3AYWB

Crystal structure of human nucleosome core particle containing h3k56q mutation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aywB00
4J8XD 4J8VD 3W98B 3X1SC 3AYWD 4WZSB 1M1AA 3A6NA 3UTAA 3TU4A 4J8XC 1ID3B 2NQBB 5C3IB 5CP6A 3X1VA 1P3KA 3REIC 3LZ1B 3A6NC 3UTAC 3VH5W 4HGAB 5B2IB 4UUZA 3LJAA 4J8WA 5AY8C 1P3PD 1BH9A 5AV6D 3MGPB 3R45A 5B1LC 5CPIC 3WAAC 3B6GB 3W99D 3WAAB 5DNMB 5KDMA 5B40D 3WTPE 3AV2A 1P3MD 4J8UC 3AZNA 4WU9D 3WTPC 3AZEA 2CWEA 4JJND 5G49A 4QLCB 3AZID 5DNNB 5B0ZB 3W97C 4YS3C 4E45A 1H3OB 3AZKA 1HQ3D 1P3AC 5B2JB 1P3GC 5JA4A 2AROB 4ZUXA 5AV9C 1P3LC 4X23B 5GT3C 5GXQB 5JRGB 1AOID 4X23C 3RELA 3AN2B 5B32C 3W96C 4ZUXD 1KX5D 3AYWC 3MGQC 3X1VD 1P3KD 3AN2A 4WU8A 4H9QA 3MGRA 1P3BD 3REKA 1B6WA 5B32D 1P34C 3VH6T 5CPJC 4NE5A 3LZ0A 3X1VC 1P3KC 5AVCC 3B0BA 3AZIB 4WU8D 3AZLC 3UTBB 1P3MA 5B40A 4Z5TB 1H3OA 3AZKB 3AV2D 5B1LD 1P34D 1P3FC 3UT9C 5AVBA 3AZLB 5BNXB 5B1MD 5B2JD 1P3IC 4NE6A 3RELC 2PYOD 3AZEB 3AV2C 1P3FD 2F8NG 4G91C 3W96A 3LELB 1U35B 3AV1B 5B1MC 3B6GA 5JRGD 1P3ID 3REIA 4H9NA 2F8NA 3C1CA 5AY8A 1ID3C 2NQBC 2NZDA 1HQ3C 5B24B 5B31B 5AVCA 3REIB 4UUZB 1S32A 5B33C 2LY8A 3MVDC 5B32G 1N1JB 4XZQD 3A6NB 3UTAB 3KSYA 4J8UA 5BS7A 3AZNC 2CV5A 5AV6C 4G92C 1B67A 3W96D 5B32A 3MVDD 2HUEB 3B0CT 4WU9A 3WTPB 1KX3B 5FUGB 4QLCC 3REJC 3NQJA 5AV5B 2HIOC 4H9RB 4J8UD 5B1LA 4KUDD 1KX4A 4M6BA 5AVCD 1M1AD 1F1EA 1U35D 1S32D 1M19D 5BNVA 5E5AD 4E44A 4R8PC 3AZJC 4H9PB 4Z2MH 3B6FC 3C1CB 5B33B 3REID 4J8VC 1AOIA 3MGSB 3NQJB 5GT3D 5B31G 2FJ7A 4Z66D 5CPIB 3MGQB 5AV8B 5B0YA 3NQUA 3AZFC 5B32B 5DNMC 3WA9C 3B0DC 4J8WC 3VH6W 5GSUB 1P3MC 3W99B 4DRAA 3LZ0D 4CAYB 3C1BB 5B40B 1N1JA 5AVBC 1KX3D 5E5AA 1F66D 3AZFD 3AZKD 1P34B 5B0ZC 3W97B 3MVDA 3AZMB 3WA9D 4XUJA 5AVCB 5B31A 4H9OB 3AZMC 5DNMA 3AZGB 1F66C 1P3BA 3VH6A 1TZYC 3KUYA 3X1TC 3MNNA 3AZHB 3LZ1D 1P3LB 3AV1A 1ZLAA 1BH9B 2RVQC 1KU5A 3RELD 1P3IB 4YS3D 4H9SC 5GXQA 4X23A 3X1TD 5AV8C 1ZLAC 3TU4B 4ZUXC 5AV9D 5CPID 4YM6C 4J8XB 3W99C 1P3MB 5B40C 1P3FA 4R8PA 3AZJA 4J8XA 3O62D 3LZ0B 5F99B 3MGPC 3AZIC 3V9RB 4WU8C 1TAFA 4Z66C 4WU8B 1TZYB 3AZFA 4Z66A 3MNNB 3AZHA 4J8WD 5DNND 3KUYB 3R45B 1P3LD 5AVBD 2PYOB 3AN2D 3B6FA 3AZMA 4ZUXB 2AROA 4Z2MG 4LD9B 5JA4B 5DNNC 4CSRB 1M1AC 1HTAA 1M19C 4ZBJB 3C1BA 5AV9B 5BT1D 5GSUA 3X1UB 5B24D 3B6FD 3LZ1C 5GT3B 4H9SA 1P3OB 3KWQD 3KXBD 5CPKB 5B0YB 5AV8A 1P3OC 4J8VB 1KX5B 3AZNB 1BFMA 1M18B 3AYWB 1ZLAD 5GXQC 3MGSA 1P3LA 2HUEC 1AOIB 3AZFB 4KUDA 3REJB 1WWSA 4XUJC 3W97D 4XZQC 4H9OA 5BNVB 4XUJB 4J8WB 4Z5TD 1TAFB 3MGPD 3AZKC 3V9RA 1KX4B 4CAYA 3AZHD 4KHAA 4LD9D 3REKD 1A7WA 4R8PB 3AZJB 3AZED 1P3FB 2HIOD 5FUGA 1BH8A 4WU9B 3NQUB 2JSSA 4JJNB 2YFVA 4NFTA 1U35C 3AZHC 1BH8B 5GT0C 3MGSC 2FJ7D 5B33D 1KX5C 3B0CW 2CV5B 1P3BC 5AV6A 3LJAC 1P3IA 1M18D 1ZLAB 4H9PA 4EO5C 3KWQA 5F99D 3C1BC 5AV5D 3LZ0C 5CP6C 3AZGA 2NZDB 5AY8B 4KUDB 3REHA 4WNNA 5B31D 3UT9D 2NZDC 2BYKA 3MGRC 4YM6A 3MVDB 4G92B 1P34A 1KX3A 1JFIA 1P3PB 5GT0A 3AFAB 4KGCB 5CPKA 5GT3A 2HIOB 3AFAC 2F8NK 2IO5B 4KGCC 3LELC 5AV9A 3WTPD 2FJ7B 4YS3B 3TU4C 4YM6B 1HQ3A 5B2ID 1P3AB 1P3GB 3B6FB 2PYOA 3X1UC 5B24A 3VH5T 5C3IC 1EQZB 3O62C 4HGAC 3B6GD 3C1CC 5GT0D 5DNMD 4NE3A 3O62B 1U35A 3UTBD 5CPKC 5AV6B 5B1LB 4H9RA 3REJD 1P3PC 5B0ZD 5BO0A 2BYMB 3MNNC 1TZYD 3MGQD 2IO5C 4JJNA 5B2JA 4Z5TA 3AZMD 3UTBA 1S32C 3B0DB 1KX4D 4Z5TC 2AROC 5B0ZA 5CHLB 5DNNA 2RVQD 4ZBJC 4AWLC 3X1SA 2F8ND 1KX4C 4JJNC 4AWLB 5AV8D 3AZEC 3AV2B 5KDMB 2AROD 3AN2C 3REJA 1EQZA 4H9NB 3KXBC 3AV1C 1P3BB 1Q9CA 5JRGA 1P3OD 3X1SD 3KXBB 3X1TA 3WKJC 1M18A 3W96B 4J8VA 1P3AA 4EO5B 1P3GA 1HQ3B 5B24C 1AOIC 3REHC 3LZ1A 3AV1D 3X1VB 1P3KB 3WA9B 5CP6B 5BNXA 3X1UA 3WKJD 3W99A 5AVBB 3AZLA 5F99C 4X23D 5GXQD 3WA9A 3WAAD 4LD9A 3AFAA 4KGCA 1P3PA 4WV4B 3MGQA 5BO0B 5B1MA 3KUYD 3AZLD 3KXBA 3X1TB 4WU9C 5BT1C 4H9QB 2L5AA 3W98C 3MGSD 2FJ7C 4YM6D 1TZYA 3LELD 3KUYC 4LD9C 5B2IA 3LJAB 3X1SB 2CV5D 3W98D 5F99A 5B2IC 3A6ND 3UTAD 1EQZD 1M1AB 5GSUD 5E5AC 4YS3A 5CP6D 3WTPA 5JRGC 4DRBA 2YFWB 3B6GC 1M18C 1EQZC 2BYMA 2HIOA 4J8UB 5G49B 4KHAB 4QLCA 5CPKD 5AV5C 1JFIB 3REHD 3UT9A 3O62A 5CPJD 3WAAA 1S32B 3AFAD 4KGCD 3MGRD 1F66A 4WNNB 2PYOC 4QLCD 3MGPA 2F8NB 4XZQA 3KWQB 3LJAD 1F66B 5B0YD 1M19B 3W97A 3AYWA 5B2JC 3KWQC 5E5AB 3LELA 1ID3A 2NQBA 3VH5A 5AY8D 4G91B 4R8PD 3AZJD 1P3OA 2F8NH 5B0YC 3W98A 5GT0B 3C1BD 5CPIA 4XUJD 1ID3D 2NQBD 5BS7C 2CV5C 3AZIA 3WKJB 4CSRA 1M19A 5B31C 2NZDD 3MNND 2BYKB 3C1CD 4XZQB 5GSUC 3REHB 5B33A 3UTBC 3REKB 5CPJB 3MGRB 3AZGC 3AZND 3REKC 4Z66B 4KUDC 5CPJA 1P3GD 1P3AD 1WWIA 1ULYA 1R4VA 3RELB 3UT9B 3AZGD 1KX3C 5AV5A 3X1UD 3WKJA 5B1MB 3TU4D 1KX5A 2YFWA 2YFVB
chains in the Genus database with same CATH superfamily
4J8XD 4J8VD 3W98B 3X1SC 3AYWD 4WZSB 1M1AA 3A6NA 3UTAA 3TU4A 2Y2KA 4J8XC 1ID3B 2NQBB 5C3IB 5CP6A 3X1VA 1P3KA 3REIC 3LZ1B 3A6NC 3UTAC 3VH5W 4HGAB 5B2IB 4UUZA 3LJAA 4J8WA 5AY8C 4WJ3C 1P3PD 1BH9A 5AV6D 3MGPB 3R45A 5B1LC 5CPIC 3H0RC 3WAAC 3B6GB 3W99D 3WAAB 5DNMB 5KDMA 5B40D 3WTPE 3AV2A 1P3MD 4J8UC 3AZNA 4WU9D 3WTPC 3AZEA 1W2EA 2CWEA 4JJND 5G49A 4QLCB 3AZID 5DNNB 5B0ZB 3W97C 2UWXA 4E45A 1H3OB 4YS3C 3AZKA 2FFFB 1HQ3D 1P3AC 5B2JB 1P3GC 5JA4A 2AROB 4ZUXA 5AV9C 1P3LC 2VQRA 4X23B 5GT3C 5GXQB 5JRGB 1AOID 4X23C 3RELA 3AN2B 5B32C 3W96C 4ZUXD 1KX5D 3AYWC 3MGQC 3X1VD 1P3KD 3AN2A 3EPHA 4WU8A 4H9QA 2Y2QA 3MGRA 1P3BD 3REKA 1B6WA 5B32D 1P34C 3VH6T 5CPJC 4NE5A 3LZ0A 3X1VC 1P3KC 5AVCC 3B0BA 3AZIB 4WU8D 3AZLC 3UTBB 1P3MA 5B40A 4Z5TB 1H3OA 3AZKB 3AV2D 5B1LD 1P34D 1P3FC 3UT9C 5AVBA 3AZLB 5BNXB 5B1MD 5B2JD 1P3IC 4NE6A 3RELC 2PYOD 3AZEB 3AV2C 1P3FD 2F8NG 4G91C 3W96A 3LELB 1U35B 3AV1B 2ZY5A 5B1MC 3B6GA 5JRGD 1P3ID 3REIA 4H9NA 2F8NA 3C1CA 5AY8A 1ID3C 2NQBC 2NZDA 1HQ3C 5B24B 5B31B 5AVCA 3REIB 4UUZB 1S32A 5B33C 2LY8A 3MVDC 5B32G 1N1JB 2ZY3A 4XZQD 3A6NB 3UTAB 3KSYA 4J8UA 5BS7A 3AZNC 2CV5A 5AV6C 4G92C 1B67A 2F2AC 5B32A 3MVDD 3W96D 2HUEB 3B0CT 4WU9A 3WTPB 1KX3B 5FUGB 4QLCC 3REJC 3NQJA 5AV5B 2HIOC 4H9RB 4J8UD 5B1LA 4KUDD 1KX4A 4M6BA 5AVCD 3EG5B 1M1AD 1F1EA 1U35D 2JCHA 1S32D 1M19D 5BNVA 5E5AD 4E44A 4R8PC 3AZJC 4H9PB 4Z2MH 3B6FC 3C1CB 5B33B 3REID 4J8VC 1AOIA 3MGSB 3NQJB 3P5JB 5GT3D 2Y2NA 5B31G 2FJ7A 4Z66D 5CPIB 3MGQB 5AV8B 5B0YA 2W8SA 3NQUA 3AZFC 5B32B 5DNMC 3WA9C 3B0DC 4J8WC 3VH6W 5GSUB 1P3MC 3W99B 4DRAA 3LZ0D 4CAYB 3C1BB 5B40B 1N1JA 5AVBC 1KX3D 5E5AA 1F66D 3AZFD 3AZKD 1P34B 5B0ZC 3W97B 3MVDA 3AZMB 3WA9D 4XUJA 5AVCB 5B31A 4H9OB 4DQYB 3AZMC 5DNMA 3AZGB 1F66C 1P3BA 3VH6A 1TZYC 3KUYA 3X1TC 3MNNA 3AZHB 3LZ1D 1P3LB 3AV1A 1ZLAA 1BH9B 2RVQC 1KU5A 3RELD 1P3IB 4YS3D 4H9SC 5GXQA 4X23A 3X1TD 5AV8C 1ZLAC 2Y2GA 3TU4B 4ZUXC 5AV9D 5CPID 4YM6C 4J8XB 2Y2LA 3W99C 1P3MB 5B40C 1P3FA 4R8PA 3AZJA 4J8XA 3O62D 3LZ0B 2G5IC 5F99B 3A1KA 3MGPC 3AZIC 3V9RB 4WU8C 1TAFA 4Z66C 4WU8B 1TZYB 3AZFA 4Z66A 3AL0C 3MNNB 3AZHA 4J8WD 5DNND 3KUYB 3R45B 1P3LD 5AVBD 2PYOB 3AN2D 3B6FA 3AZMA 4ZUXB 2AROA 4Z2MG 4LD9B 5JA4B 5DNNC 4CSRB 1M1AC 1HTAA 3IP4C 1M19C 4ZBJB 3C1BA 5AV9B 5BT1D 2BG1A 2JE5A 5GSUA 3X1UB 5B24D 3B6FD 3LZ1C 5GT3B 4H9SA 1P3OB 3KWQD 3KXBD 3F6TA 5CPKB 5B0YB 5AV8A 1P3OC 4J8VB 1KX5B 3AZNB 1BFMA 1M18B 3AYWB 1ZLAD 5GXQC 3MGSA 3A1IA 1P3LA 2HUEC 1AOIB 3AZFB 4KUDA 3REJB 1WWSA 3H0LC 4XUJC 4XZQC 3W97D 4H9OA 5BNVB 4XUJB 4J8WB 4Z5TD 1TAFB 3MGPD 3AZKC 3V9RA 1KX4B 4CAYA 3AZHD 4KHAA 4LD9D 3REKD 1A7WA 4R8PB 3AZJB 3AZED 1P3FB 2HIOD 5FUGA 1BH8A 4WU9B 3NQUB 2JSSA 4JJNB 2YFVA 4NFTA 1U35C 3AZHC 1BH8B 5GT0C 3MGSC 2FJ7D 5B33D 1KX5C 3B0CW 2CV5B 2ZY2A 1P3BC 5AV6A 1Z2CB 3LJAC 1P3IA 1PZRA 1M18D 1ZLAB 4H9PA 4EO5C 3KWQA 5F99D 3C1BC 5AV5D 3LZ0C 5CP6C 3AZGA 2NZDB 5AY8B 4KUDB 3REHA 4WNNA 5B31D 3UT9D 2NZDC 2BYKA 3MGRC 4YM6A 3MVDB 4G92B 1T3UA 1P34A 1KX3A 1JFIA 3H0MC 5GT0A 1P3PB 3AFAB 4KGCB 5CPKA 5GT3A 2HIOB 3AFAC 2F8NK 2IO5B 4KGCC 3LELC 5AV9A 3WTPD 2FJ7B 4YS3B 3TU4C 4YM6B 1HQ3A 5B2ID 1P3AB 1P3GB 3B6FB 2PYOA 3X1UC 5B24A 3VH5T 5C3IC 1EQZB 3O62C 4HGAC 3B6GD 3C1CC 5GT0D 5DNMD 4NE3A 3O62B 1U35A 3UTBD 5CPKC 5AV6B 5B1LB 4H9RA 3REJD 1P3PC 5B0ZD 2Y2HA 5BO0A 2BYMB 3MNNC 1TZYD 3MGQD 2IO5C 4JJNA 2ZM5A 5B2JA 4Z5TA 3AZMD 3UTBA 1S32C 3B0DB 1KX4D 2Y2IA 4Z5TC 2AROC 5B0ZA 2J8PA 2Y2OA 5CHLB 5DNNA 2RVQD 2G5HC 4ZBJC 3EPKA 3X1SA 4AWLC 2F8ND 1KX4C 4UPKA 4JJNC 4AWLB 5AV8D 3AZEC 3AV2B 5KDMB 2AROD 3AN2C 3REJA 1EQZA 4H9NB 3KXBC 3AV1C 1P3BB 2DQNC 1Q9CA 5JRGA 1P3OD 3X1SD 3KXBB 3X1TA 3WKJC 1M18A 3W96B 2XD1A 3EPJA 4J8VA 1P3AA 4EO5B 1P3GA 1HQ3B 5B24C 1AOIC 3REHC 3LZ1A 3AV1D 3X1VB 1P3KB 3WA9B 5CP6B 5BNXA 3X1UA 3WKJD 3W99A 5AVBB 3AZLA 5F99C 4X23D 5GXQD 3WA9A 3WAAD 4LD9A 3AFAA 4KGCA 1P3PA 4WV4B 3MGQA 5BO0B 2Y2MA 5B1MA 3KUYD 3AZLD 3KXBA 3X1TB 4WU9C 5BT1C 4H9QB 2L5AA 3W98C 3MGSD 2FJ7C 4YM6D 1TZYA 3LELD 3KUYC 4LD9C 5B2IA 3LJAB 3X1SB 2CV5D 3W98D 5F99A 5B2IC 3KFUG 3A6ND 3UTAD 1EQZD 1M1AB 5GSUD 2DF4C 5E5AC 4YS3A 5CP6D 3WTPA 5JRGC 2RIQA 4DRBA 2YFWB 3B6GC 1M18C 1EQZC 2BYMA 2HIOA 2XD5A 4J8UB 5G49B 4KHAB 4QLCA 5CPKD 5AV5C 1JFIB 3REHD 3UT9A 3O62A 5CPJD 3WAAA 1S32B 3AFAD 4KGCD 3MGRD 1F66A 4WNNB 2PYOC 4QLCD 3MGPA 3EPLA 2F8NB 4XZQA 3FDDA 3KWQB 3LJAD 1F66B 5B0YD 1M19B 3W97A 3AYWA 5B2JC 3KWQC 5E5AB 3LELA 1ID3A 2NQBA 3VH5A 5AY8D 4G91B 4R8PD 2Y2PA 3AZJD 1P3OA 2F8NH 5B0YC 3W98A 5GT0B 3C1BD 2Y2JA 5CPIA 4XUJD 1ID3D 2NQBD 5BS7C 2CV5C 3AZIA 3WKJB 4CSRA 1M19A 5B31C 2NZDD 3MNND 2BYKB 3C1CD 4XZQB 5GSUC 3REHB 5B33A 2ZY4A 3UTBC 3REKB 5CPJB 3MGRB 3AZGC 3AZND 3REKC 4Z66B 4KUDC 5CPJA 1P3GD 1P3AD 1WWIA 1ULYA 1R4VA 3RELB 3UT9B 3AZGD 1KX3C 5AV5A 3X1UD 3WKJA 5B1MB 3TU4D 1KX5A 2YFWA 2YFVB
chains in the Genus database with same CATH topology
4J8XD 4J8VD 3W98B 3X1SC 3AYWD 4WZSB 1M1AA 3A6NA 3UTAA 3TU4A 2Y2KA 4J8XC 1ID3B 2NQBB 5C3IB 5CP6A 3X1VA 1P3KA 3REIC 3LZ1B 3A6NC 3UTAC 3VH5W 4HGAB 5B2IB 4UUZA 3LJAA 4J8WA 5AY8C 4WJ3C 1P3PD 1BH9A 5AV6D 3MGPB 3R45A 5B1LC 5CPIC 3H0RC 3WAAC 3B6GB 3W99D 3WAAB 5DNMB 5KDMA 5B40D 3WTPE 3AV2A 1P3MD 4J8UC 3AZNA 4WU9D 3WTPC 3AZEA 1W2EA 2CWEA 4JJND 5G49A 4QLCB 3AZID 5DNNB 5B0ZB 3W97C 2UWXA 4E45A 1H3OB 4YS3C 3AZKA 2FFFB 1HQ3D 1P3AC 5B2JB 1P3GC 5JA4A 2AROB 4ZUXA 5AV9C 1P3LC 2VQRA 4X23B 5GT3C 5GXQB 5JRGB 1AOID 4X23C 3RELA 3AN2B 5B32C 3W96C 4ZUXD 1KX5D 3AYWC 3MGQC 3X1VD 1P3KD 3AN2A 3EPHA 4WU8A 4H9QA 2Y2QA 3MGRA 1P3BD 3REKA 1B6WA 5B32D 1P34C 3VH6T 5CPJC 4NE5A 3LZ0A 3X1VC 1P3KC 5AVCC 3B0BA 3AZIB 4WU8D 3AZLC 3UTBB 1P3MA 5B40A 4Z5TB 1H3OA 3AZKB 3AV2D 5B1LD 1P34D 1P3FC 3UT9C 5AVBA 3AZLB 5BNXB 5B1MD 5B2JD 1P3IC 4NE6A 3RELC 2PYOD 3AZEB 3AV2C 1P3FD 2F8NG 4G91C 3W96A 3LELB 1U35B 3AV1B 2ZY5A 5B1MC 3B6GA 5JRGD 1P3ID 3REIA 4H9NA 2F8NA 3C1CA 5AY8A 1ID3C 2NQBC 2NZDA 1HQ3C 5B24B 5B31B 5AVCA 3REIB 4UUZB 1S32A 5B33C 2LY8A 3MVDC 5B32G 1N1JB 2ZY3A 4XZQD 3A6NB 3UTAB 3KSYA 4J8UA 5BS7A 3AZNC 2CV5A 5AV6C 4G92C 1B67A 2F2AC 5B32A 3MVDD 3W96D 2HUEB 3B0CT 4WU9A 3WTPB 1KX3B 5FUGB 4QLCC 3REJC 3NQJA 5AV5B 2HIOC 4H9RB 4J8UD 5B1LA 4KUDD 1KX4A 4M6BA 5AVCD 3EG5B 1M1AD 1F1EA 1U35D 2JCHA 1S32D 1M19D 5BNVA 5E5AD 4E44A 4R8PC 3AZJC 4H9PB 4Z2MH 3B6FC 3C1CB 5B33B 3REID 4J8VC 1AOIA 3MGSB 3NQJB 3P5JB 5GT3D 2Y2NA 5B31G 2FJ7A 4Z66D 5CPIB 3MGQB 5AV8B 5B0YA 2W8SA 3NQUA 3AZFC 5B32B 5DNMC 3WA9C 3B0DC 4J8WC 3VH6W 5GSUB 1P3MC 3W99B 4DRAA 3LZ0D 4CAYB 3C1BB 5B40B 1N1JA 5AVBC 1KX3D 5E5AA 1F66D 3AZFD 3AZKD 1P34B 5B0ZC 3W97B 3MVDA 3AZMB 3WA9D 4XUJA 5AVCB 5B31A 4H9OB 4DQYB 3AZMC 5DNMA 3AZGB 1F66C 1P3BA 3VH6A 1TZYC 3KUYA 3X1TC 3MNNA 3AZHB 3LZ1D 1P3LB 3AV1A 1ZLAA 1BH9B 2RVQC 1KU5A 3RELD 1P3IB 4YS3D 4H9SC 5GXQA 4X23A 3X1TD 5AV8C 1ZLAC 2Y2GA 3TU4B 4ZUXC 5AV9D 5CPID 4YM6C 4J8XB 2Y2LA 3W99C 1P3MB 5B40C 1P3FA 4R8PA 3AZJA 4J8XA 3O62D 3LZ0B 2G5IC 5F99B 3A1KA 3MGPC 3AZIC 3V9RB 4WU8C 1TAFA 4Z66C 4WU8B 1TZYB 3AZFA 4Z66A 3AL0C 3MNNB 3AZHA 4J8WD 5DNND 3KUYB 3R45B 1P3LD 5AVBD 2PYOB 3AN2D 3B6FA 3AZMA 4ZUXB 2AROA 4Z2MG 4LD9B 5JA4B 5DNNC 4CSRB 1M1AC 1HTAA 3IP4C 1M19C 4ZBJB 3C1BA 5AV9B 5BT1D 2BG1A 2JE5A 5GSUA 3X1UB 5B24D 3B6FD 3LZ1C 5GT3B 4H9SA 1P3OB 3KWQD 3KXBD 3F6TA 5CPKB 5B0YB 5AV8A 1P3OC 4J8VB 1KX5B 3AZNB 1BFMA 1M18B 3AYWB 1ZLAD 5GXQC 3MGSA 3A1IA 1P3LA 2HUEC 1AOIB 3AZFB 4KUDA 3REJB 1WWSA 3H0LC 4XUJC 4XZQC 3W97D 4H9OA 5BNVB 4XUJB 4J8WB 4Z5TD 1TAFB 3MGPD 3AZKC 3V9RA 1KX4B 4CAYA 3AZHD 4KHAA 4LD9D 3REKD 1A7WA 4R8PB 3AZJB 3AZED 1P3FB 2HIOD 5FUGA 1BH8A 4WU9B 3NQUB 2JSSA 4JJNB 2YFVA 4NFTA 1U35C 3AZHC 1BH8B 5GT0C 3MGSC 2FJ7D 5B33D 1KX5C 3B0CW 2CV5B 2ZY2A 1P3BC 5AV6A 1Z2CB 3LJAC 1P3IA 1PZRA 1M18D 1ZLAB 4H9PA 4EO5C 3KWQA 5F99D 3C1BC 5AV5D 3LZ0C 5CP6C 3AZGA 2NZDB 5AY8B 4KUDB 3REHA 4WNNA 5B31D 3UT9D 2NZDC 2BYKA 3MGRC 4YM6A 3MVDB 4G92B 1T3UA 1P34A 1KX3A 1JFIA 3H0MC 5GT0A 1P3PB 3AFAB 4KGCB 5CPKA 5GT3A 2HIOB 3AFAC 2F8NK 2IO5B 4KGCC 3LELC 5AV9A 3WTPD 2FJ7B 4YS3B 3TU4C 4YM6B 1HQ3A 5B2ID 1P3AB 1P3GB 3B6FB 2PYOA 3X1UC 5B24A 3VH5T 5C3IC 1EQZB 3O62C 4HGAC 3B6GD 3C1CC 5GT0D 5DNMD 4NE3A 3O62B 1U35A 3UTBD 5CPKC 5AV6B 5B1LB 4H9RA 3REJD 1P3PC 5B0ZD 2Y2HA 5BO0A 2BYMB 3MNNC 1TZYD 3MGQD 2IO5C 4JJNA 2ZM5A 5B2JA 4Z5TA 3AZMD 3UTBA 1S32C 3B0DB 1KX4D 2Y2IA 4Z5TC 2AROC 5B0ZA 2J8PA 2Y2OA 5CHLB 5DNNA 2RVQD 2G5HC 4ZBJC 3EPKA 3X1SA 4AWLC 2F8ND 1KX4C 4UPKA 4JJNC 4AWLB 5AV8D 3AZEC 3AV2B 5KDMB 2AROD 3AN2C 3REJA 1EQZA 4H9NB 3KXBC 3AV1C 1P3BB 2DQNC 1Q9CA 5JRGA 1P3OD 3X1SD 3KXBB 3X1TA 3WKJC 1M18A 3W96B 2XD1A 3EPJA 4J8VA 1P3AA 4EO5B 1P3GA 1HQ3B 5B24C 1AOIC 3REHC 3LZ1A 3AV1D 3X1VB 1P3KB 3WA9B 5CP6B 5BNXA 3X1UA 3WKJD 3W99A 5AVBB 3AZLA 5F99C 4X23D 5GXQD 3WA9A 3WAAD 4LD9A 3AFAA 4KGCA 1P3PA 4WV4B 3MGQA 5BO0B 2Y2MA 5B1MA 3KUYD 3AZLD 3KXBA 3X1TB 4WU9C 5BT1C 4H9QB 2L5AA 3W98C 3MGSD 2FJ7C 4YM6D 1TZYA 3LELD 3KUYC 4LD9C 5B2IA 3LJAB 3X1SB 2CV5D 3W98D 5F99A 5B2IC 3KFUG 3A6ND 3UTAD 1EQZD 1M1AB 5GSUD 2DF4C 5E5AC 4YS3A 5CP6D 3WTPA 5JRGC 2RIQA 4DRBA 2YFWB 3B6GC 1M18C 1EQZC 2BYMA 2HIOA 2XD5A 4J8UB 5G49B 4KHAB 4QLCA 5CPKD 5AV5C 1JFIB 3REHD 3UT9A 3O62A 5CPJD 3WAAA 1S32B 3AFAD 4KGCD 3MGRD 1F66A 4WNNB 2PYOC 4QLCD 3MGPA 3EPLA 2F8NB 4XZQA 3FDDA 3KWQB 3LJAD 1F66B 5B0YD 1M19B 3W97A 3AYWA 5B2JC 3KWQC 5E5AB 3LELA 1ID3A 2NQBA 3VH5A 5AY8D 4G91B 4R8PD 2Y2PA 3AZJD 1P3OA 2F8NH 5B0YC 3W98A 5GT0B 3C1BD 2Y2JA 5CPIA 4XUJD 1ID3D 2NQBD 5BS7C 2CV5C 3AZIA 3WKJB 4CSRA 1M19A 5B31C 2NZDD 3MNND 2BYKB 3C1CD 4XZQB 5GSUC 3REHB 5B33A 2ZY4A 3UTBC 3REKB 5CPJB 3MGRB 3AZGC 3AZND 3REKC 4Z66B 4KUDC 5CPJA 1P3GD 1P3AD 1WWIA 1ULYA 1R4VA 3RELB 3UT9B 3AZGD 1KX3C 5AV5A 3X1UD 3WKJA 5B1MB 3TU4D 1KX5A 2YFWA 2YFVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8X D;  4J8V D;  3W98 B;  3X1S C;  3AYW D;  4WZS B;  1M1A A;  3A6N A;  3UTA A;  3TU4 A;  4J8X C;  1ID3 B;  2NQB B;  5C3I B;  5CP6 A;  3X1V A;  1P3K A;  3REI C;  3LZ1 B;  3A6N C;  3UTA C;  3VH5 W;  4HGA B;  5B2I B;  4UUZ A;  3LJA A;  4J8W A;  5AY8 C;  1P3P D;  1BH9 A;  5AV6 D;  3MGP B;  3R45 A;  5B1L C;  5CPI C;  3WAA C;  3B6G B;  3W99 D;  3WAA B;  5DNM B;  5KDM A;  5B40 D;  3WTP E;  3AV2 A;  1P3M D;  4J8U C;  3AZN A;  4WU9 D;  3WTP C;  3AZE A;  2CWE A;  4JJN D;  5G49 A;  4QLC B;  3AZI D;  5DNN B;  5B0Z B;  3W97 C;  4YS3 C;  4E45 A;  1H3O B;  3AZK A;  1HQ3 D;  1P3A C;  5B2J B;  1P3G C;  5JA4 A;  2ARO B;  4ZUX A;  5AV9 C;  1P3L C;  4X23 B;  5GT3 C;  5GXQ B;  5JRG B;  1AOI D;  4X23 C;  3REL A;  3AN2 B;  5B32 C;  3W96 C;  4ZUX D;  1KX5 D;  3AYW C;  3MGQ C;  3X1V D;  1P3K D;  3AN2 A;  4WU8 A;  4H9Q A;  3MGR A;  1P3B D;  3REK A;  1B6W A;  5B32 D;  1P34 C;  3VH6 T;  5CPJ C;  4NE5 A;  3LZ0 A;  3X1V C;  1P3K C;  5AVC C;  3B0B A;  3AZI B;  4WU8 D;  3AZL C;  3UTB B;  1P3M A;  5B40 A;  4Z5T B;  1H3O A;  3AZK B;  3AV2 D;  5B1L D;  1P34 D;  1P3F C;  3UT9 C;  5AVB A;  3AZL B;  5BNX B;  5B1M D;  5B2J D;  1P3I C;  4NE6 A;  3REL C;  2PYO D;  3AZE B;  3AV2 C;  1P3F D;  2F8N G;  4G91 C;  3W96 A;  3LEL B;  1U35 B;  3AV1 B;  5B1M C;  3B6G A;  5JRG D;  1P3I D;  3REI A;  4H9N A;  2F8N A;  3C1C A;  5AY8 A;  1ID3 C;  2NQB C;  2NZD A;  1HQ3 C;  5B24 B;  5B31 B;  5AVC A;  3REI B;  4UUZ B;  1S32 A;  5B33 C;  2LY8 A;  3MVD C;  5B32 G;  1N1J B;  4XZQ D;  3A6N B;  3UTA B;  3KSY A;  4J8U A;  5BS7 A;  3AZN C;  2CV5 A;  5AV6 C;  4G92 C;  1B67 A;  3W96 D;  5B32 A;  3MVD D;  2HUE B;  3B0C T;  4WU9 A;  3WTP B;  1KX3 B;  5FUG B;  4QLC C;  3REJ C;  3NQJ A;  5AV5 B;  2HIO C;  4H9R B;  4J8U D;  5B1L A;  4KUD D;  1KX4 A;  4M6B A;  5AVC D;  1M1A D;  1F1E A;  1U35 D;  1S32 D;  1M19 D;  5BNV A;  5E5A D;  4E44 A;  4R8P C;  3AZJ C;  4H9P B;  4Z2M H;  3B6F C;  3C1C B;  5B33 B;  3REI D;  4J8V C;  1AOI A;  3MGS B;  3NQJ B;  5GT3 D;  5B31 G;  2FJ7 A;  4Z66 D;  5CPI B;  3MGQ B;  5AV8 B;  5B0Y A;  3NQU A;  3AZF C;  5B32 B;  5DNM C;  3WA9 C;  3B0D C;  4J8W C;  3VH6 W;  5GSU B;  1P3M C;  3W99 B;  4DRA A;  3LZ0 D;  4CAY B;  3C1B B;  5B40 B;  1N1J A;  5AVB C;  1KX3 D;  5E5A A;  1F66 D;  3AZF D;  3AZK D;  1P34 B;  5B0Z C;  3W97 B;  3MVD A;  3AZM B;  3WA9 D;  4XUJ A;  5AVC B;  5B31 A;  4H9O B;  3AZM C;  5DNM A;  3AZG B;  1F66 C;  1P3B A;  3VH6 A;  1TZY C;  3KUY A;  3X1T C;  3MNN A;  3AZH B;  3LZ1 D;  1P3L B;  3AV1 A;  1ZLA A;  1BH9 B;  2RVQ C;  1KU5 A;  3REL D;  1P3I B;  4YS3 D;  4H9S C;  5GXQ A;  4X23 A;  3X1T D;  5AV8 C;  1ZLA C;  3TU4 B;  4ZUX C;  5AV9 D;  5CPI D;  4YM6 C;  4J8X B;  3W99 C;  1P3M B;  5B40 C;  1P3F A;  4R8P A;  3AZJ A;  4J8X A;  3O62 D;  3LZ0 B;  5F99 B;  3MGP C;  3AZI C;  3V9R B;  4WU8 C;  1TAF A;  4Z66 C;  4WU8 B;  1TZY B;  3AZF A;  4Z66 A;  3MNN B;  3AZH A;  4J8W D;  5DNN D;  3KUY B;  3R45 B;  1P3L D;  5AVB D;  2PYO B;  3AN2 D;  3B6F A;  3AZM A;  4ZUX B;  2ARO A;  4Z2M G;  4LD9 B;  5JA4 B;  5DNN C;  4CSR B;  1M1A C;  1HTA A;  1M19 C;  4ZBJ B;  3C1B A;  5AV9 B;  5BT1 D;  5GSU A;  3X1U B;  5B24 D;  3B6F D;  3LZ1 C;  5GT3 B;  4H9S A;  1P3O B;  3KWQ D;  3KXB D;  5CPK B;  5B0Y B;  5AV8 A;  1P3O C;  4J8V B;  1KX5 B;  3AZN B;  1BFM A;  1M18 B;  3AYW B;  1ZLA D;  5GXQ C;  3MGS A;  1P3L A;  2HUE C;  1AOI B;  3AZF B;  4KUD A;  3REJ B;  1WWS A;  4XUJ C;  3W97 D;  4XZQ C;  4H9O A;  5BNV B;  4XUJ B;  4J8W B;  4Z5T D;  1TAF B;  3MGP D;  3AZK C;  3V9R A;  1KX4 B;  4CAY A;  3AZH D;  4KHA A;  4LD9 D;  3REK D;  1A7W A;  4R8P B;  3AZJ B;  3AZE D;  1P3F B;  2HIO D;  5FUG A;  1BH8 A;  4WU9 B;  3NQU B;  2JSS A;  4JJN B;  2YFV A;  4NFT A;  1U35 C;  3AZH C;  1BH8 B;  5GT0 C;  3MGS C;  2FJ7 D;  5B33 D;  1KX5 C;  3B0C W;  2CV5 B;  1P3B C;  5AV6 A;  3LJA C;  1P3I A;  1M18 D;  1ZLA B;  4H9P A;  4EO5 C;  3KWQ A;  5F99 D;  3C1B C;  5AV5 D;  3LZ0 C;  5CP6 C;  3AZG A;  2NZD B;  5AY8 B;  4KUD B;  3REH A;  4WNN A;  5B31 D;  3UT9 D;  2NZD C;  2BYK A;  3MGR C;  4YM6 A;  3MVD B;  4G92 B;  1P34 A;  1KX3 A;  1JFI A;  1P3P B;  5GT0 A;  3AFA B;  4KGC B;  5CPK A;  5GT3 A;  2HIO B;  3AFA C;  2F8N K;  2IO5 B;  4KGC C;  3LEL C;  5AV9 A;  3WTP D;  2FJ7 B;  4YS3 B;  3TU4 C;  4YM6 B;  1HQ3 A;  5B2I D;  1P3A B;  1P3G B;  3B6F B;  2PYO A;  3X1U C;  5B24 A;  3VH5 T;  5C3I C;  1EQZ B;  3O62 C;  4HGA C;  3B6G D;  3C1C C;  5GT0 D;  5DNM D;  4NE3 A;  3O62 B;  1U35 A;  3UTB D;  5CPK C;  5AV6 B;  5B1L B;  4H9R A;  3REJ D;  1P3P C;  5B0Z D;  5BO0 A;  2BYM B;  3MNN C;  1TZY D;  3MGQ D;  2IO5 C;  4JJN A;  5B2J A;  4Z5T A;  3AZM D;  3UTB A;  1S32 C;  3B0D B;  1KX4 D;  4Z5T C;  2ARO C;  5B0Z A;  5CHL B;  5DNN A;  2RVQ D;  4ZBJ C;  4AWL C;  3X1S A;  2F8N D;  1KX4 C;  4JJN C;  4AWL B;  5AV8 D;  3AZE C;  3AV2 B;  5KDM B;  2ARO D;  3AN2 C;  3REJ A;  1EQZ A;  4H9N B;  3KXB C;  3AV1 C;  1P3B B;  1Q9C A;  5JRG A;  1P3O D;  3X1S D;  3KXB B;  3X1T A;  3WKJ C;  1M18 A;  3W96 B;  4J8V A;  1P3A A;  4EO5 B;  1P3G A;  1HQ3 B;  5B24 C;  1AOI C;  3REH C;  3LZ1 A;  3AV1 D;  3X1V B;  1P3K B;  3WA9 B;  5CP6 B;  5BNX A;  3X1U A;  3WKJ D;  3W99 A;  5AVB B;  3AZL A;  5F99 C;  4X23 D;  5GXQ D;  3WA9 A;  3WAA D;  4LD9 A;  3AFA A;  4KGC A;  1P3P A;  4WV4 B;  3MGQ A;  5BO0 B;  5B1M A;  3KUY D;  3AZL D;  3KXB A;  3X1T B;  4WU9 C;  5BT1 C;  4H9Q B;  2L5A A;  3W98 C;  3MGS D;  2FJ7 C;  4YM6 D;  1TZY A;  3LEL D;  3KUY C;  4LD9 C;  5B2I A;  3LJA B;  3X1S B;  2CV5 D;  3W98 D;  5F99 A;  5B2I C;  3A6N D;  3UTA D;  1EQZ D;  1M1A B;  5GSU D;  5E5A C;  4YS3 A;  5CP6 D;  3WTP A;  5JRG C;  4DRB A;  2YFW B;  3B6G C;  1M18 C;  1EQZ C;  2BYM A;  2HIO A;  4J8U B;  5G49 B;  4KHA B;  4QLC A;  5CPK D;  5AV5 C;  1JFI B;  3REH D;  3UT9 A;  3O62 A;  5CPJ D;  3WAA A;  1S32 B;  3AFA D;  4KGC D;  3MGR D;  1F66 A;  4WNN B;  2PYO C;  4QLC D;  3MGP A;  2F8N B;  4XZQ A;  3KWQ B;  3LJA D;  1F66 B;  5B0Y D;  1M19 B;  3W97 A;  3AYW A;  5B2J C;  3KWQ C;  5E5A B;  3LEL A;  1ID3 A;  2NQB A;  3VH5 A;  5AY8 D;  4G91 B;  4R8P D;  3AZJ D;  1P3O A;  2F8N H;  5B0Y C;  3W98 A;  5GT0 B;  3C1B D;  5CPI A;  4XUJ D;  1ID3 D;  2NQB D;  5BS7 C;  2CV5 C;  3AZI A;  3WKJ B;  4CSR A;  1M19 A;  5B31 C;  2NZD D;  3MNN D;  2BYK B;  3C1C D;  4XZQ B;  5GSU C;  3REH B;  5B33 A;  3UTB C;  3REK B;  5CPJ B;  3MGR B;  3AZG C;  3AZN D;  3REK C;  4Z66 B;  4KUD C;  5CPJ A;  1P3G D;  1P3A D;  1WWI A;  1ULY A;  1R4V A;  3REL B;  3UT9 B;  3AZG D;  1KX3 C;  5AV5 A;  3X1U D;  3WKJ A;  5B1M B;  3TU4 D;  1KX5 A;  2YFW A;  2YFV B; 
#chains in the Genus database with same CATH topology
 4J8X D;  4J8V D;  3W98 B;  3X1S C;  3AYW D;  4WZS B;  1M1A A;  3A6N A;  3UTA A;  3TU4 A;  2Y2K A;  4J8X C;  1ID3 B;  2NQB B;  5C3I B;  5CP6 A;  3X1V A;  1P3K A;  3REI C;  3LZ1 B;  3A6N C;  3UTA C;  3VH5 W;  4HGA B;  5B2I B;  4UUZ A;  3LJA A;  4J8W A;  5AY8 C;  4WJ3 C;  1P3P D;  1BH9 A;  5AV6 D;  3MGP B;  3R45 A;  5B1L C;  5CPI C;  3H0R C;  3WAA C;  3B6G B;  3W99 D;  3WAA B;  5DNM B;  5KDM A;  5B40 D;  3WTP E;  3AV2 A;  1P3M D;  4J8U C;  3AZN A;  4WU9 D;  3WTP C;  3AZE A;  1W2E A;  2CWE A;  4JJN D;  5G49 A;  4QLC B;  3AZI D;  5DNN B;  5B0Z B;  3W97 C;  2UWX A;  4E45 A;  1H3O B;  4YS3 C;  3AZK A;  2FFF B;  1HQ3 D;  1P3A C;  5B2J B;  1P3G C;  5JA4 A;  2ARO B;  4ZUX A;  5AV9 C;  1P3L C;  2VQR A;  4X23 B;  5GT3 C;  5GXQ B;  5JRG B;  1AOI D;  4X23 C;  3REL A;  3AN2 B;  5B32 C;  3W96 C;  4ZUX D;  1KX5 D;  3AYW C;  3MGQ C;  3X1V D;  1P3K D;  3AN2 A;  3EPH A;  4WU8 A;  4H9Q A;  2Y2Q A;  3MGR A;  1P3B D;  3REK A;  1B6W A;  5B32 D;  1P34 C;  3VH6 T;  5CPJ C;  4NE5 A;  3LZ0 A;  3X1V C;  1P3K C;  5AVC C;  3B0B A;  3AZI B;  4WU8 D;  3AZL C;  3UTB B;  1P3M A;  5B40 A;  4Z5T B;  1H3O A;  3AZK B;  3AV2 D;  5B1L D;  1P34 D;  1P3F C;  3UT9 C;  5AVB A;  3AZL B;  5BNX B;  5B1M D;  5B2J D;  1P3I C;  4NE6 A;  3REL C;  2PYO D;  3AZE B;  3AV2 C;  1P3F D;  2F8N G;  4G91 C;  3W96 A;  3LEL B;  1U35 B;  3AV1 B;  2ZY5 A;  5B1M C;  3B6G A;  5JRG D;  1P3I D;  3REI A;  4H9N A;  2F8N A;  3C1C A;  5AY8 A;  1ID3 C;  2NQB C;  2NZD A;  1HQ3 C;  5B24 B;  5B31 B;  5AVC A;  3REI B;  4UUZ B;  1S32 A;  5B33 C;  2LY8 A;  3MVD C;  5B32 G;  1N1J B;  2ZY3 A;  4XZQ D;  3A6N B;  3UTA B;  3KSY A;  4J8U A;  5BS7 A;  3AZN C;  2CV5 A;  5AV6 C;  4G92 C;  1B67 A;  2F2A C;  5B32 A;  3MVD D;  3W96 D;  2HUE B;  3B0C T;  4WU9 A;  3WTP B;  1KX3 B;  5FUG B;  4QLC C;  3REJ C;  3NQJ A;  5AV5 B;  2HIO C;  4H9R B;  4J8U D;  5B1L A;  4KUD D;  1KX4 A;  4M6B A;  5AVC D;  3EG5 B;  1M1A D;  1F1E A;  1U35 D;  2JCH A;  1S32 D;  1M19 D;  5BNV A;  5E5A D;  4E44 A;  4R8P C;  3AZJ C;  4H9P B;  4Z2M H;  3B6F C;  3C1C B;  5B33 B;  3REI D;  4J8V C;  1AOI A;  3MGS B;  3NQJ B;  3P5J B;  5GT3 D;  2Y2N A;  5B31 G;  2FJ7 A;  4Z66 D;  5CPI B;  3MGQ B;  5AV8 B;  5B0Y A;  2W8S A;  3NQU A;  3AZF C;  5B32 B;  5DNM C;  3WA9 C;  3B0D C;  4J8W C;  3VH6 W;  5GSU B;  1P3M C;  3W99 B;  4DRA A;  3LZ0 D;  4CAY B;  3C1B B;  5B40 B;  1N1J A;  5AVB C;  1KX3 D;  5E5A A;  1F66 D;  3AZF D;  3AZK D;  1P34 B;  5B0Z C;  3W97 B;  3MVD A;  3AZM B;  3WA9 D;  4XUJ A;  5AVC B;  5B31 A;  4H9O B;  4DQY B;  3AZM C;  5DNM A;  3AZG B;  1F66 C;  1P3B A;  3VH6 A;  1TZY C;  3KUY A;  3X1T C;  3MNN A;  3AZH B;  3LZ1 D;  1P3L B;  3AV1 A;  1ZLA A;  1BH9 B;  2RVQ C;  1KU5 A;  3REL D;  1P3I B;  4YS3 D;  4H9S C;  5GXQ A;  4X23 A;  3X1T D;  5AV8 C;  1ZLA C;  2Y2G A;  3TU4 B;  4ZUX C;  5AV9 D;  5CPI D;  4YM6 C;  4J8X B;  2Y2L A;  3W99 C;  1P3M B;  5B40 C;  1P3F A;  4R8P A;  3AZJ A;  4J8X A;  3O62 D;  3LZ0 B;  2G5I C;  5F99 B;  3A1K A;  3MGP C;  3AZI C;  3V9R B;  4WU8 C;  1TAF A;  4Z66 C;  4WU8 B;  1TZY B;  3AZF A;  4Z66 A;  3AL0 C;  3MNN B;  3AZH A;  4J8W D;  5DNN D;  3KUY B;  3R45 B;  1P3L D;  5AVB D;  2PYO B;  3AN2 D;  3B6F A;  3AZM A;  4ZUX B;  2ARO A;  4Z2M G;  4LD9 B;  5JA4 B;  5DNN C;  4CSR B;  1M1A C;  1HTA A;  3IP4 C;  1M19 C;  4ZBJ B;  3C1B A;  5AV9 B;  5BT1 D;  2BG1 A;  2JE5 A;  5GSU A;  3X1U B;  5B24 D;  3B6F D;  3LZ1 C;  5GT3 B;  4H9S A;  1P3O B;  3KWQ D;  3KXB D;  3F6T A;  5CPK B;  5B0Y B;  5AV8 A;  1P3O C;  4J8V B;  1KX5 B;  3AZN B;  1BFM A;  1M18 B;  3AYW B;  1ZLA D;  5GXQ C;  3MGS A;  3A1I A;  1P3L A;  2HUE C;  1AOI B;  3AZF B;  4KUD A;  3REJ B;  1WWS A;  3H0L C;  4XUJ C;  4XZQ C;  3W97 D;  4H9O A;  5BNV B;  4XUJ B;  4J8W B;  4Z5T D;  1TAF B;  3MGP D;  3AZK C;  3V9R A;  1KX4 B;  4CAY A;  3AZH D;  4KHA A;  4LD9 D;  3REK D;  1A7W A;  4R8P B;  3AZJ B;  3AZE D;  1P3F B;  2HIO D;  5FUG A;  1BH8 A;  4WU9 B;  3NQU B;  2JSS A;  4JJN B;  2YFV A;  4NFT A;  1U35 C;  3AZH C;  1BH8 B;  5GT0 C;  3MGS C;  2FJ7 D;  5B33 D;  1KX5 C;  3B0C W;  2CV5 B;  2ZY2 A;  1P3B C;  5AV6 A;  1Z2C B;  3LJA C;  1P3I A;  1PZR A;  1M18 D;  1ZLA B;  4H9P A;  4EO5 C;  3KWQ A;  5F99 D;  3C1B C;  5AV5 D;  3LZ0 C;  5CP6 C;  3AZG A;  2NZD B;  5AY8 B;  4KUD B;  3REH A;  4WNN A;  5B31 D;  3UT9 D;  2NZD C;  2BYK A;  3MGR C;  4YM6 A;  3MVD B;  4G92 B;  1T3U A;  1P34 A;  1KX3 A;  1JFI A;  3H0M C;  5GT0 A;  1P3P B;  3AFA B;  4KGC B;  5CPK A;  5GT3 A;  2HIO B;  3AFA C;  2F8N K;  2IO5 B;  4KGC C;  3LEL C;  5AV9 A;  3WTP D;  2FJ7 B;  4YS3 B;  3TU4 C;  4YM6 B;  1HQ3 A;  5B2I D;  1P3A B;  1P3G B;  3B6F B;  2PYO A;  3X1U C;  5B24 A;  3VH5 T;  5C3I C;  1EQZ B;  3O62 C;  4HGA C;  3B6G D;  3C1C C;  5GT0 D;  5DNM D;  4NE3 A;  3O62 B;  1U35 A;  3UTB D;  5CPK C;  5AV6 B;  5B1L B;  4H9R A;  3REJ D;  1P3P C;  5B0Z D;  2Y2H A;  5BO0 A;  2BYM B;  3MNN C;  1TZY D;  3MGQ D;  2IO5 C;  4JJN A;  2ZM5 A;  5B2J A;  4Z5T A;  3AZM D;  3UTB A;  1S32 C;  3B0D B;  1KX4 D;  2Y2I A;  4Z5T C;  2ARO C;  5B0Z A;  2J8P A;  2Y2O A;  5CHL B;  5DNN A;  2RVQ D;  2G5H C;  4ZBJ C;  3EPK A;  3X1S A;  4AWL C;  2F8N D;  1KX4 C;  4UPK A;  4JJN C;  4AWL B;  5AV8 D;  3AZE C;  3AV2 B;  5KDM B;  2ARO D;  3AN2 C;  3REJ A;  1EQZ A;  4H9N B;  3KXB C;  3AV1 C;  1P3B B;  2DQN C;  1Q9C A;  5JRG A;  1P3O D;  3X1S D;  3KXB B;  3X1T A;  3WKJ C;  1M18 A;  3W96 B;  2XD1 A;  3EPJ A;  4J8V A;  1P3A A;  4EO5 B;  1P3G A;  1HQ3 B;  5B24 C;  1AOI C;  3REH C;  3LZ1 A;  3AV1 D;  3X1V B;  1P3K B;  3WA9 B;  5CP6 B;  5BNX A;  3X1U A;  3WKJ D;  3W99 A;  5AVB B;  3AZL A;  5F99 C;  4X23 D;  5GXQ D;  3WA9 A;  3WAA D;  4LD9 A;  3AFA A;  4KGC A;  1P3P A;  4WV4 B;  3MGQ A;  5BO0 B;  2Y2M A;  5B1M A;  3KUY D;  3AZL D;  3KXB A;  3X1T B;  4WU9 C;  5BT1 C;  4H9Q B;  2L5A A;  3W98 C;  3MGS D;  2FJ7 C;  4YM6 D;  1TZY A;  3LEL D;  3KUY C;  4LD9 C;  5B2I A;  3LJA B;  3X1S B;  2CV5 D;  3W98 D;  5F99 A;  5B2I C;  3KFU G;  3A6N D;  3UTA D;  1EQZ D;  1M1A B;  5GSU D;  2DF4 C;  5E5A C;  4YS3 A;  5CP6 D;  3WTP A;  5JRG C;  2RIQ A;  4DRB A;  2YFW B;  3B6G C;  1M18 C;  1EQZ C;  2BYM A;  2HIO A;  2XD5 A;  4J8U B;  5G49 B;  4KHA B;  4QLC A;  5CPK D;  5AV5 C;  1JFI B;  3REH D;  3UT9 A;  3O62 A;  5CPJ D;  3WAA A;  1S32 B;  3AFA D;  4KGC D;  3MGR D;  1F66 A;  4WNN B;  2PYO C;  4QLC D;  3MGP A;  3EPL A;  2F8N B;  4XZQ A;  3FDD A;  3KWQ B;  3LJA D;  1F66 B;  5B0Y D;  1M19 B;  3W97 A;  3AYW A;  5B2J C;  3KWQ C;  5E5A B;  3LEL A;  1ID3 A;  2NQB A;  3VH5 A;  5AY8 D;  4G91 B;  4R8P D;  2Y2P A;  3AZJ D;  1P3O A;  2F8N H;  5B0Y C;  3W98 A;  5GT0 B;  3C1B D;  2Y2J A;  5CPI A;  4XUJ D;  1ID3 D;  2NQB D;  5BS7 C;  2CV5 C;  3AZI A;  3WKJ B;  4CSR A;  1M19 A;  5B31 C;  2NZD D;  3MNN D;  2BYK B;  3C1C D;  4XZQ B;  5GSU C;  3REH B;  5B33 A;  2ZY4 A;  3UTB C;  3REK B;  5CPJ B;  3MGR B;  3AZG C;  3AZN D;  3REK C;  4Z66 B;  4KUD C;  5CPJ A;  1P3G D;  1P3A D;  1WWI A;  1ULY A;  1R4V A;  3REL B;  3UT9 B;  3AZG D;  1KX3 C;  5AV5 A;  3X1U D;  3WKJ A;  5B1M B;  3TU4 D;  1KX5 A;  2YFW A;  2YFV B; 
#chains in the Genus database with same CATH homology
 4J8X D;  4J8V D;  3W98 B;  3X1S C;  3AYW D;  4WZS B;  1M1A A;  3A6N A;  3UTA A;  3TU4 A;  2Y2K A;  4J8X C;  1ID3 B;  2NQB B;  5C3I B;  5CP6 A;  3X1V A;  1P3K A;  3REI C;  3LZ1 B;  3A6N C;  3UTA C;  3VH5 W;  4HGA B;  5B2I B;  4UUZ A;  3LJA A;  4J8W A;  5AY8 C;  4WJ3 C;  1P3P D;  1BH9 A;  5AV6 D;  3MGP B;  3R45 A;  5B1L C;  5CPI C;  3H0R C;  3WAA C;  3B6G B;  3W99 D;  3WAA B;  5DNM B;  5KDM A;  5B40 D;  3WTP E;  3AV2 A;  1P3M D;  4J8U C;  3AZN A;  4WU9 D;  3WTP C;  3AZE A;  1W2E A;  2CWE A;  4JJN D;  5G49 A;  4QLC B;  3AZI D;  5DNN B;  5B0Z B;  3W97 C;  2UWX A;  4E45 A;  1H3O B;  4YS3 C;  3AZK A;  2FFF B;  1HQ3 D;  1P3A C;  5B2J B;  1P3G C;  5JA4 A;  2ARO B;  4ZUX A;  5AV9 C;  1P3L C;  2VQR A;  4X23 B;  5GT3 C;  5GXQ B;  5JRG B;  1AOI D;  4X23 C;  3REL A;  3AN2 B;  5B32 C;  3W96 C;  4ZUX D;  1KX5 D;  3AYW C;  3MGQ C;  3X1V D;  1P3K D;  3AN2 A;  3EPH A;  4WU8 A;  4H9Q A;  2Y2Q A;  3MGR A;  1P3B D;  3REK A;  1B6W A;  5B32 D;  1P34 C;  3VH6 T;  5CPJ C;  4NE5 A;  3LZ0 A;  3X1V C;  1P3K C;  5AVC C;  3B0B A;  3AZI B;  4WU8 D;  3AZL C;  3UTB B;  1P3M A;  5B40 A;  4Z5T B;  1H3O A;  3AZK B;  3AV2 D;  5B1L D;  1P34 D;  1P3F C;  3UT9 C;  5AVB A;  3AZL B;  5BNX B;  5B1M D;  5B2J D;  1P3I C;  4NE6 A;  3REL C;  2PYO D;  3AZE B;  3AV2 C;  1P3F D;  2F8N G;  4G91 C;  3W96 A;  3LEL B;  1U35 B;  3AV1 B;  2ZY5 A;  5B1M C;  3B6G A;  5JRG D;  1P3I D;  3REI A;  4H9N A;  2F8N A;  3C1C A;  5AY8 A;  1ID3 C;  2NQB C;  2NZD A;  1HQ3 C;  5B24 B;  5B31 B;  5AVC A;  3REI B;  4UUZ B;  1S32 A;  5B33 C;  2LY8 A;  3MVD C;  5B32 G;  1N1J B;  2ZY3 A;  4XZQ D;  3A6N B;  3UTA B;  3KSY A;  4J8U A;  5BS7 A;  3AZN C;  2CV5 A;  5AV6 C;  4G92 C;  1B67 A;  2F2A C;  5B32 A;  3MVD D;  3W96 D;  2HUE B;  3B0C T;  4WU9 A;  3WTP B;  1KX3 B;  5FUG B;  4QLC C;  3REJ C;  3NQJ A;  5AV5 B;  2HIO C;  4H9R B;  4J8U D;  5B1L A;  4KUD D;  1KX4 A;  4M6B A;  5AVC D;  3EG5 B;  1M1A D;  1F1E A;  1U35 D;  2JCH A;  1S32 D;  1M19 D;  5BNV A;  5E5A D;  4E44 A;  4R8P C;  3AZJ C;  4H9P B;  4Z2M H;  3B6F C;  3C1C B;  5B33 B;  3REI D;  4J8V C;  1AOI A;  3MGS B;  3NQJ B;  3P5J B;  5GT3 D;  2Y2N A;  5B31 G;  2FJ7 A;  4Z66 D;  5CPI B;  3MGQ B;  5AV8 B;  5B0Y A;  2W8S A;  3NQU A;  3AZF C;  5B32 B;  5DNM C;  3WA9 C;  3B0D C;  4J8W C;  3VH6 W;  5GSU B;  1P3M C;  3W99 B;  4DRA A;  3LZ0 D;  4CAY B;  3C1B B;  5B40 B;  1N1J A;  5AVB C;  1KX3 D;  5E5A A;  1F66 D;  3AZF D;  3AZK D;  1P34 B;  5B0Z C;  3W97 B;  3MVD A;  3AZM B;  3WA9 D;  4XUJ A;  5AVC B;  5B31 A;  4H9O B;  4DQY B;  3AZM C;  5DNM A;  3AZG B;  1F66 C;  1P3B A;  3VH6 A;  1TZY C;  3KUY A;  3X1T C;  3MNN A;  3AZH B;  3LZ1 D;  1P3L B;  3AV1 A;  1ZLA A;  1BH9 B;  2RVQ C;  1KU5 A;  3REL D;  1P3I B;  4YS3 D;  4H9S C;  5GXQ A;  4X23 A;  3X1T D;  5AV8 C;  1ZLA C;  2Y2G A;  3TU4 B;  4ZUX C;  5AV9 D;  5CPI D;  4YM6 C;  4J8X B;  2Y2L A;  3W99 C;  1P3M B;  5B40 C;  1P3F A;  4R8P A;  3AZJ A;  4J8X A;  3O62 D;  3LZ0 B;  2G5I C;  5F99 B;  3A1K A;  3MGP C;  3AZI C;  3V9R B;  4WU8 C;  1TAF A;  4Z66 C;  4WU8 B;  1TZY B;  3AZF A;  4Z66 A;  3AL0 C;  3MNN B;  3AZH A;  4J8W D;  5DNN D;  3KUY B;  3R45 B;  1P3L D;  5AVB D;  2PYO B;  3AN2 D;  3B6F A;  3AZM A;  4ZUX B;  2ARO A;  4Z2M G;  4LD9 B;  5JA4 B;  5DNN C;  4CSR B;  1M1A C;  1HTA A;  3IP4 C;  1M19 C;  4ZBJ B;  3C1B A;  5AV9 B;  5BT1 D;  2BG1 A;  2JE5 A;  5GSU A;  3X1U B;  5B24 D;  3B6F D;  3LZ1 C;  5GT3 B;  4H9S A;  1P3O B;  3KWQ D;  3KXB D;  3F6T A;  5CPK B;  5B0Y B;  5AV8 A;  1P3O C;  4J8V B;  1KX5 B;  3AZN B;  1BFM A;  1M18 B;  3AYW B;  1ZLA D;  5GXQ C;  3MGS A;  3A1I A;  1P3L A;  2HUE C;  1AOI B;  3AZF B;  4KUD A;  3REJ B;  1WWS A;  3H0L C;  4XUJ C;  4XZQ C;  3W97 D;  4H9O A;  5BNV B;  4XUJ B;  4J8W B;  4Z5T D;  1TAF B;  3MGP D;  3AZK C;  3V9R A;  1KX4 B;  4CAY A;  3AZH D;  4KHA A;  4LD9 D;  3REK D;  1A7W A;  4R8P B;  3AZJ B;  3AZE D;  1P3F B;  2HIO D;  5FUG A;  1BH8 A;  4WU9 B;  3NQU B;  2JSS A;  4JJN B;  2YFV A;  4NFT A;  1U35 C;  3AZH C;  1BH8 B;  5GT0 C;  3MGS C;  2FJ7 D;  5B33 D;  1KX5 C;  3B0C W;  2CV5 B;  2ZY2 A;  1P3B C;  5AV6 A;  1Z2C B;  3LJA C;  1P3I A;  1PZR A;  1M18 D;  1ZLA B;  4H9P A;  4EO5 C;  3KWQ A;  5F99 D;  3C1B C;  5AV5 D;  3LZ0 C;  5CP6 C;  3AZG A;  2NZD B;  5AY8 B;  4KUD B;  3REH A;  4WNN A;  5B31 D;  3UT9 D;  2NZD C;  2BYK A;  3MGR C;  4YM6 A;  3MVD B;  4G92 B;  1T3U A;  1P34 A;  1KX3 A;  1JFI A;  3H0M C;  5GT0 A;  1P3P B;  3AFA B;  4KGC B;  5CPK A;  5GT3 A;  2HIO B;  3AFA C;  2F8N K;  2IO5 B;  4KGC C;  3LEL C;  5AV9 A;  3WTP D;  2FJ7 B;  4YS3 B;  3TU4 C;  4YM6 B;  1HQ3 A;  5B2I D;  1P3A B;  1P3G B;  3B6F B;  2PYO A;  3X1U C;  5B24 A;  3VH5 T;  5C3I C;  1EQZ B;  3O62 C;  4HGA C;  3B6G D;  3C1C C;  5GT0 D;  5DNM D;  4NE3 A;  3O62 B;  1U35 A;  3UTB D;  5CPK C;  5AV6 B;  5B1L B;  4H9R A;  3REJ D;  1P3P C;  5B0Z D;  2Y2H A;  5BO0 A;  2BYM B;  3MNN C;  1TZY D;  3MGQ D;  2IO5 C;  4JJN A;  2ZM5 A;  5B2J A;  4Z5T A;  3AZM D;  3UTB A;  1S32 C;  3B0D B;  1KX4 D;  2Y2I A;  4Z5T C;  2ARO C;  5B0Z A;  2J8P A;  2Y2O A;  5CHL B;  5DNN A;  2RVQ D;  2G5H C;  4ZBJ C;  3EPK A;  3X1S A;  4AWL C;  2F8N D;  1KX4 C;  4UPK A;  4JJN C;  4AWL B;  5AV8 D;  3AZE C;  3AV2 B;  5KDM B;  2ARO D;  3AN2 C;  3REJ A;  1EQZ A;  4H9N B;  3KXB C;  3AV1 C;  1P3B B;  2DQN C;  1Q9C A;  5JRG A;  1P3O D;  3X1S D;  3KXB B;  3X1T A;  3WKJ C;  1M18 A;  3W96 B;  2XD1 A;  3EPJ A;  4J8V A;  1P3A A;  4EO5 B;  1P3G A;  1HQ3 B;  5B24 C;  1AOI C;  3REH C;  3LZ1 A;  3AV1 D;  3X1V B;  1P3K B;  3WA9 B;  5CP6 B;  5BNX A;  3X1U A;  3WKJ D;  3W99 A;  5AVB B;  3AZL A;  5F99 C;  4X23 D;  5GXQ D;  3WA9 A;  3WAA D;  4LD9 A;  3AFA A;  4KGC A;  1P3P A;  4WV4 B;  3MGQ A;  5BO0 B;  2Y2M A;  5B1M A;  3KUY D;  3AZL D;  3KXB A;  3X1T B;  4WU9 C;  5BT1 C;  4H9Q B;  2L5A A;  3W98 C;  3MGS D;  2FJ7 C;  4YM6 D;  1TZY A;  3LEL D;  3KUY C;  4LD9 C;  5B2I A;  3LJA B;  3X1S B;  2CV5 D;  3W98 D;  5F99 A;  5B2I C;  3KFU G;  3A6N D;  3UTA D;  1EQZ D;  1M1A B;  5GSU D;  2DF4 C;  5E5A C;  4YS3 A;  5CP6 D;  3WTP A;  5JRG C;  2RIQ A;  4DRB A;  2YFW B;  3B6G C;  1M18 C;  1EQZ C;  2BYM A;  2HIO A;  2XD5 A;  4J8U B;  5G49 B;  4KHA B;  4QLC A;  5CPK D;  5AV5 C;  1JFI B;  3REH D;  3UT9 A;  3O62 A;  5CPJ D;  3WAA A;  1S32 B;  3AFA D;  4KGC D;  3MGR D;  1F66 A;  4WNN B;  2PYO C;  4QLC D;  3MGP A;  3EPL A;  2F8N B;  4XZQ A;  3FDD A;  3KWQ B;  3LJA D;  1F66 B;  5B0Y D;  1M19 B;  3W97 A;  3AYW A;  5B2J C;  3KWQ C;  5E5A B;  3LEL A;  1ID3 A;  2NQB A;  3VH5 A;  5AY8 D;  4G91 B;  4R8P D;  2Y2P A;  3AZJ D;  1P3O A;  2F8N H;  5B0Y C;  3W98 A;  5GT0 B;  3C1B D;  2Y2J A;  5CPI A;  4XUJ D;  1ID3 D;  2NQB D;  5BS7 C;  2CV5 C;  3AZI A;  3WKJ B;  4CSR A;  1M19 A;  5B31 C;  2NZD D;  3MNN D;  2BYK B;  3C1C D;  4XZQ B;  5GSU C;  3REH B;  5B33 A;  2ZY4 A;  3UTB C;  3REK B;  5CPJ B;  3MGR B;  3AZG C;  3AZN D;  3REK C;  4Z66 B;  4KUD C;  5CPJ A;  1P3G D;  1P3A D;  1WWI A;  1ULY A;  1R4V A;  3REL B;  3UT9 B;  3AZG D;  1KX3 C;  5AV5 A;  3X1U D;  3WKJ A;  5B1M B;  3TU4 D;  1KX5 A;  2YFW A;  2YFV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...