BS7 A;  1P3B B;  1KX5 C;  5GXQ B;  3LJA C;  1U35 D;  5BNX B;  1ULY A;  3MVD B;  3LEL C;  3AZF A;  5AV8 D;  2CV5 D;  4Z5T B;  4ZBJ B;  5C3I B;  1U35 C;  3KWQ D;  4KGC C;  2PYO B;  3AZM A;  3X1U A;  4KUD C;  1AOI C;  3UT9 B;  4ZUX A;  3NQU A;  1P3K D;  3KUY B;  3X1T D;  4NFT A;  4H9Q A;  5AV6 C;  5F99 D;  3AZJ C;  3KWQ C;  1P3O B;  3KXB B;  3MGP A;  3AV2 D;  3REI B;  5B2I C;  1B67 A;  5B0Y A;  3VH5 A;  3UTA C;  3AZI D;  1BH9 A;  5F99 C;  4J8V D;  1P34 B;  3AV2 C;  5B24 A;  3LZ0 C;  3B6G B;  5B1M A;  5GT0 A;  3REK B;  4H9N A;  3WA9 B;  5AV5 D;  3NQJ B;  3AZI C;  4J8V C;  4EO5 C;  3WTP B;  1P3F C;  3AN2 D;  3UTB D;  3O62 C;  1F66 C;  3R45 A;  4WNN B;  1S32 C;  3W99 D;  2NZD C;  4J8X D;  1P3A C;  4HGA B;  3AZK B;  5AV9 D;  5GT3 B;  3AN2 C;  2BYK B;  1P3I C;  1M1A B;  3C1B B;  5AVB D;  4X23 D;  3W99 C;  3X1V A;  3AZF C;  4UUZ A;  2F8N H;  5CPI B;  5JRG D;  5DNN A;  5CPJ B;  5BO0 B;  2NQB A;  4G91 C;  4QLC D;  5AV9 C;  3W97 D;  5B33 B;  5GSU B;  1EQZ D;  4Z2M G;  5DNM C;  4WU8 D;  5BT1 D;  5B1L B;  5CHL B;  4QLC C;  5B0Z C;  3MGP C;  1Q9C A;  5B40 A;  1P3P D;  3W97 C;  1P3L C;  1EQZ C;  1M18 D;  3AYW B;  3KUY D;  3AZE B;  4WU8 C;  5CP6 C;  4J8U A;  4WU9 C;  1P3O D;  1HQ3 A;  3AZG B;  3WAA A;  1P3P C;  1ZLA A;  1TAF B;  2FJ7 B;  4H9S A;  3REL D;  4CAY B;  3VH5 W;  1M18 C;  4YS3 B;  3AZL B;  3VH6 A;  1KX5 A;  3LJA A;  1HTA A;  1ID3 B;  4XZQ D;  4G92 B;  3LEL A;  3B6G D;  3WA9 D;  4NE5 A;  5KDM B;  2YFV B;  4Z66 D;  1M19 D;  1U35 A;  4H9P A;  3WTP D;  3KSY A;  5FUG B;  3A6N B;  4DRB A;  4KUD A;  5G49 B;  1P3G B;  1AOI A;  3X1V C;  1P3M B;  4XUJ D;  3LZ1 B;  2CV5 A;  4E45 A;  2HIO C;  4KHA A;  3AZJ A;  3AZK D;  1M19 C;  3KWQ A;  5B31 D;  1H3O B;  5B2I A;  3REJ D;  3MGS B;  3AZN C;  4XUJ C;  1P3K A;  1KX3 B;  3UTA A;  2YFW B;  1JFI B;  5F99 A;  4JJN B;  2BYM A;  5E5A B;  3AV1 D;  3AV2 A;  5B2J D;  3LZ0 A;  3REJ C;  4WV4 B;  2F8N B;  5AY8 D;  4AWL B;  3MGR D;  1TZY B;  3AZI A;  4J8V A;  1P3F A;  3AV1 C;  1KX4 C;  3X1S B;  1BH8 A;  5B2J C;  3O62 A;  1F66 A;  3B6F D;  5AY8 C;  3AYW D;  3W96 D;  1N1J A;  3MGR C;  3AZE D;  1S32 B;  1P3A A;  3TU4 C;  2NZD B;  3AFA B;  3MGQ C;  5B32 B;  4LD9 D;  3AZG D;  3AN2 A;  1P3I A;  2FJ7 D;  3W99 A;  2IO5 B;  3C1C D;  3VH6 W;  4J8X A;  4YS3 D;  3AZF B;  5BNV A;  5CPK B;  3VH5 T;  4LD9 C;  5AV9 A;  1ID3 D;  3AZM B;  3X1U B;  3WKJ D;  5AV8 C;  5DNM A;  2CV5 C;  4ZUX B;  3NQU B;  4J8W D;  3AZH D;  4QLC A;  5B0Z A;  3W97 A;  4H9Q B;  5B31 G;  1P3G D;  3MGP B;  1P3L A;  1EQZ A;  1P3K C;  3LZ1 D;  4WU8 A;  3W98 D;  5CP6 A;  3X1T C;  2ARO D;  4J8W C;  1BFM A;  5B0Y B;  4WU9 A;  5AVC D;  1BH9 B;  1P3P A;  2LY8 A;  5B24 B;  1M18 A;  3W98 C;  5B1M B;  5GT0 B;  4H9N B;  5AVC C;  5E5A D;  3REL A;  5AV5 C;  3R45 B;  3WTP E;  3REH D;  3B0D B;  4YM6 D;  4XZQ A;  3UTB C;  2HUE B;  4R8P D;  4J8X C;  5JA4 A;  3MNN D;  3X1V B;  4Z66 A;  1P3B D;  4UUZ B;  3AFA D;  2HIO A;  5GXQ D;  5DNN B;  5B32 D;  1M19 A;  4DRA A;  4YM6 C;  3WTP A;  2NQB B;  5AVB C;  4X23 C;  3MVD D;  2JSS A;  4R8P C;  3AZN A;  4XUJ A;  5JRG C;  1B6W A;  4Z5T D;  1P3B C;  3B0C W;  5GXQ C;  4M6B A;  5CPK D;  2PYO D;  3VH6 T;  5B31 A;  4H9R A;  3MVD C;  3REJ A;  3AZM D;  5B40 B;  3UT9 D;  5BT1 C;  4Z5T C;  2CWE A;  4NE3 A;  4ZUX D;  5C3I C;  4J8U B;  3KXB D;  3AV1 A;  1KX4 A;  3REI D;  1HQ3 B;  5B2J A;  3WAA B;  1ZLA B;  3UT9 C;  5AY8 A;  3KUY C;  3MGR A;  3TU4 A;  3MGQ A;  1P3O C;  5B0Y D;  1P34 D;  3KXB C;  1KX5 B;  3LJA B;  3REI C;  3V9R A;  3REL C;  3B6F A;  3REK D;  5B24 D;  3W96 A;  3LEL B;  2L5A A;  2F8N G;  5B1M D;  5GT0 D;  4LD9 A;  3AZG A;  4XZQ C;  1P34 C;  1U35 B;  4H9P B;  4KGC B;  3B6G C;  3REK C;  3WA9 C;  3C1C A;  5AV8 A;  4KUD B;  1AOI B;  4Z66 C;  2CV5 B;  3WTP C;  4KHA B;  5GT3 D;  5B32 G;  5AV6 B;  3AZJ B;  1M1A D;  3KWQ B;  3C1B D;  3WKJ A;  5B2I B;  5CPI D;  5CPJ D;  4HGA C;  3X1T A;  4J8W A;  1P3K B;  3AZK C;  3AZH A;  3UTA B;  5B31 C;  1M1A C;  5F99 B;  1WWS A;  1KU5 A;  2BYM B;  5GSU D;  5B33 D;  3C1B C;  1P3G A;  3AV2 B;  5CPI C;  3LZ0 B;  3W98 A;  5CPJ C;  2ARO A;  5B1L D;  3AZI B;  4H9O A;  5AVC A;  3B0C T;  4CSR A;  4EO5 B;  4J8V B;  1P3F B;  1BH8 B;  3O62 B;  5AV5 A;  1F66 B;  1F1E A;  5B1L C;  1N1J B;  1P3A B;  4J8U D;  3UTB A;  2RVQ D;  3B6F C;  3AN2 B;  1P3I B;  3W96 C;  3AYW C;  3REH A;  3AZE C;  3AZL D;  3W99 B;  4J8X B;  4YM6 A;  3AZG C;  4NE6 A;  5BNV B;  3LJA D;  4G91 B;  5AV9 B;  2FJ7 C;  5AVB A;  4X23 A;  4R8P A;  3C1C C;  4E44 A;  4YS3 C;  3MNN A;  5JRG A;  3LEL D;  3AZL C;  1P3B A;  5GXQ A;  5DNM B;  5BNX A;  1ID3 C;  3A6N D;  4G92 C;  4QLC B;  5B0Z B;  4KGC D;  3MVD A;  3W97 B;  1P3M D;  3WKJ C;  4KUD D;  1AOI D;  1P3L B;  4Z5T A;  1EQZ B;  3AZH C;  4WU8 B;  5CPK A;  5CP6 B;  2PYO A;  3A6N C;  3AZJ D;  5AV6 D;  1A7W A;  4WU9 B;  1P3G C;  3MGS D;  1P3M C;  3UT9 A;  1P3P B;  2F8N K;  5B2I D;  3KUY A;  1KX3 D;  3LZ1 C;  1M18 B;  2ARO C;  1P3O A;  3UTA D;  4JJN D;  3KXB A;  3REI A;  3MGS C;  2F8N D;  1KX3 C;  3LZ0 D;  3REL B;  1TZY D;  4Z2M H;  4JJN C;  5E5A C;  1P34 A;  3B0B A;  3X1S D;  4XZQ B;  3B6G A;  1P3F D;  3REK A;  3WA9 A;  4AWL C;  3O62 D;  3REH C;  1S32 D;  1F66 D;  1TZY C;  3NQJ A;  2NZD D;  5JA4 B;  4Z66 B;  1P3A D;  2HIO B;  1M19 B;  3X1S C;  4WNN A;  1P3I D;  3MNN C;  3AZN B;  3AZF D;  4XUJ B;  3AFA C;  5B32 C;  3AZK A;  5BS7 C;  5GT3 A;  1M1A A;  2BYK A;  3C1B A;  5B31 B;  4H9R B;  3X1U D;  2IO5 C;  3REJ B;  5CPI A;  5CPJ A;  4ZBJ C;  5BO0 A;  4WZS B;  5DNM D;  5CPK C;  2PYO C;  5B33 A;  5B0Z D;  5GSU A;  3AZM C;  3MGP D;  3X1U C;  3AV1 B;  1KX4 B;  5B2J B;  1P3L D; 
#chains in the Genus database with same CATH topology
 2Y2Q A;  4ZUX C;  5AY8 B;  5B1L A;  1WWI A;  3MGR B;  5CP6 D;  3TU4 B;  3MGQ B;  4WU9 D;  3EPL A;  3AYW A;  3V9R B;  3AZE A;  3B6F B;  3W96 B;  5B0Y C;  1TAF A;  4LD9 B;  2FJ7 A;  4CAY A;  5B24 C;  4YS3 A;  5B1M C;  5GT0 C;  3AZL A;  3C1C B;  5AV8 B;  1ID3 A;  2XD1 A;  5KDM A;  3EPK A;  2YFV A;  3X1V D;  3WKJ B;  2VQR A;  3B0D C;  5DNN D;  3X1T B;  4J8W B;  5GT3 C;  2HIO D;  5FUG A;  3A6N A;  3AZH B;  2NQB D;  4KGC A;  2HUE C;  5G49 A;  1P3M A;  3LZ1 A;  3AZN D;  5DNN C;  3W98 B;  2ARO B;  3EPH A;  2NQB C;  1H3O A;  5AV6 A;  5B33 C;  5GSU C;  4H9O B;  5AVC B;  5B40 D;  3MGS A;  4CSR B;  1KX3 A;  2YFW A;  5AV5 B;  1JFI A;  4JJN A;  5E5A A;  1HQ3 D;  3WAA D;  5B40 C;  1ZLA D;  3UTB B;  1KX4 D;  2F8N A;  1TZY A;  3REH B;  4J8U C;  3TU4 D;  3MGQ D;  1KX5 D;  3X1S A;  1HQ3 C;  4YM6 B;  2RVQ C;  3WAA C;  1ZLA C;  1R4V A;  5AVB B;  4H9S C;  4X23 B;  1S32 A;  2NZD A;  4R8P B;  3AFA A;  3MNN B;  5JRG B;  5B32 A;  5BS7 A;  1P3B B;  1KX5 C;  5GXQ B;  3LJA C;  1U35 D;  5BNX B;  1ULY A;  2XD5 A;  3MVD B;  3LEL C;  3AZF A;  5AV8 D;  2CV5 D;  4Z5T B;  4ZBJ B;  5C3I B;  1U35 C;  3KWQ D;  4KGC C;  2PYO B;  3AZM A;  3X1U A;  4KUD C;  1AOI C;  3UT9 B;  4ZUX A;  3NQU A;  1P3K D;  3KUY B;  3X1T D;  4NFT A;  4H9Q A;  5AV6 C;  5F99 D;  3AZJ C;  3KWQ C;  1P3O B;  3KXB B;  3MGP A;  3A1I A;  3AV2 D;  3REI B;  5B2I C;  2Y2K A;  1B67 A;  2UWX A;  5B0Y A;  3VH5 A;  3UTA C;  3AZI D;  1BH9 A;  5F99 C;  4J8V D;  1P34 B;  3AV2 C;  5B24 A;  3LZ0 C;  3B6G B;  5B1M A;  5GT0 A;  3REK B;  4H9N A;  3WA9 B;  5AV5 D;  3NQJ B;  3AZI C;  4J8V C;  4EO5 C;  3WTP B;  1P3F C;  3AN2 D;  3UTB D;  3O62 C;  1F66 C;  3R45 A;  4WNN B;  1S32 C;  3W99 D;  2NZD C;  4J8X D;  1P3A C;  4HGA B;  3AZK B;  3H0L C;  5AV9 D;  5GT3 B;  3AN2 C;  2BYK B;  1P3I C;  1M1A B;  3C1B B;  5AVB D;  4X23 D;  3W99 C;  3X1V A;  3AZF C;  4UUZ A;  2F8N H;  5CPI B;  2W8S A;  5JRG D;  5DNN A;  5CPJ B;  5BO0 B;  2NQB A;  4G91 C;  4QLC D;  5AV9 C;  3W97 D;  5B33 B;  5GSU B;  1EQZ D;  4Z2M G;  5DNM C;  4WU8 D;  5BT1 D;  5B1L B;  5CHL B;  4QLC C;  5B0Z C;  3MGP C;  1Q9C A;  5B40 A;  1P3P D;  3W97 C;  1P3L C;  1EQZ C;  1M18 D;  3AYW B;  3KUY D;  3AZE B;  4WU8 C;  5CP6 C;  4J8U A;  4WU9 C;  1P3O D;  1HQ3 A;  3AZG B;  2RIQ A;  3WAA A;  1P3P C;  1ZLA A;  1TAF B;  2FJ7 B;  4H9S A;  3REL D;  4CAY B;  3VH5 W;  1M18 C;  4YS3 B;  3AZL B;  3VH6 A;  2JCH A;  1KX5 A;  3LJA A;  1HTA A;  1ID3 B;  4XZQ D;  4G92 B;  3LEL A;  3B6G D;  3WA9 D;  4NE5 A;  5KDM B;  2YFV B;  4Z66 D;  1M19 D;  2ZY3 A;  1U35 A;  4H9P A;  3WTP D;  3KSY A;  5FUG B;  3A6N B;  2F2A C;  4DRB A;  5G49 B;  1P3G B;  1AOI A;  4KUD A;  3X1V C;  1P3M B;  4XUJ D;  3LZ1 B;  2CV5 A;  4E45 A;  2HIO C;  4KHA A;  3AZJ A;  3AZK D;  1M19 C;  3KWQ A;  5B31 D;  1H3O B;  3P5J B;  5B2I A;  2Y2N A;  3REJ D;  3MGS B;  3AZN C;  4XUJ C;  1P3K A;  1KX3 B;  3UTA A;  2YFW B;  1JFI B;  5F99 A;  4JJN B;  2BYM A;  5E5A B;  3AV1 D;  3AV2 A;  5B2J D;  3LZ0 A;  3REJ C;  4WV4 B;  2F8N B;  5AY8 D;  4AWL B;  3MGR D;  1TZY B;  3AZI A;  4J8V A;  1P3F A;  3AV1 C;  1KX4 C;  3X1S B;  1BH8 A;  4DQY B;  5B2J C;  3O62 A;  1F66 A;  3B6F D;  2Y2O A;  5AY8 C;  3AYW D;  3W96 D;  1N1J A;  3MGR C;  3AZE D;  1S32 B;  1P3A A;  2Y2I A;  3TU4 C;  2NZD B;  3AFA B;  3MGQ C;  5B32 B;  4LD9 D;  3AZG D;  3AN2 A;  1P3I A;  2FJ7 D;  3W99 A;  2IO5 B;  3C1C D;  3VH6 W;  4J8X A;  4YS3 D;  3AZF B;  5BNV A;  5CPK B;  3VH5 T;  4LD9 C;  5AV9 A;  1ID3 D;  2J8P A;  2JE5 A;  3AZM B;  3X1U B;  3WKJ D;  5AV8 C;  5DNM A;  2CV5 C;  4ZUX B;  3NQU B;  4J8W D;  3AZH D;  4QLC A;  5B0Z A;  3W97 A;  4H9Q B;  5B31 G;  1P3G D;  3MGP B;  1P3L A;  1EQZ A;  1P3K C;  3F6T A;  3LZ1 D;  4WU8 A;  3W98 D;  5CP6 A;  3X1T C;  2ARO D;  4J8W C;  1BFM A;  5B0Y B;  4WU9 A;  5AVC D;  1BH9 B;  2ZY4 A;  2G5H C;  1P3P A;  3A1K A;  3EG5 B;  2LY8 A;  5B24 B;  1M18 A;  3W98 C;  5B1M B;  5GT0 B;  4H9N B;  2Y2M A;  5AVC C;  5E5A D;  2G5I C;  3REL A;  5AV5 C;  3R45 B;  3WTP E;  3EPJ A;  3REH D;  3B0D B;  4YM6 D;  4XZQ A;  3UTB C;  2HUE B;  4R8P D;  4J8X C;  5JA4 A;  3MNN D;  3X1V B;  4Z66 A;  1P3B D;  4UUZ B;  3AFA D;  2HIO A;  5GXQ D;  5DNN B;  5B32 D;  1M19 A;  4DRA A;  4YM6 C;  3WTP A;  2NQB B;  5AVB C;  4X23 C;  3MVD D;  1W2E A;  2JSS A;  4R8P C;  3AZN A;  4XUJ A;  5JRG C;  1B6W A;  4Z5T D;  1P3B C;  3B0C W;  5GXQ C;  4M6B A;  5CPK D;  2PYO D;  3VH6 T;  5B31 A;  4H9R A;  3MVD C;  3REJ A;  3AZM D;  5B40 B;  3UT9 D;  5BT1 C;  4Z5T C;  2CWE A;  4UPK A;  4NE3 A;  4WJ3 C;  4ZUX D;  5C3I C;  4J8U B;  3KXB D;  3AV1 A;  1KX4 A;  3REI D;  1HQ3 B;  5B2J A;  3WAA B;  1Z2C B;  1ZLA B;  3UT9 C;  5AY8 A;  3KUY C;  3MGR A;  2FFF B;  3TU4 A;  3MGQ A;  1P3O C;  5B0Y D;  1P34 D;  3KXB C;  1KX5 B;  3LJA B;  3REI C;  3V9R A;  3REL C;  3B6F A;  3REK D;  3AL0 C;  5B24 D;  3W96 A;  3LEL B;  2L5A A;  2F8N G;  5B1M D;  5GT0 D;  4LD9 A;  3AZG A;  4XZQ C;  1P34 C;  1U35 B;  2Y2G A;  4H9P B;  4KGC B;  3B6G C;  3REK C;  3WA9 C;  3H0R C;  3C1C A;  5AV8 A;  4KUD B;  1AOI B;  4Z66 C;  2CV5 B;  3WTP C;  2ZY5 A;  4KHA B;  5GT3 D;  5B32 G;  5AV6 B;  3AZJ B;  1M1A D;  3KWQ B;  3FDD A;  3C1B D;  3WKJ A;  5B2I B;  5CPI D;  5CPJ D;  4HGA C;  3X1T A;  4J8W A;  1P3K B;  3AZK C;  3AZH A;  3UTA B;  5B31 C;  1M1A C;  5F99 B;  1WWS A;  3H0M C;  1KU5 A;  2BYM B;  5GSU D;  5B33 D;  3C1B C;  1P3G A;  3AV2 B;  5CPI C;  3LZ0 B;  3W98 A;  5CPJ C;  2ZY2 A;  2ARO A;  5B1L D;  3AZI B;  2Y2J A;  4H9O A;  5AVC A;  3B0C T;  4CSR A;  4EO5 B;  4J8V B;  1P3F B;  1BH8 B;  3O62 B;  5AV5 A;  1F66 B;  2DQN C;  1F1E A;  5B1L C;  1N1J B;  1P3A B;  4J8U D;  3UTB A;  2RVQ D;  3B6F C;  3AN2 B;  1P3I B;  3W96 C;  3AYW C;  3REH A;  3AZE C;  3AZL D;  3W99 B;  4J8X B;  4YM6 A;  3AZG C;  4NE6 A;  5BNV B;  3LJA D;  4G91 B;  5AV9 B;  2FJ7 C;  5AVB A;  4X23 A;  4R8P A;  3C1C C;  4E44 A;  4YS3 C;  3MNN A;  5JRG A;  3LEL D;  3AZL C;  1P3B A;  5GXQ A;  3IP4 C;  5DNM B;  5BNX A;  1ID3 C;  2Y2L A;  3A6N D;  2ZM5 A;  4G92 C;  4QLC B;  5B0Z B;  4KGC D;  3MVD A;  2DF4 C;  3W97 B;  1P3M D;  3WKJ C;  4KUD D;  1AOI D;  1P3L B;  4Z5T A;  2Y2P A;  1EQZ B;  3AZH C;  4WU8 B;  5CPK A;  5CP6 B;  2PYO A;  3A6N C;  3AZJ D;  5AV6 D;  1A7W A;  4WU9 B;  3KFU G;  1P3G C;  3MGS D;  1T3U A;  3UT9 A;  1P3M C;  1P3P B;  2F8N K;  5B2I D;  3KUY A;  1KX3 D;  3LZ1 C;  1M18 B;  2ARO C;  1P3O A;  3UTA D;  4JJN D;  3KXB A;  3REI A;  3MGS C;  2F8N D;  1KX3 C;  3LZ0 D;  3REL B;  1TZY D;  4Z2M H;  4JJN C;  5E5A C;  1P34 A;  3B0B A;  2BG1 A;  3X1S D;  4XZQ B;  3B6G A;  1P3F D;  3REK A;  3WA9 A;  4AWL C;  3O62 D;  3REH C;  1S32 D;  1F66 D;  1TZY C;  3NQJ A;  2NZD D;  5JA4 B;  4Z66 B;  1P3A D;  2Y2H A;  2HIO B;  1M19 B;  3X1S C;  4WNN A;  1P3I D;  3MNN C;  3AZN B;  3AZF D;  4XUJ B;  3AFA C;  1PZR A;  5B32 C;  3AZK A;  5BS7 C;  5GT3 A;  1M1A A;  2BYK A;  3C1B A;  5B31 B;  4H9R B;  3X1U D;  2IO5 C;  3REJ B;  5CPI A;  5CPJ A;  4ZBJ C;  5BO0 A;  4WZS B;  5DNM D;  5CPK C;  2PYO C;  5B33 A;  5B0Z D;  5GSU A;  3AZM C;  3MGP D;  3X1U C;  3AV1 B;  1KX4 B;  5B2J B;  1P3L D; 
#chains in the Genus database with same CATH homology
 2Y2Q A;  4ZUX C;  5AY8 B;  5B1L A;  1WWI A;  3MGR B;  5CP6 D;  3TU4 B;  3MGQ B;  4WU9 D;  3EPL A;  3AYW A;  3V9R B;  3AZE A;  3B6F B;  3W96 B;  5B0Y C;  1TAF A;  4LD9 B;  2FJ7 A;  4CAY A;  5B24 C;  4YS3 A;  5B1M C;  5GT0 C;  3AZL A;  3C1C B;  5AV8 B;  1ID3 A;  2XD1 A;  5KDM A;  3EPK A;  2YFV A;  3X1V D;  3WKJ B;  2VQR A;  3B0D C;  5DNN D;  3X1T B;  4J8W B;  5GT3 C;  2HIO D;  5FUG A;  3A6N A;  3AZH B;  2NQB D;  4KGC A;  2HUE C;  5G49 A;  1P3M A;  3LZ1 A;  3AZN D;  5DNN C;  3W98 B;  2ARO B;  3EPH A;  2NQB C;  1H3O A;  5AV6 A;  5B33 C;  5GSU C;  4H9O B;  5AVC B;  5B40 D;  3MGS A;  4CSR B;  1KX3 A;  2YFW A;  5AV5 B;  1JFI A;  4JJN A;  5E5A A;  1HQ3 D;  3WAA D;  5B40 C;  1ZLA D;  3UTB B;  1KX4 D;  2F8N A;  1TZY A;  3REH B;  4J8U C;  3TU4 D;  3MGQ D;  1KX5 D;  3X1S A;  1HQ3 C;  4YM6 B;  2RVQ C;  3WAA C;  1ZLA C;  1R4V A;  5AVB B;  4H9S C;  4X23 B;  1S32 A;  2NZD A;  4R8P B;  3AFA A;  3MNN B;  5JRG B;  5B32 A;  5BS7 A;  1P3B B;  1KX5 C;  5GXQ B;  3LJA C;  1U35 D;  5BNX B;  1ULY A;  2XD5 A;  3MVD B;  3LEL C;  3AZF A;  5AV8 D;  2CV5 D;  4Z5T B;  4ZBJ B;  5C3I B;  1U35 C;  3KWQ D;  4KGC C;  2PYO B;  3AZM A;  3X1U A;  4KUD C;  1AOI C;  3UT9 B;  4ZUX A;  3NQU A;  1P3K D;  3KUY B;  3X1T D;  4NFT A;  4H9Q A;  5AV6 C;  5F99 D;  3AZJ C;  3KWQ C;  1P3O B;  3KXB B;  3MGP A;  3A1I A;  3AV2 D;  3REI B;  5B2I C;  2Y2K A;  1B67 A;  2UWX A;  5B0Y A;  3VH5 A;  3UTA C;  3AZI D;  1BH9 A;  5F99 C;  4J8V D;  1P34 B;  3AV2 C;  5B24 A;  3LZ0 C;  3B6G B;  5B1M A;  5GT0 A;  3REK B;  4H9N A;  3WA9 B;  5AV5 D;  3NQJ B;  3AZI C;  4J8V C;  4EO5 C;  3WTP B;  1P3F C;  3AN2 D;  3UTB D;  3O62 C;  1F66 C;  3R45 A;  4WNN B;  1S32 C;  3W99 D;  2NZD C;  4J8X D;  1P3A C;  4HGA B;  3AZK B;  3H0L C;  5AV9 D;  5GT3 B;  3AN2 C;  2BYK B;  1P3I C;  1M1A B;  3C1B B;  5AVB D;  4X23 D;  3W99 C;  3X1V A;  3AZF C;  4UUZ A;  2F8N H;  5CPI B;  2W8S A;  5JRG D;  5DNN A;  5CPJ B;  5BO0 B;  2NQB A;  4G91 C;  4QLC D;  5AV9 C;  3W97 D;  5B33 B;  5GSU B;  1EQZ D;  4Z2M G;  5DNM C;  4WU8 D;  5BT1 D;  5B1L B;  5CHL B;  4QLC C;  5B0Z C;  3MGP C;  1Q9C A;  5B40 A;  1P3P D;  3W97 C;  1P3L C;  1EQZ C;  1M18 D;  3AYW B;  3KUY D;  3AZE B;  4WU8 C;  5CP6 C;  4J8U A;  4WU9 C;  1P3O D;  1HQ3 A;  3AZG B;  2RIQ A;  3WAA A;  1P3P C;  1ZLA A;  1TAF B;  2FJ7 B;  4H9S A;  3REL D;  4CAY B;  3VH5 W;  1M18 C;  4YS3 B;  3AZL B;  3VH6 A;  2JCH A;  1KX5 A;  3LJA A;  1HTA A;  1ID3 B;  4XZQ D;  4G92 B;  3LEL A;  3B6G D;  3WA9 D;  4NE5 A;  5KDM B;  2YFV B;  4Z66 D;  1M19 D;  2ZY3 A;  1U35 A;  4H9P A;  3WTP D;  3KSY A;  5FUG B;  3A6N B;  2F2A C;  4DRB A;  5G49 B;  1P3G B;  1AOI A;  4KUD A;  3X1V C;  1P3M B;  4XUJ D;  3LZ1 B;  2CV5 A;  4E45 A;  2HIO C;  4KHA A;  3AZJ A;  3AZK D;  1M19 C;  3KWQ A;  5B31 D;  1H3O B;  3P5J B;  5B2I A;  2Y2N A;  3REJ D;  3MGS B;  3AZN C;  4XUJ C;  1P3K A;  1KX3 B;  3UTA A;  2YFW B;  1JFI B;  5F99 A;  4JJN B;  2BYM A;  5E5A B;  3AV1 D;  3AV2 A;  5B2J D;  3LZ0 A;  3REJ C;  4WV4 B;  2F8N B;  5AY8 D;  4AWL B;  3MGR D;  1TZY B;  3AZI A;  4J8V A;  1P3F A;  3AV1 C;  1KX4 C;  3X1S B;  1BH8 A;  4DQY B;  5B2J C;  3O62 A;  1F66 A;  3B6F D;  2Y2O A;  5AY8 C;  3AYW D;  3W96 D;  1N1J A;  3MGR C;  3AZE D;  1S32 B;  1P3A A;  2Y2I A;  3TU4 C;  2NZD B;  3AFA B;  3MGQ C;  5B32 B;  4LD9 D;  3AZG D;  3AN2 A;  1P3I A;  2FJ7 D;  3W99 A;  2IO5 B;  3C1C D;  3VH6 W;  4J8X A;  4YS3 D;  3AZF B;  5BNV A;  5CPK B;  3VH5 T;  4LD9 C;  5AV9 A;  1ID3 D;  2J8P A;  2JE5 A;  3AZM B;  3X1U B;  3WKJ D;  5AV8 C;  5DNM A;  2CV5 C;  4ZUX B;  3NQU B;  4J8W D;  3AZH D;  4QLC A;  5B0Z A;  3W97 A;  4H9Q B;  5B31 G;  1P3G D;  3MGP B;  1P3L A;  1EQZ A;  1P3K C;  3F6T A;  3LZ1 D;  4WU8 A;  3W98 D;  5CP6 A;  3X1T C;  2ARO D;  4J8W C;  1BFM A;  5B0Y B;  4WU9 A;  5AVC D;  1BH9 B;  2ZY4 A;  2G5H C;  1P3P A;  3A1K A;  3EG5 B;  2LY8 A;  5B24 B;  1M18 A;  3W98 C;  5B1M B;  5GT0 B;  4H9N B;  2Y2M A;  5AVC C;  5E5A D;  2G5I C;  3REL A;  5AV5 C;  3R45 B;  3WTP E;  3EPJ A;  3REH D;  3B0D B;  4YM6 D;  4XZQ A;  3UTB C;  2HUE B;  4R8P D;  4J8X C;  5JA4 A;  3MNN D;  3X1V B;  4Z66 A;  1P3B D;  4UUZ B;  3AFA D;  2HIO A;  5GXQ D;  5DNN B;  5B32 D;  1M19 A;  4DRA A;  4YM6 C;  3WTP A;  2NQB B;  5AVB C;  4X23 C;  3MVD D;  1W2E A;  2JSS A;  4R8P C;  3AZN A;  4XUJ A;  5JRG C;  1B6W A;  4Z5T D;  1P3B C;  3B0C W;  5GXQ C;  4M6B A;  5CPK D;  2PYO D;  3VH6 T;  5B31 A;  4H9R A;  3MVD C;  3REJ A;  3AZM D;  5B40 B;  3UT9 D;  5BT1 C;  4Z5T C;  2CWE A;  4UPK A;  4NE3 A;  4WJ3 C;  4ZUX D;  5C3I C;  4J8U B;  3KXB D;  3AV1 A;  1KX4 A;  3REI D;  1HQ3 B;  5B2J A;  3WAA B;  1Z2C B;  1ZLA B;  3UT9 C;  5AY8 A;  3KUY C;  3MGR A;  2FFF B;  3TU4 A;  3MGQ A;  1P3O C;  5B0Y D;  1P34 D;  3KXB C;  1KX5 B;  3LJA B;  3REI C;  3V9R A;  3REL C;  3B6F A;  3REK D;  3AL0 C;  5B24 D;  3W96 A;  3LEL B;  2L5A A;  2F8N G;  5B1M D;  5GT0 D;  4LD9 A;  3AZG A;  4XZQ C;  1P34 C;  1U35 B;  2Y2G A;  4H9P B;  4KGC B;  3B6G C;  3REK C;  3WA9 C;  3H0R C;  3C1C A;  5AV8 A;  4KUD B;  1AOI B;  4Z66 C;  2CV5 B;  3WTP C;  2ZY5 A;  4KHA B;  5GT3 D;  5B32 G;  5AV6 B;  3AZJ B;  1M1A D;  3KWQ B;  3FDD A;  3C1B D;  3WKJ A;  5B2I B;  5CPI D;  5CPJ D;  4HGA C;  3X1T A;  4J8W A;  1P3K B;  3AZK C;  3AZH A;  3UTA B;  5B31 C;  1M1A C;  5F99 B;  1WWS A;  3H0M C;  1KU5 A;  2BYM B;  5GSU D;  5B33 D;  3C1B C;  1P3G A;  3AV2 B;  5CPI C;  3LZ0 B;  3W98 A;  5CPJ C;  2ZY2 A;  2ARO A;  5B1L D;  3AZI B;  2Y2J A;  4H9O A;  5AVC A;  3B0C T;  4CSR A;  4EO5 B;  4J8V B;  1P3F B;  1BH8 B;  3O62 B;  5AV5 A;  1F66 B;  2DQN C;  1F1E A;  5B1L C;  1N1J B;  1P3A B;  4J8U D;  3UTB A;  2RVQ D;  3B6F C;  3AN2 B;  1P3I B;  3W96 C;  3AYW C;  3REH A;  3AZE C;  3AZL D;  3W99 B;  4J8X B;  4YM6 A;  3AZG C;  4NE6 A;  5BNV B;  3LJA D;  4G91 B;  5AV9 B;  2FJ7 C;  5AVB A;  4X23 A;  4R8P A;  3C1C C;  4E44 A;  4YS3 C;  3MNN A;  5JRG A;  3LEL D;  3AZL C;  1P3B A;  5GXQ A;  3IP4 C;  5DNM B;  5BNX A;  1ID3 C;  2Y2L A;  3A6N D;  2ZM5 A;  4G92 C;  4QLC B;  5B0Z B;  4KGC D;  3MVD A;  2DF4 C;  3W97 B;  1P3M D;  3WKJ C;  4KUD D;  1AOI D;  1P3L B;  4Z5T A;  2Y2P A;  1EQZ B;  3AZH C;  4WU8 B;  5CPK A;  5CP6 B;  2PYO A;  3A6N C;  3AZJ D;  5AV6 D;  1A7W A;  4WU9 B;  3KFU G;  1P3G C;  3MGS D;  1T3U A;  3UT9 A;  1P3M C;  1P3P B;  2F8N K;  5B2I D;  3KUY A;  1KX3 D;  3LZ1 C;  1M18 B;  2ARO C;  1P3O A;  3UTA D;  4JJN D;  3KXB A;  3REI A;  3MGS C;  2F8N D;  1KX3 C;  3LZ0 D;  3REL B;  1TZY D;  4Z2M H;  4JJN C;  5E5A C;  1P34 A;  3B0B A;  2BG1 A;  3X1S D;  4XZQ B;  3B6G A;  1P3F D;  3REK A;  3WA9 A;  4AWL C;  3O62 D;  3REH C;  1S32 D;  1F66 D;  1TZY C;  3NQJ A;  2NZD D;  5JA4 B;  4Z66 B;  1P3A D;  2Y2H A;  2HIO B;  1M19 B;  3X1S C;  4WNN A;  1P3I D;  3MNN C;  3AZN B;  3AZF D;  4XUJ B;  3AFA C;  1PZR A;  5B32 C;  3AZK A;  5BS7 C;  5GT3 A;  1M1A A;  2BYK A;  3C1B A;  5B31 B;  4H9R B;  3X1U D;  2IO5 C;  3REJ B;  5CPI A;  5CPJ A;  4ZBJ C;  5BO0 A;  4WZS B;  5DNM D;  5CPK C;  2PYO C;  5B33 A;  5B0Z D;  5GSU A;  3AZM C;  3MGP D;  3X1U C;  3AV1 B;  1KX4 B;  5B2J B;  1P3L D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...