3AYWB

Crystal structure of human nucleosome core particle containing h3k56q mutation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
molecule keywords Histone H3.1
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aywB00
5F99D 4J8XA 3WA9B 1ZLAC 3W99C 2BYKB 5CP6C 5GXQD 3KWQA 3AZMB 5GT3B 5CPJB 4CAYB 1P3BD 3MGPB 1KX4C 3O62B 5JRGC 4X23A 4JJNA 1F66A 3MNNB 3REID 3X1SD 5B32B 4M6BA 4UUZA 3WTPB 3AZJA 4NE5A 1P3PB 3AZHD 1P3OB 1M18C 3MVDA 1P34A 5CPIB 5BNXB 5CPKA 5AV6D 4J8XC 3KWQC 3X1VB 1P3GC 1P3ID 3LELA 3WAAC 4LD9D 3REHD 3AZKB 4JJNC 1R4VA 1KX5D 3W96D 3KUYB 3UT9D 3AZIC 4KHAB 3W97A 3AZNA 2AROA 1BH8A 4NE3A 5B31A 3A6NB 3AZEA 4H9PA 3WA9D 3B6FA 5CPJD 5CPKC 3VH5A 5GT3D 3MGPD 3O62D 5AV9A 2FJ7B 5B24C 3MNND 5B32D 1S32B 4NE6A 4H9NA 4E44A 5KDMB 1P3PD 1P3OD 4AWLB 5AY8A 5B32G 4KUDA 5CPID 3AZGA 3LZ1A 3AZFB 5B31C 3AN2C 3AZEC 5F99A 1M1AB 1Q9CA 3VH5T 3R45A 5GXQA 3X1VD 1P3BA 5B1MC 1HQ3C 3B0DC 3AZKD 3C1CC 3REIA 3X1SA 4ZBJB 3REKB 5B33B 3KXBB 2NQBD 4EO5C 3AZHA 1ID3B 3A6ND 1P3FB 3C1BC 3LJAC 5AV6A 1H3OB 5B40C 5AVCB 3X1UB 2FJ7D 5GXQC 1P3BC 1P3IA 4Z5TD 4LD9A 3REHA 1S32D 1P3AB 3WKJB 1P3LB 3REIC 1KX5A 3W96A 4WV4B 3UT9A 5G49B 5GT0B 2YFVB 5B0ZA 3AZHC 1TZYB 1KX3B 4Z2MG 3WA9A 1M1AD 2NZDC 3AV2B 5CPJA 3AZMA 5GT3A 4CAYA 3MGPA 3O62A 5B0YB 3AZJD 1M19C 3MNNA 4R8PC 1B6WA 5B32A 4LD9C 3REKD 3MVDD 3KXBD 3WTPA 1P3PA 3UTBB 4HGAC 1KX5C 1P3OA 3UT9C 3AZLD 1ID3D 2YFWB 1P3FD 5CPIA 5BNXA 2RVQD 5AVCD 4ZUXB 3X1UD 5CPJC 3X1VA 5GT3C 5E5AB 4J8VB 3AZKA 1P3AD 2F8NK 5B32C 3KUYA 3UTAB 3B0CW 2AROD 1P3PC 4CSRB 3B6GB 3REJB 4KHAA 4YS3B 3B6FD 1KX3D 4H9QA 3A6NA 3W98B 4XUJB 2BYMB 3MGSC 3RELD 1JFIB 3X1TB 5DNMB 2FJ7A 5B0YD 3X1VC 1P3KB 2HUEC 4Z5TA 2IO5C 4XZQD 3AZKC 1S32A 5KDMA 3UTBD 4Z66B 4KUDD 3AZGD 2NQBC 1TAFB 2HIOB 4J8UB 3AZFA 4WU8B 1M1AA 5E5AD 4J8VD 4WU9B 4Z5TC 1P3MC 3REKA 1S32C 3MGQD 5B33A 3KXBA 5AV8B 3UTAD 1EQZC 3B6GD 5GSUD 3REJD 3AFAB 4KGCC 4YS3D 3AZLA 1ID3A 2PYOB 3AV1B 1P3FA 1U35B 3W98D 4XUJD 5AVBB 1H3OA 5AVCA 4E45A 4X23C 3X1UA 5DNMD 5B2JB 3MGRB 1F66C 1P3KD 3WKJA 1P3AA 3AZJC 1P3LA 5B0ZD 4Z66D 1B67A 3MVDC 1P34C 5G49A 5GT0A 2YFVA 1KU5A 3AZMD 3AZLC 3AYWB 1KX3A 1ID3C 5DNNB 5AV5B 4WU8D 1WWSA 1AOIB 5BNVB 3AV2A 3RELA 3LELC 4QLCB 2RVQC 4G91C 5JA4B 3X1UC 5B0YA 3WTPD 4J8WB 4XZQA 1P3AC 5AV8D 3UTBA 3W97C 3AZNC 2AROC 4G92C 2YFWA 3AV1D 5CP6B 1ZLAB 3W99B 3B6FC 2CV5B 5AVBD 4ZUXA 5AV9C 3MGRD 5B2JD 3RELC 5E5AA 4J8VA 3KUYD 2CWEA 1M18B 4XZQC 5AY8C 3MGQA 3UTAA 3B6GA 4CSRA 5CHLB 5GSUA 3REJA 4KUDC 3AZGC 4YS3A 3LZ1C 3AYWD 5DNND 5F99C 5AV5D 3W98A 1AOID 4XUJA 1P3GB 2BYMA 1JFIA 3WAAB 4QLCD 3X1TA 4JJNB 5C3IC 5DNMA 3X1SC 1P3KA 4H9SA 4J8WD 4J8VC 5BT1D 3AZIB 4Z66A 3MGQC 3NQJA 3UTAC 3AZFD 5GSUC 1TAFA 1ZLAD 3W99D 5CP6D 3VH5W 4YS3C 2BYKA 2HIOA 4J8UA 2CV5D 5AV6C 1N1JB 4WU8A 5B24B 4XUJC 1P3IC 3REHC 5B33D 4WU9A 5DNMC 4H9SC 3TU4B 1M18D 3W96C 4DRAA 5AV8A 5B0ZC 3AFAA 3AN2B 1BH8B 3AZEB 2PYOA 3AV1A 1U35A 3WA9C 3AZMC 5B1MB 5AVBA 1HQ3B 3MGPC 3WAAD 3B0DB 5B1LB 3O62C 3C1CB 3WKJD 3MGRA 5B2JA 3MNNC 1P3LD 3LZ0B 4EO5B 3WTPC 4DRBA 3VH6W 5GT0D 1P3OC 1TZYD 3C1BB 1BFMA 5CPIC 3LJAB 3AV2D 3AYWA 5B40B 5DNNA 5AV5A 2L5AA 4H9RB 4NFTA 5B24D 1AOIA 3R45B 5BNVA 5AVBC 4QLCA 5JA4A 4J8WA 3TU4D 3KUYC 5B2IB 3AZHB 4YM6B 3AN2D 3A6NC 1ZLAA 2LY8A 5CP6A 4ZUXD 3W99A 2NZDB 3AYWC 5B1MD 2CV5A 1HQ3D 5B1LD 1M19B 3C1CD 2FJ7C 4R8PB 4QLCC 3LZ0D 4HGAB 4WNNB 5BO0B 1M18A 4J8WC 5BT1C 4AWLC 3NQUB 1ULYA 3AZFC 3X1TD 1M1AC 1P3GA 2CV5C 3WAAA 2F8NB 4ZBJC 3REKC 5B33C 3KXBC 5B2ID 3AZIA 4YM6D 1TZYA 2HIOD 4WZSB 4J8UD 1F1EA 1P3FC 2NZDD 5FUGB 3MGSB 1BH9B 1N1JA 4H9OB 5AVCC 3V9RB 5B24A 4WU9D 1M19D 2HUEB 2IO5B 4R8PD 2F8NH 3WKJC 1P3LC 3TU4A 3AFAD 2NQBB 2PYOD 5GT0C 1U35D 1TZYC 5BS7A 1KX3C 4H9QB 3AN2A 1KX4B 5JRGB 3AV2C 5B1MA 1HQ3A 5B1LA 2F8ND 3C1CA 5B0YC 4Z5TB 1P3MB 3LZ0A 1EQZB 2F8NG 3UTBC 4KGCB 3TU4C 4J8XB 3KWQB 3C1BA 3LJAA 5BS7C 3MGSD 5B40A 4X23B 4H9RA 4ZUXC 1F66B 5E5AC 5B1LC 4UUZB 3AZJB 3B0BA 3LZ0C 3MVDB 1P34B 3B6GC 5B2IA 3REJC 4Z2MH 4YM6A 3VH6A 3AZLB 5CPKB 1KX4D 5JRGD 2JSSA 3W98C 2NZDA 3LELB 4G91B 3X1TC 1M19A 1P3KC 4R8PA 1P3MD 1EQZD 4WNNA 5BO0A 3W97B 4Z66C 3AZNB 4KGCD 2AROB 5B31B 4G92B 3B0CT 5B2IC 4H9PB 4J8XD 3VH6T 4YM6C 3NQUA 3KWQD 3B6FB 2HIOC 1P3GD 4J8UC 4WU8C 5AV9B 4X23D 4JJND 1F66D 3RELB 3WTPE 2F8NA 4H9NB 4WU9C 4XZQB 3AZID 5AY8B 1P34D 5AV8C 1WWIA 4KUDB 3AZGB 3AFAC 3LZ1B 5CPKD 5F99B 2PYOC 3AV1C 1U35C 1A7WA 5GXQB 1P3BB 5FUGA 3MGSA 1BH9A 3LELD 5C3IB 4H9OA 1HTAA 3V9RA 3REIB 3MGRC 5B2JC 3X1SB 3W97D 3MGQB 3AZND 2NQBA 5B31D 5GSUB 3AZED 5AV6B 1KX4A 5DNNC 5JRGA 5AV5C 5B31G 5AV9D 1AOIC 1P3IB 4LD9B 3REHB 3KSYA 1KX5B 3W96B 1P3MA 3UT9B 5AY8D 1EQZA 5B0ZB 3C1BD 4KGCA 3LJAD 3NQJB 3LZ1D 5B40D
chains in the Genus database with same CATH superfamily
5F99D 4J8XA 3WA9B 2Y2IA 3W99C 2BYKB 5CP6C 5GXQD 3KWQA 3AZMB 5GT3B 5CPJB 4CAYB 2Y2JA 2JCHA 3MGPB 3O62B 1P3BD 5JRGC 1KX4C 4X23A 4JJNA 1F66A 3MNNB 3REID 3X1SD 5B32B 4M6BA 4UUZA 3WTPB 3AZJA 4NE5A 1P3PB 3AZHD 1P3OB 1M18C 3MVDA 1P34A 2RIQA 2J8PA 5CPIB 5BNXB 5CPKA 5AV6D 4J8XC 3KWQC 3X1VB 1P3GC 1P3ID 3LELA 3WAAC 4LD9D 3REHD 3AZKB 4JJNC 1R4VA 1KX5D 1PZRA 3W96D 3KUYB 3UT9D 3AZIC 4KHAB 3W97A 3AZNA 2AROA 1BH8A 2VQRA 4NE3A 5B31A 3A6NB 3AZEA 4H9PA 3WA9D 3B6FA 5CPJD 5CPKC 3VH5A 5GT3D 3EPHA 3MGPD 3O62D 5AV9A 2FJ7B 5B24C 3MNND 5B32D 1S32B 4NE6A 4H9NA 4E44A 5KDMB 1P3PD 1P3OD 4AWLB 5AY8A 4DQYB 5B32G 4KUDA 5CPID 3AZGA 3LZ1A 3AZFB 5B31C 3AN2C 2ZM5A 3AZEC 5F99A 1M1AB 3H0LC 1Q9CA 3VH5T 3R45A 5GXQA 3X1VD 1P3BA 5B1MC 1HQ3C 3B0DC 3AZKD 3C1CC 3REIA 3X1SA 4ZBJB 3REKB 5B33B 3KXBB 2NQBD 4EO5C 3AZHA 1ID3B 3A6ND 1P3FB 3C1BC 3LJAC 5AV6A 1H3OB 5B40C 5AVCB 3X1UB 2FJ7D 5GXQC 1P3BC 1P3IA 4Z5TD 4LD9A 3REHA 1S32D 1P3AB 3WKJB 1P3LB 3REIC 1KX5A 3W96A 4WV4B 3UT9A 5G49B 5GT0B 2YFVB 5B0ZA 3AZHC 1TZYB 1KX3B 1Z2CB 4Z2MG 3WA9A 1M1AD 2NZDC 3AV2B 5CPJA 3AZMA 5GT3A 4CAYA 3MGPA 3O62A 5B0YB 3AZJD 1M19C 3MNNA 4R8PC 1B6WA 5B32A 4LD9C 3REKD 3MVDD 3KXBD 3WTPA 1P3PA 3UTBB 4HGAC 1KX5C 1P3OA 3UT9C 3AZLD 1ID3D 2YFWB 3A1KA 1P3FD 5CPIA 5BNXA 2RVQD 4ZUXB 5AVCD 3X1UD 5CPJC 3X1VA 5GT3C 5E5AB 4J8VB 3AZKA 1P3AD 3AL0C 2F8NK 5B32C 3KUYA 3UTAB 3B0CW 2AROD 1P3PC 4CSRB 3B6GB 3REJB 4KHAA 4YS3B 3B6FD 1KX3D 4H9QA 3A6NA 3W98B 3H0RC 4XUJB 2BYMB 3MGSC 3RELD 1JFIB 3X1TB 5DNMB 2FJ7A 5B0YD 3X1VC 1P3KB 2HUEC 4Z5TA 2IO5C 4XZQD 3AZKC 1S32A 5KDMA 3UTBD 4Z66B 4KUDD 3AZGD 2NQBC 1TAFB 2HIOB 4J8UB 3AZFA 4WU8B 1M1AA 3EG5B 5E5AD 4J8VD 4WU9B 4Z5TC 1P3MC 3REKA 1S32C 3MGQD 5B33A 3KXBA 5AV8B 3UTAD 1EQZC 3B6GD 5GSUD 3REJD 3AFAB 4KGCC 4YS3D 3AZLA 1ID3A 2PYOB 3AV1B 1P3FA 1U35B 3W98D 4XUJD 5AVBB 1H3OA 2UWXA 3KFUG 5AVCA 4E45A 4X23C 3X1UA 5DNMD 5B2JB 3MGRB 1F66C 1P3KD 3WKJA 1P3AA 3AZJC 1P3LA 5B0ZD 4Z66D 1B67A 3MVDC 1P34C 5G49A 5GT0A 2YFVA 1KU5A 3AZMD 3AZLC 3AYWB 1KX3A 1ID3C 5DNNB 5AV5B 4WU8D 1WWSA 1AOIB 5BNVB 3AV2A 3RELA 3LELC 4QLCB 2RVQC 4G91C 5JA4B 3X1UC 5B0YA 3WTPD 4J8WB 4XZQA 1P3AC 5AV8D 2ZY2A 3UTBA 3W97C 3AZNC 2Y2KA 2AROC 4G92C 2YFWA 1T3UA 2Y2PA 3AV1D 5CP6B 1ZLAB 3W99B 3B6FC 2CV5B 5AVBD 4ZUXA 5AV9C 3MGRD 3IP4C 5B2JD 3RELC 5E5AA 4J8VA 3KUYD 2CWEA 1M18B 4XZQC 5AY8C 3MGQA 3UTAA 3B6GA 4CSRA 2ZY3A 5CHLB 5GSUA 3REJA 4KUDC 3AZGC 4YS3A 3LZ1C 3AYWD 5DNND 5F99C 5AV5D 3W98A 1AOID 4XUJA 1P3GB 2BYMA 1JFIA 3WAAB 4QLCD 3X1TA 4JJNB 2FFFB 5C3IC 5DNMA 1W2EA 3X1SC 1P3KA 4H9SA 4J8WD 4J8VC 5BT1D 3AZIB 4Z66A 3MGQC 3NQJA 3UTAC 2BG1A 3AZFD 5GSUC 1TAFA 1ZLAD 5CP6D 3VH5W 2ZY4A 3W99D 2BYKA 2HIOA 2Y2QA 4YS3C 4J8UA 2CV5D 5AV6C 1N1JB 4WU8A 5B24B 4XUJC 1P3IC 3REHC 5B33D 4WU9A 5DNMC 4H9SC 3TU4B 1M18D 3W96C 4DRAA 5AV8A 2Y2MA 2W8SA 5B0ZC 3AFAA 3AN2B 1BH8B 3AZEB 2PYOA 3AV1A 4WJ3C 1U35A 3WA9C 3AZMC 5B1MB 5AVBA 1HQ3B 3MGPC 3WAAD 3B0DB 5B1LB 3O62C 3C1CB 3WKJD 1ZLAC 3MGRA 2G5IC 5B2JA 3MNNC 1P3LD 3LZ0B 2DF4C 4EO5B 3WTPC 4DRBA 3VH6W 5GT0D 1P3OC 1TZYD 3F6TA 3C1BB 1BFMA 5CPIC 3LJAB 3AV2D 3AYWA 5B40B 5DNNA 5AV5A 2L5AA 4H9RB 4NFTA 5B24D 2DQNC 3R45B 5BNVA 1AOIA 5AVBC 4QLCA 5JA4A 4J8WA 3TU4D 3KUYC 5B2IB 3AZHB 4YM6B 3AN2D 3A6NC 1ZLAA 2LY8A 5CP6A 4ZUXD 3W99A 2NZDB 3AYWC 5B1MD 2CV5A 1HQ3D 5B1LD 1M19B 3C1CD 2FJ7C 2G5HC 4R8PB 4QLCC 3LZ0D 4HGAB 4WNNB 5BO0B 1M18A 4J8WC 5BT1C 4AWLC 3NQUB 1ULYA 3EPLA 3AZFC 3X1TD 2F2AC 1M1AC 1P3GA 2CV5C 3WAAA 2F8NB 4ZBJC 3REKC 5B33C 3FDDA 3KXBC 5B2ID 3AZIA 4UPKA 4YM6D 1TZYA 2HIOD 4WZSB 4J8UD 1F1EA 1P3FC 2NZDD 2Y2LA 5FUGB 3MGSB 1BH9B 2Y2NA 1N1JA 4H9OB 5AVCC 3V9RB 5B24A 4WU9D 1M19D 2HUEB 2IO5B 4R8PD 2F8NH 3WKJC 1P3LC 3TU4A 3AFAD 2NQBB 2PYOD 5GT0C 1U35D 1TZYC 5BS7A 1KX3C 4H9QB 3AN2A 1KX4B 5JRGB 3AV2C 5B1MA 1HQ3A 3EPJA 5B1LA 2F8ND 3C1CA 5B0YC 4Z5TB 1P3MB 3LZ0A 2Y2OA 1EQZB 2F8NG 3UTBC 4KGCB 3TU4C 4J8XB 3KWQB 3C1BA 3LJAA 5BS7C 3MGSD 5B40A 4X23B 4H9RA 4ZUXC 1F66B 5E5AC 5B1LC 4UUZB 3AZJB 3B0BA 3LZ0C 3MVDB 1P34B 3B6GC 5B2IA 3REJC 2JE5A 4Z2MH 4YM6A 3VH6A 3AZLB 5CPKB 1KX4D 5JRGD 2JSSA 3W98C 2NZDA 3LELB 4G91B 3X1TC 1M19A 1P3KC 4R8PA 1P3MD 1EQZD 4WNNA 5BO0A 3W97B 4Z66C 3AZNB 4KGCD 2AROB 5B31B 4G92B 3B0CT 5B2IC 4H9PB 4J8XD 3VH6T 4YM6C 3NQUA 3KWQD 3B6FB 2HIOC 1P3GD 4J8UC 2XD5A 4WU8C 5AV9B 4X23D 4JJND 1F66D 3RELB 3WTPE 2F8NA 3P5JB 4H9NB 4WU9C 4XZQB 3AZID 5AY8B 1P34D 5AV8C 1WWIA 4KUDB 3AZGB 3AFAC 3LZ1B 5CPKD 2Y2HA 5F99B 2PYOC 3AV1C 1U35C 1A7WA 5GXQB 1P3BB 5FUGA 3MGSA 1BH9A 3LELD 2XD1A 5C3IB 1HTAA 4H9OA 3V9RA 3REIB 3MGRC 5B2JC 3X1SB 3EPKA 3W97D 3MGQB 3AZND 2NQBA 5B31D 5GSUB 3AZED 3H0MC 2Y2GA 5AV6B 1KX4A 5DNNC 5JRGA 5AV5C 5B31G 5AV9D 2ZY5A 1AOIC 3A1IA 1P3IB 4LD9B 3REHB 3KSYA 1KX5B 3W96B 1P3MA 3UT9B 5AY8D 1EQZA 5B0ZB 3C1BD 4KGCA 3LJAD 3NQJB 3LZ1D 5B40D
chains in the Genus database with same CATH topology
5F99D 4J8XA 3WA9B 2Y2IA 3W99C 2BYKB 5CP6C 5GXQD 3KWQA 3AZMB 5GT3B 5CPJB 4CAYB 2Y2JA 2JCHA 3MGPB 3O62B 1P3BD 5JRGC 1KX4C 4X23A 4JJNA 1F66A 3MNNB 3REID 3X1SD 5B32B 4M6BA 4UUZA 3WTPB 3AZJA 4NE5A 1P3PB 3AZHD 1P3OB 1M18C 3MVDA 1P34A 2RIQA 2J8PA 5CPIB 5BNXB 5CPKA 5AV6D 4J8XC 3KWQC 3X1VB 1P3GC 1P3ID 3LELA 3WAAC 4LD9D 3REHD 3AZKB 4JJNC 1R4VA 1KX5D 1PZRA 3W96D 3KUYB 3UT9D 3AZIC 4KHAB 3W97A 3AZNA 2AROA 1BH8A 2VQRA 4NE3A 5B31A 3A6NB 3AZEA 4H9PA 3WA9D 3B6FA 5CPJD 5CPKC 3VH5A 5GT3D 3EPHA 3MGPD 3O62D 5AV9A 2FJ7B 5B24C 3MNND 5B32D 1S32B 4NE6A 4H9NA 4E44A 5KDMB 1P3PD 1P3OD 4AWLB 5AY8A 4DQYB 5B32G 4KUDA 5CPID 3AZGA 3LZ1A 3AZFB 5B31C 3AN2C 2ZM5A 3AZEC 5F99A 1M1AB 3H0LC 1Q9CA 3VH5T 3R45A 5GXQA 3X1VD 1P3BA 5B1MC 1HQ3C 3B0DC 3AZKD 3C1CC 3REIA 3X1SA 4ZBJB 3REKB 5B33B 3KXBB 2NQBD 4EO5C 3AZHA 1ID3B 3A6ND 1P3FB 3C1BC 3LJAC 5AV6A 1H3OB 5B40C 5AVCB 3X1UB 2FJ7D 5GXQC 1P3BC 1P3IA 4Z5TD 4LD9A 3REHA 1S32D 1P3AB 3WKJB 1P3LB 3REIC 1KX5A 3W96A 4WV4B 3UT9A 5G49B 5GT0B 2YFVB 5B0ZA 3AZHC 1TZYB 1KX3B 1Z2CB 4Z2MG 3WA9A 1M1AD 2NZDC 3AV2B 5CPJA 3AZMA 5GT3A 4CAYA 3MGPA 3O62A 5B0YB 3AZJD 1M19C 3MNNA 4R8PC 1B6WA 5B32A 4LD9C 3REKD 3MVDD 3KXBD 3WTPA 1P3PA 3UTBB 4HGAC 1KX5C 1P3OA 3UT9C 3AZLD 1ID3D 2YFWB 3A1KA 1P3FD 5CPIA 5BNXA 2RVQD 4ZUXB 5AVCD 3X1UD 5CPJC 3X1VA 5GT3C 5E5AB 4J8VB 3AZKA 1P3AD 3AL0C 2F8NK 5B32C 3KUYA 3UTAB 3B0CW 2AROD 1P3PC 4CSRB 3B6GB 3REJB 4KHAA 4YS3B 3B6FD 1KX3D 4H9QA 3A6NA 3W98B 3H0RC 4XUJB 2BYMB 3MGSC 3RELD 1JFIB 3X1TB 5DNMB 2FJ7A 5B0YD 3X1VC 1P3KB 2HUEC 4Z5TA 2IO5C 4XZQD 3AZKC 1S32A 5KDMA 3UTBD 4Z66B 4KUDD 3AZGD 2NQBC 1TAFB 2HIOB 4J8UB 3AZFA 4WU8B 1M1AA 3EG5B 5E5AD 4J8VD 4WU9B 4Z5TC 1P3MC 3REKA 1S32C 3MGQD 5B33A 3KXBA 5AV8B 3UTAD 1EQZC 3B6GD 5GSUD 3REJD 3AFAB 4KGCC 4YS3D 3AZLA 1ID3A 2PYOB 3AV1B 1P3FA 1U35B 3W98D 4XUJD 5AVBB 1H3OA 2UWXA 3KFUG 5AVCA 4E45A 4X23C 3X1UA 5DNMD 5B2JB 3MGRB 1F66C 1P3KD 3WKJA 1P3AA 3AZJC 1P3LA 5B0ZD 4Z66D 1B67A 3MVDC 1P34C 5G49A 5GT0A 2YFVA 1KU5A 3AZMD 3AZLC 3AYWB 1KX3A 1ID3C 5DNNB 5AV5B 4WU8D 1WWSA 1AOIB 5BNVB 3AV2A 3RELA 3LELC 4QLCB 2RVQC 4G91C 5JA4B 3X1UC 5B0YA 3WTPD 4J8WB 4XZQA 1P3AC 5AV8D 2ZY2A 3UTBA 3W97C 3AZNC 2Y2KA 2AROC 4G92C 2YFWA 1T3UA 2Y2PA 3AV1D 5CP6B 1ZLAB 3W99B 3B6FC 2CV5B 5AVBD 4ZUXA 5AV9C 3MGRD 3IP4C 5B2JD 3RELC 5E5AA 4J8VA 3KUYD 2CWEA 1M18B 4XZQC 5AY8C 3MGQA 3UTAA 3B6GA 4CSRA 2ZY3A 5CHLB 5GSUA 3REJA 4KUDC 3AZGC 4YS3A 3LZ1C 3AYWD 5DNND 5F99C 5AV5D 3W98A 1AOID 4XUJA 1P3GB 2BYMA 1JFIA 3WAAB 4QLCD 3X1TA 4JJNB 2FFFB 5C3IC 5DNMA 1W2EA 3X1SC 1P3KA 4H9SA 4J8WD 4J8VC 5BT1D 3AZIB 4Z66A 3MGQC 3NQJA 3UTAC 2BG1A 3AZFD 5GSUC 1TAFA 1ZLAD 5CP6D 3VH5W 2ZY4A 3W99D 2BYKA 2HIOA 2Y2QA 4YS3C 4J8UA 2CV5D 5AV6C 1N1JB 4WU8A 5B24B 4XUJC 1P3IC 3REHC 5B33D 4WU9A 5DNMC 4H9SC 3TU4B 1M18D 3W96C 4DRAA 5AV8A 2Y2MA 2W8SA 5B0ZC 3AFAA 3AN2B 1BH8B 3AZEB 2PYOA 3AV1A 4WJ3C 1U35A 3WA9C 3AZMC 5B1MB 5AVBA 1HQ3B 3MGPC 3WAAD 3B0DB 5B1LB 3O62C 3C1CB 3WKJD 1ZLAC 3MGRA 2G5IC 5B2JA 3MNNC 1P3LD 3LZ0B 2DF4C 4EO5B 3WTPC 4DRBA 3VH6W 5GT0D 1P3OC 1TZYD 3F6TA 3C1BB 1BFMA 5CPIC 3LJAB 3AV2D 3AYWA 5B40B 5DNNA 5AV5A 2L5AA 4H9RB 4NFTA 5B24D 2DQNC 3R45B 5BNVA 1AOIA 5AVBC 4QLCA 5JA4A 4J8WA 3TU4D 3KUYC 5B2IB 3AZHB 4YM6B 3AN2D 3A6NC 1ZLAA 2LY8A 5CP6A 4ZUXD 3W99A 2NZDB 3AYWC 5B1MD 2CV5A 1HQ3D 5B1LD 1M19B 3C1CD 2FJ7C 2G5HC 4R8PB 4QLCC 3LZ0D 4HGAB 4WNNB 5BO0B 1M18A 4J8WC 5BT1C 4AWLC 3NQUB 1ULYA 3EPLA 3AZFC 3X1TD 2F2AC 1M1AC 1P3GA 2CV5C 3WAAA 2F8NB 4ZBJC 3REKC 5B33C 3FDDA 3KXBC 5B2ID 3AZIA 4UPKA 4YM6D 1TZYA 2HIOD 4WZSB 4J8UD 1F1EA 1P3FC 2NZDD 2Y2LA 5FUGB 3MGSB 1BH9B 2Y2NA 1N1JA 4H9OB 5AVCC 3V9RB 5B24A 4WU9D 1M19D 2HUEB 2IO5B 4R8PD 2F8NH 3WKJC 1P3LC 3TU4A 3AFAD 2NQBB 2PYOD 5GT0C 1U35D 1TZYC 5BS7A 1KX3C 4H9QB 3AN2A 1KX4B 5JRGB 3AV2C 5B1MA 1HQ3A 3EPJA 5B1LA 2F8ND 3C1CA 5B0YC 4Z5TB 1P3MB 3LZ0A 2Y2OA 1EQZB 2F8NG 3UTBC 4KGCB 3TU4C 4J8XB 3KWQB 3C1BA 3LJAA 5BS7C 3MGSD 5B40A 4X23B 4H9RA 4ZUXC 1F66B 5E5AC 5B1LC 4UUZB 3AZJB 3B0BA 3LZ0C 3MVDB 1P34B 3B6GC 5B2IA 3REJC 2JE5A 4Z2MH 4YM6A 3VH6A 3AZLB 5CPKB 1KX4D 5JRGD 2JSSA 3W98C 2NZDA 3LELB 4G91B 3X1TC 1M19A 1P3KC 4R8PA 1P3MD 1EQZD 4WNNA 5BO0A 3W97B 4Z66C 3AZNB 4KGCD 2AROB 5B31B 4G92B 3B0CT 5B2IC 4H9PB 4J8XD 3VH6T 4YM6C 3NQUA 3KWQD 3B6FB 2HIOC 1P3GD 4J8UC 2XD5A 4WU8C 5AV9B 4X23D 4JJND 1F66D 3RELB 3WTPE 2F8NA 3P5JB 4H9NB 4WU9C 4XZQB 3AZID 5AY8B 1P34D 5AV8C 1WWIA 4KUDB 3AZGB 3AFAC 3LZ1B 5CPKD 2Y2HA 5F99B 2PYOC 3AV1C 1U35C 1A7WA 5GXQB 1P3BB 5FUGA 3MGSA 1BH9A 3LELD 2XD1A 5C3IB 1HTAA 4H9OA 3V9RA 3REIB 3MGRC 5B2JC 3X1SB 3EPKA 3W97D 3MGQB 3AZND 2NQBA 5B31D 5GSUB 3AZED 3H0MC 2Y2GA 5AV6B 1KX4A 5DNNC 5JRGA 5AV5C 5B31G 5AV9D 2ZY5A 1AOIC 3A1IA 1P3IB 4LD9B 3REHB 3KSYA 1KX5B 3W96B 1P3MA 3UT9B 5AY8D 1EQZA 5B0ZB 3C1BD 4KGCA 3LJAD 3NQJB 3LZ1D 5B40D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F99 D;  4J8X A;  3WA9 B;  1ZLA C;  3W99 C;  2BYK B;  5CP6 C;  5GXQ D;  3KWQ A;  3AZM B;  5GT3 B;  5CPJ B;  4CAY B;  1P3B D;  3MGP B;  1KX4 C;  3O62 B;  5JRG C;  4X23 A;  4JJN A;  1F66 A;  3MNN B;  3REI D;  3X1S D;  5B32 B;  4M6B A;  4UUZ A;  3WTP B;  3AZJ A;  4NE5 A;  1P3P B;  3AZH D;  1P3O B;  1M18 C;  3MVD A;  1P34 A;  5CPI B;  5BNX B;  5CPK A;  5AV6 D;  4J8X C;  3KWQ C;  3X1V B;  1P3G C;  1P3I D;  3LEL A;  3WAA C;  4LD9 D;  3REH D;  3AZK B;  4JJN C;  1R4V A;  1KX5 D;  3W96 D;  3KUY B;  3UT9 D;  3AZI C;  4KHA B;  3W97 A;  3AZN A;  2ARO A;  1BH8 A;  4NE3 A;  5B31 A;  3A6N B;  3AZE A;  4H9P A;  3WA9 D;  3B6F A;  5CPJ D;  5CPK C;  3VH5 A;  5GT3 D;  3MGP D;  3O62 D;  5AV9 A;  2FJ7 B;  5B24 C;  3MNN D;  5B32 D;  1S32 B;  4NE6 A;  4H9N A;  4E44 A;  5KDM B;  1P3P D;  1P3O D;  4AWL B;  5AY8 A;  5B32 G;  4KUD A;  5CPI D;  3AZG A;  3LZ1 A;  3AZF B;  5B31 C;  3AN2 C;  3AZE C;  5F99 A;  1M1A B;  1Q9C A;  3VH5 T;  3R45 A;  5GXQ A;  3X1V D;  1P3B A;  5B1M C;  1HQ3 C;  3B0D C;  3AZK D;  3C1C C;  3REI A;  3X1S A;  4ZBJ B;  3REK B;  5B33 B;  3KXB B;  2NQB D;  4EO5 C;  3AZH A;  1ID3 B;  3A6N D;  1P3F B;  3C1B C;  3LJA C;  5AV6 A;  1H3O B;  5B40 C;  5AVC B;  3X1U B;  2FJ7 D;  5GXQ C;  1P3B C;  1P3I A;  4Z5T D;  4LD9 A;  3REH A;  1S32 D;  1P3A B;  3WKJ B;  1P3L B;  3REI C;  1KX5 A;  3W96 A;  4WV4 B;  3UT9 A;  5G49 B;  5GT0 B;  2YFV B;  5B0Z A;  3AZH C;  1TZY B;  1KX3 B;  4Z2M G;  3WA9 A;  1M1A D;  2NZD C;  3AV2 B;  5CPJ A;  3AZM A;  5GT3 A;  4CAY A;  3MGP A;  3O62 A;  5B0Y B;  3AZJ D;  1M19 C;  3MNN A;  4R8P C;  1B6W A;  5B32 A;  4LD9 C;  3REK D;  3MVD D;  3KXB D;  3WTP A;  1P3P A;  3UTB B;  4HGA C;  1KX5 C;  1P3O A;  3UT9 C;  3AZL D;  1ID3 D;  2YFW B;  1P3F D;  5CPI A;  5BNX A;  2RVQ D;  5AVC D;  4ZUX B;  3X1U D;  5CPJ C;  3X1V A;  5GT3 C;  5E5A B;  4J8V B;  3AZK A;  1P3A D;  2F8N K;  5B32 C;  3KUY A;  3UTA B;  3B0C W;  2ARO D;  1P3P C;  4CSR B;  3B6G B;  3REJ B;  4KHA A;  4YS3 B;  3B6F D;  1KX3 D;  4H9Q A;  3A6N A;  3W98 B;  4XUJ B;  2BYM B;  3MGS C;  3REL D;  1JFI B;  3X1T B;  5DNM B;  2FJ7 A;  5B0Y D;  3X1V C;  1P3K B;  2HUE C;  4Z5T A;  2IO5 C;  4XZQ D;  3AZK C;  1S32 A;  5KDM A;  3UTB D;  4Z66 B;  4KUD D;  3AZG D;  2NQB C;  1TAF B;  2HIO B;  4J8U B;  3AZF A;  4WU8 B;  1M1A A;  5E5A D;  4J8V D;  4WU9 B;  4Z5T C;  1P3M C;  3REK A;  1S32 C;  3MGQ D;  5B33 A;  3KXB A;  5AV8 B;  3UTA D;  1EQZ C;  3B6G D;  5GSU D;  3REJ D;  3AFA B;  4KGC C;  4YS3 D;  3AZL A;  1ID3 A;  2PYO B;  3AV1 B;  1P3F A;  1U35 B;  3W98 D;  4XUJ D;  5AVB B;  1H3O A;  5AVC A;  4E45 A;  4X23 C;  3X1U A;  5DNM D;  5B2J B;  3MGR B;  1F66 C;  1P3K D;  3WKJ A;  1P3A A;  3AZJ C;  1P3L A;  5B0Z D;  4Z66 D;  1B67 A;  3MVD C;  1P34 C;  5G49 A;  5GT0 A;  2YFV A;  1KU5 A;  3AZM D;  3AZL C;  3AYW B;  1KX3 A;  1ID3 C;  5DNN B;  5AV5 B;  4WU8 D;  1WWS A;  1AOI B;  5BNV B;  3AV2 A;  3REL A;  3LEL C;  4QLC B;  2RVQ C;  4G91 C;  5JA4 B;  3X1U C;  5B0Y A;  3WTP D;  4J8W B;  4XZQ A;  1P3A C;  5AV8 D;  3UTB A;  3W97 C;  3AZN C;  2ARO C;  4G92 C;  2YFW A;  3AV1 D;  5CP6 B;  1ZLA B;  3W99 B;  3B6F C;  2CV5 B;  5AVB D;  4ZUX A;  5AV9 C;  3MGR D;  5B2J D;  3REL C;  5E5A A;  4J8V A;  3KUY D;  2CWE A;  1M18 B;  4XZQ C;  5AY8 C;  3MGQ A;  3UTA A;  3B6G A;  4CSR A;  5CHL B;  5GSU A;  3REJ A;  4KUD C;  3AZG C;  4YS3 A;  3LZ1 C;  3AYW D;  5DNN D;  5F99 C;  5AV5 D;  3W98 A;  1AOI D;  4XUJ A;  1P3G B;  2BYM A;  1JFI A;  3WAA B;  4QLC D;  3X1T A;  4JJN B;  5C3I C;  5DNM A;  3X1S C;  1P3K A;  4H9S A;  4J8W D;  4J8V C;  5BT1 D;  3AZI B;  4Z66 A;  3MGQ C;  3NQJ A;  3UTA C;  3AZF D;  5GSU C;  1TAF A;  1ZLA D;  3W99 D;  5CP6 D;  3VH5 W;  4YS3 C;  2BYK A;  2HIO A;  4J8U A;  2CV5 D;  5AV6 C;  1N1J B;  4WU8 A;  5B24 B;  4XUJ C;  1P3I C;  3REH C;  5B33 D;  4WU9 A;  5DNM C;  4H9S C;  3TU4 B;  1M18 D;  3W96 C;  4DRA A;  5AV8 A;  5B0Z C;  3AFA A;  3AN2 B;  1BH8 B;  3AZE B;  2PYO A;  3AV1 A;  1U35 A;  3WA9 C;  3AZM C;  5B1M B;  5AVB A;  1HQ3 B;  3MGP C;  3WAA D;  3B0D B;  5B1L B;  3O62 C;  3C1C B;  3WKJ D;  3MGR A;  5B2J A;  3MNN C;  1P3L D;  3LZ0 B;  4EO5 B;  3WTP C;  4DRB A;  3VH6 W;  5GT0 D;  1P3O C;  1TZY D;  3C1B B;  1BFM A;  5CPI C;  3LJA B;  3AV2 D;  3AYW A;  5B40 B;  5DNN A;  5AV5 A;  2L5A A;  4H9R B;  4NFT A;  5B24 D;  1AOI A;  3R45 B;  5BNV A;  5AVB C;  4QLC A;  5JA4 A;  4J8W A;  3TU4 D;  3KUY C;  5B2I B;  3AZH B;  4YM6 B;  3AN2 D;  3A6N C;  1ZLA A;  2LY8 A;  5CP6 A;  4ZUX D;  3W99 A;  2NZD B;  3AYW C;  5B1M D;  2CV5 A;  1HQ3 D;  5B1L D;  1M19 B;  3C1C D;  2FJ7 C;  4R8P B;  4QLC C;  3LZ0 D;  4HGA B;  4WNN B;  5BO0 B;  1M18 A;  4J8W C;  5BT1 C;  4AWL C;  3NQU B;  1ULY A;  3AZF C;  3X1T D;  1M1A C;  1P3G A;  2CV5 C;  3WAA A;  2F8N B;  4ZBJ C;  3REK C;  5B33 C;  3KXB C;  5B2I D;  3AZI A;  4YM6 D;  1TZY A;  2HIO D;  4WZS B;  4J8U D;  1F1E A;  1P3F C;  2NZD D;  5FUG B;  3MGS B;  1BH9 B;  1N1J A;  4H9O B;  5AVC C;  3V9R B;  5B24 A;  4WU9 D;  1M19 D;  2HUE B;  2IO5 B;  4R8P D;  2F8N H;  3WKJ C;  1P3L C;  3TU4 A;  3AFA D;  2NQB B;  2PYO D;  5GT0 C;  1U35 D;  1TZY C;  5BS7 A;  1KX3 C;  4H9Q B;  3AN2 A;  1KX4 B;  5JRG B;  3AV2 C;  5B1M A;  1HQ3 A;  5B1L A;  2F8N D;  3C1C A;  5B0Y C;  4Z5T B;  1P3M B;  3LZ0 A;  1EQZ B;  2F8N G;  3UTB C;  4KGC B;  3TU4 C;  4J8X B;  3KWQ B;  3C1B A;  3LJA A;  5BS7 C;  3MGS D;  5B40 A;  4X23 B;  4H9R A;  4ZUX C;  1F66 B;  5E5A C;  5B1L C;  4UUZ B;  3AZJ B;  3B0B A;  3LZ0 C;  3MVD B;  1P34 B;  3B6G C;  5B2I A;  3REJ C;  4Z2M H;  4YM6 A;  3VH6 A;  3AZL B;  5CPK B;  1KX4 D;  5JRG D;  2JSS A;  3W98 C;  2NZD A;  3LEL B;  4G91 B;  3X1T C;  1M19 A;  1P3K C;  4R8P A;  1P3M D;  1EQZ D;  4WNN A;  5BO0 A;  3W97 B;  4Z66 C;  3AZN B;  4KGC D;  2ARO B;  5B31 B;  4G92 B;  3B0C T;  5B2I C;  4H9P B;  4J8X D;  3VH6 T;  4YM6 C;  3NQU A;  3KWQ D;  3B6F B;  2HIO C;  1P3G D;  4J8U C;  4WU8 C;  5AV9 B;  4X23 D;  4JJN D;  1F66 D;  3REL B;  3WTP E;  2F8N A;  4H9N B;  4WU9 C;  4XZQ B;  3AZI D;  5AY8 B;  1P34 D;  5AV8 C;  1WWI A;  4KUD B;  3AZG B;  3AFA C;  3LZ1 B;  5CPK D;  5F99 B;  2PYO C;  3AV1 C;  1U35 C;  1A7W A;  5GXQ B;  1P3B B;  5FUG A;  3MGS A;  1BH9 A;  3LEL D;  5C3I B;  4H9O A;  1HTA A;  3V9R A;  3REI B;  3MGR C;  5B2J C;  3X1S B;  3W97 D;  3MGQ B;  3AZN D;  2NQB A;  5B31 D;  5GSU B;  3AZE D;  5AV6 B;  1KX4 A;  5DNN C;  5JRG A;  5AV5 C;  5B31 G;  5AV9 D;  1AOI C;  1P3I B;  4LD9 B;  3REH B;  3KSY A;  1KX5 B;  3W96 B;  1P3M A;  3UT9 B;  5AY8 D;  1EQZ A;  5B0Z B;  3C1B D;  4KGC A;  3LJA D;  3NQJ B;  3LZ1 D;  5B40 D; 
#chains in the Genus database with same CATH topology
 5F99 D;  4J8X A;  3WA9 B;  2Y2I A;  3W99 C;  2BYK B;  5CP6 C;  5GXQ D;  3KWQ A;  3AZM B;  5GT3 B;  5CPJ B;  4CAY B;  2Y2J A;  2JCH A;  3MGP B;  3O62 B;  1P3B D;  5JRG C;  1KX4 C;  4X23 A;  4JJN A;  1F66 A;  3MNN B;  3REI D;  3X1S D;  5B32 B;  4M6B A;  4UUZ A;  3WTP B;  3AZJ A;  4NE5 A;  1P3P B;  3AZH D;  1P3O B;  1M18 C;  3MVD A;  1P34 A;  2RIQ A;  2J8P A;  5CPI B;  5BNX B;  5CPK A;  5AV6 D;  4J8X C;  3KWQ C;  3X1V B;  1P3G C;  1P3I D;  3LEL A;  3WAA C;  4LD9 D;  3REH D;  3AZK B;  4JJN C;  1R4V A;  1KX5 D;  1PZR A;  3W96 D;  3KUY B;  3UT9 D;  3AZI C;  4KHA B;  3W97 A;  3AZN A;  2ARO A;  1BH8 A;  2VQR A;  4NE3 A;  5B31 A;  3A6N B;  3AZE A;  4H9P A;  3WA9 D;  3B6F A;  5CPJ D;  5CPK C;  3VH5 A;  5GT3 D;  3EPH A;  3MGP D;  3O62 D;  5AV9 A;  2FJ7 B;  5B24 C;  3MNN D;  5B32 D;  1S32 B;  4NE6 A;  4H9N A;  4E44 A;  5KDM B;  1P3P D;  1P3O D;  4AWL B;  5AY8 A;  4DQY B;  5B32 G;  4KUD A;  5CPI D;  3AZG A;  3LZ1 A;  3AZF B;  5B31 C;  3AN2 C;  2ZM5 A;  3AZE C;  5F99 A;  1M1A B;  3H0L C;  1Q9C A;  3VH5 T;  3R45 A;  5GXQ A;  3X1V D;  1P3B A;  5B1M C;  1HQ3 C;  3B0D C;  3AZK D;  3C1C C;  3REI A;  3X1S A;  4ZBJ B;  3REK B;  5B33 B;  3KXB B;  2NQB D;  4EO5 C;  3AZH A;  1ID3 B;  3A6N D;  1P3F B;  3C1B C;  3LJA C;  5AV6 A;  1H3O B;  5B40 C;  5AVC B;  3X1U B;  2FJ7 D;  5GXQ C;  1P3B C;  1P3I A;  4Z5T D;  4LD9 A;  3REH A;  1S32 D;  1P3A B;  3WKJ B;  1P3L B;  3REI C;  1KX5 A;  3W96 A;  4WV4 B;  3UT9 A;  5G49 B;  5GT0 B;  2YFV B;  5B0Z A;  3AZH C;  1TZY B;  1KX3 B;  1Z2C B;  4Z2M G;  3WA9 A;  1M1A D;  2NZD C;  3AV2 B;  5CPJ A;  3AZM A;  5GT3 A;  4CAY A;  3MGP A;  3O62 A;  5B0Y B;  3AZJ D;  1M19 C;  3MNN A;  4R8P C;  1B6W A;  5B32 A;  4LD9 C;  3REK D;  3MVD D;  3KXB D;  3WTP A;  1P3P A;  3UTB B;  4HGA C;  1KX5 C;  1P3O A;  3UT9 C;  3AZL D;  1ID3 D;  2YFW B;  3A1K A;  1P3F D;  5CPI A;  5BNX A;  2RVQ D;  4ZUX B;  5AVC D;  3X1U D;  5CPJ C;  3X1V A;  5GT3 C;  5E5A B;  4J8V B;  3AZK A;  1P3A D;  3AL0 C;  2F8N K;  5B32 C;  3KUY A;  3UTA B;  3B0C W;  2ARO D;  1P3P C;  4CSR B;  3B6G B;  3REJ B;  4KHA A;  4YS3 B;  3B6F D;  1KX3 D;  4H9Q A;  3A6N A;  3W98 B;  3H0R C;  4XUJ B;  2BYM B;  3MGS C;  3REL D;  1JFI B;  3X1T B;  5DNM B;  2FJ7 A;  5B0Y D;  3X1V C;  1P3K B;  2HUE C;  4Z5T A;  2IO5 C;  4XZQ D;  3AZK C;  1S32 A;  5KDM A;  3UTB D;  4Z66 B;  4KUD D;  3AZG D;  2NQB C;  1TAF B;  2HIO B;  4J8U B;  3AZF A;  4WU8 B;  1M1A A;  3EG5 B;  5E5A D;  4J8V D;  4WU9 B;  4Z5T C;  1P3M C;  3REK A;  1S32 C;  3MGQ D;  5B33 A;  3KXB A;  5AV8 B;  3UTA D;  1EQZ C;  3B6G D;  5GSU D;  3REJ D;  3AFA B;  4KGC C;  4YS3 D;  3AZL A;  1ID3 A;  2PYO B;  3AV1 B;  1P3F A;  1U35 B;  3W98 D;  4XUJ D;  5AVB B;  1H3O A;  2UWX A;  3KFU G;  5AVC A;  4E45 A;  4X23 C;  3X1U A;  5DNM D;  5B2J B;  3MGR B;  1F66 C;  1P3K D;  3WKJ A;  1P3A A;  3AZJ C;  1P3L A;  5B0Z D;  4Z66 D;  1B67 A;  3MVD C;  1P34 C;  5G49 A;  5GT0 A;  2YFV A;  1KU5 A;  3AZM D;  3AZL C;  3AYW B;  1KX3 A;  1ID3 C;  5DNN B;  5AV5 B;  4WU8 D;  1WWS A;  1AOI B;  5BNV B;  3AV2 A;  3REL A;  3LEL C;  4QLC B;  2RVQ C;  4G91 C;  5JA4 B;  3X1U C;  5B0Y A;  3WTP D;  4J8W B;  4XZQ A;  1P3A C;  5AV8 D;  2ZY2 A;  3UTB A;  3W97 C;  3AZN C;  2Y2K A;  2ARO C;  4G92 C;  2YFW A;  1T3U A;  2Y2P A;  3AV1 D;  5CP6 B;  1ZLA B;  3W99 B;  3B6F C;  2CV5 B;  5AVB D;  4ZUX A;  5AV9 C;  3MGR D;  3IP4 C;  5B2J D;  3REL C;  5E5A A;  4J8V A;  3KUY D;  2CWE A;  1M18 B;  4XZQ C;  5AY8 C;  3MGQ A;  3UTA A;  3B6G A;  4CSR A;  2ZY3 A;  5CHL B;  5GSU A;  3REJ A;  4KUD C;  3AZG C;  4YS3 A;  3LZ1 C;  3AYW D;  5DNN D;  5F99 C;  5AV5 D;  3W98 A;  1AOI D;  4XUJ A;  1P3G B;  2BYM A;  1JFI A;  3WAA B;  4QLC D;  3X1T A;  4JJN B;  2FFF B;  5C3I C;  5DNM A;  1W2E A;  3X1S C;  1P3K A;  4H9S A;  4J8W D;  4J8V C;  5BT1 D;  3AZI B;  4Z66 A;  3MGQ C;  3NQJ A;  3UTA C;  2BG1 A;  3AZF D;  5GSU C;  1TAF A;  1ZLA D;  5CP6 D;  3VH5 W;  2ZY4 A;  3W99 D;  2BYK A;  2HIO A;  2Y2Q A;  4YS3 C;  4J8U A;  2CV5 D;  5AV6 C;  1N1J B;  4WU8 A;  5B24 B;  4XUJ C;  1P3I C;  3REH C;  5B33 D;  4WU9 A;  5DNM C;  4H9S C;  3TU4 B;  1M18 D;  3W96 C;  4DRA A;  5AV8 A;  2Y2M A;  2W8S A;  5B0Z C;  3AFA A;  3AN2 B;  1BH8 B;  3AZE B;  2PYO A;  3AV1 A;  4WJ3 C;  1U35 A;  3WA9 C;  3AZM C;  5B1M B;  5AVB A;  1HQ3 B;  3MGP C;  3WAA D;  3B0D B;  5B1L B;  3O62 C;  3C1C B;  3WKJ D;  1ZLA C;  3MGR A;  2G5I C;  5B2J A;  3MNN C;  1P3L D;  3LZ0 B;  2DF4 C;  4EO5 B;  3WTP C;  4DRB A;  3VH6 W;  5GT0 D;  1P3O C;  1TZY D;  3F6T A;  3C1B B;  1BFM A;  5CPI C;  3LJA B;  3AV2 D;  3AYW A;  5B40 B;  5DNN A;  5AV5 A;  2L5A A;  4H9R B;  4NFT A;  5B24 D;  2DQN C;  3R45 B;  5BNV A;  1AOI A;  5AVB C;  4QLC A;  5JA4 A;  4J8W A;  3TU4 D;  3KUY C;  5B2I B;  3AZH B;  4YM6 B;  3AN2 D;  3A6N C;  1ZLA A;  2LY8 A;  5CP6 A;  4ZUX D;  3W99 A;  2NZD B;  3AYW C;  5B1M D;  2CV5 A;  1HQ3 D;  5B1L D;  1M19 B;  3C1C D;  2FJ7 C;  2G5H C;  4R8P B;  4QLC C;  3LZ0 D;  4HGA B;  4WNN B;  5BO0 B;  1M18 A;  4J8W C;  5BT1 C;  4AWL C;  3NQU B;  1ULY A;  3EPL A;  3AZF C;  3X1T D;  2F2A C;  1M1A C;  1P3G A;  2CV5 C;  3WAA A;  2F8N B;  4ZBJ C;  3REK C;  5B33 C;  3FDD A;  3KXB C;  5B2I D;  3AZI A;  4UPK A;  4YM6 D;  1TZY A;  2HIO D;  4WZS B;  4J8U D;  1F1E A;  1P3F C;  2NZD D;  2Y2L A;  5FUG B;  3MGS B;  1BH9 B;  2Y2N A;  1N1J A;  4H9O B;  5AVC C;  3V9R B;  5B24 A;  4WU9 D;  1M19 D;  2HUE B;  2IO5 B;  4R8P D;  2F8N H;  3WKJ C;  1P3L C;  3TU4 A;  3AFA D;  2NQB B;  2PYO D;  5GT0 C;  1U35 D;  1TZY C;  5BS7 A;  1KX3 C;  4H9Q B;  3AN2 A;  1KX4 B;  5JRG B;  3AV2 C;  5B1M A;  1HQ3 A;  3EPJ A;  5B1L A;  2F8N D;  3C1C A;  5B0Y C;  4Z5T B;  1P3M B;  3LZ0 A;  2Y2O A;  1EQZ B;  2F8N G;  3UTB C;  4KGC B;  3TU4 C;  4J8X B;  3KWQ B;  3C1B A;  3LJA A;  5BS7 C;  3MGS D;  5B40 A;  4X23 B;  4H9R A;  4ZUX C;  1F66 B;  5E5A C;  5B1L C;  4UUZ B;  3AZJ B;  3B0B A;  3LZ0 C;  3MVD B;  1P34 B;  3B6G C;  5B2I A;  3REJ C;  2JE5 A;  4Z2M H;  4YM6 A;  3VH6 A;  3AZL B;  5CPK B;  1KX4 D;  5JRG D;  2JSS A;  3W98 C;  2NZD A;  3LEL B;  4G91 B;  3X1T C;  1M19 A;  1P3K C;  4R8P A;  1P3M D;  1EQZ D;  4WNN A;  5BO0 A;  3W97 B;  4Z66 C;  3AZN B;  4KGC D;  2ARO B;  5B31 B;  4G92 B;  3B0C T;  5B2I C;  4H9P B;  4J8X D;  3VH6 T;  4YM6 C;  3NQU A;  3KWQ D;  3B6F B;  2HIO C;  1P3G D;  4J8U C;  2XD5 A;  4WU8 C;  5AV9 B;  4X23 D;  4JJN D;  1F66 D;  3REL B;  3WTP E;  2F8N A;  3P5J B;  4H9N B;  4WU9 C;  4XZQ B;  3AZI D;  5AY8 B;  1P34 D;  5AV8 C;  1WWI A;  4KUD B;  3AZG B;  3AFA C;  3LZ1 B;  5CPK D;  2Y2H A;  5F99 B;  2PYO C;  3AV1 C;  1U35 C;  1A7W A;  5GXQ B;  1P3B B;  5FUG A;  3MGS A;  1BH9 A;  3LEL D;  2XD1 A;  5C3I B;  1HTA A;  4H9O A;  3V9R A;  3REI B;  3MGR C;  5B2J C;  3X1S B;  3EPK A;  3W97 D;  3MGQ B;  3AZN D;  2NQB A;  5B31 D;  5GSU B;  3AZE D;  3H0M C;  2Y2G A;  5AV6 B;  1KX4 A;  5DNN C;  5JRG A;  5AV5 C;  5B31 G;  5AV9 D;  2ZY5 A;  1AOI C;  3A1I A;  1P3I B;  4LD9 B;  3REH B;  3KSY A;  1KX5 B;  3W96 B;  1P3M A;  3UT9 B;  5AY8 D;  1EQZ A;  5B0Z B;  3C1B D;  4KGC A;  3LJA D;  3NQJ B;  3LZ1 D;  5B40 D; 
#chains in the Genus database with same CATH homology
 5F99 D;  4J8X A;  3WA9 B;  2Y2I A;  3W99 C;  2BYK B;  5CP6 C;  5GXQ D;  3KWQ A;  3AZM B;  5GT3 B;  5CPJ B;  4CAY B;  2Y2J A;  2JCH A;  3MGP B;  3O62 B;  1P3B D;  5JRG C;  1KX4 C;  4X23 A;  4JJN A;  1F66 A;  3MNN B;  3REI D;  3X1S D;  5B32 B;  4M6B A;  4UUZ A;  3WTP B;  3AZJ A;  4NE5 A;  1P3P B;  3AZH D;  1P3O B;  1M18 C;  3MVD A;  1P34 A;  2RIQ A;  2J8P A;  5CPI B;  5BNX B;  5CPK A;  5AV6 D;  4J8X C;  3KWQ C;  3X1V B;  1P3G C;  1P3I D;  3LEL A;  3WAA C;  4LD9 D;  3REH D;  3AZK B;  4JJN C;  1R4V A;  1KX5 D;  1PZR A;  3W96 D;  3KUY B;  3UT9 D;  3AZI C;  4KHA B;  3W97 A;  3AZN A;  2ARO A;  1BH8 A;  2VQR A;  4NE3 A;  5B31 A;  3A6N B;  3AZE A;  4H9P A;  3WA9 D;  3B6F A;  5CPJ D;  5CPK C;  3VH5 A;  5GT3 D;  3EPH A;  3MGP D;  3O62 D;  5AV9 A;  2FJ7 B;  5B24 C;  3MNN D;  5B32 D;  1S32 B;  4NE6 A;  4H9N A;  4E44 A;  5KDM B;  1P3P D;  1P3O D;  4AWL B;  5AY8 A;  4DQY B;  5B32 G;  4KUD A;  5CPI D;  3AZG A;  3LZ1 A;  3AZF B;  5B31 C;  3AN2 C;  2ZM5 A;  3AZE C;  5F99 A;  1M1A B;  3H0L C;  1Q9C A;  3VH5 T;  3R45 A;  5GXQ A;  3X1V D;  1P3B A;  5B1M C;  1HQ3 C;  3B0D C;  3AZK D;  3C1C C;  3REI A;  3X1S A;  4ZBJ B;  3REK B;  5B33 B;  3KXB B;  2NQB D;  4EO5 C;  3AZH A;  1ID3 B;  3A6N D;  1P3F B;  3C1B C;  3LJA C;  5AV6 A;  1H3O B;  5B40 C;  5AVC B;  3X1U B;  2FJ7 D;  5GXQ C;  1P3B C;  1P3I A;  4Z5T D;  4LD9 A;  3REH A;  1S32 D;  1P3A B;  3WKJ B;  1P3L B;  3REI C;  1KX5 A;  3W96 A;  4WV4 B;  3UT9 A;  5G49 B;  5GT0 B;  2YFV B;  5B0Z A;  3AZH C;  1TZY B;  1KX3 B;  1Z2C B;  4Z2M G;  3WA9 A;  1M1A D;  2NZD C;  3AV2 B;  5CPJ A;  3AZM A;  5GT3 A;  4CAY A;  3MGP A;  3O62 A;  5B0Y B;  3AZJ D;  1M19 C;  3MNN A;  4R8P C;  1B6W A;  5B32 A;  4LD9 C;  3REK D;  3MVD D;  3KXB D;  3WTP A;  1P3P A;  3UTB B;  4HGA C;  1KX5 C;  1P3O A;  3UT9 C;  3AZL D;  1ID3 D;  2YFW B;  3A1K A;  1P3F D;  5CPI A;  5BNX A;  2RVQ D;  4ZUX B;  5AVC D;  3X1U D;  5CPJ C;  3X1V A;  5GT3 C;  5E5A B;  4J8V B;  3AZK A;  1P3A D;  3AL0 C;  2F8N K;  5B32 C;  3KUY A;  3UTA B;  3B0C W;  2ARO D;  1P3P C;  4CSR B;  3B6G B;  3REJ B;  4KHA A;  4YS3 B;  3B6F D;  1KX3 D;  4H9Q A;  3A6N A;  3W98 B;  3H0R C;  4XUJ B;  2BYM B;  3MGS C;  3REL D;  1JFI B;  3X1T B;  5DNM B;  2FJ7 A;  5B0Y D;  3X1V C;  1P3K B;  2HUE C;  4Z5T A;  2IO5 C;  4XZQ D;  3AZK C;  1S32 A;  5KDM A;  3UTB D;  4Z66 B;  4KUD D;  3AZG D;  2NQB C;  1TAF B;  2HIO B;  4J8U B;  3AZF A;  4WU8 B;  1M1A A;  3EG5 B;  5E5A D;  4J8V D;  4WU9 B;  4Z5T C;  1P3M C;  3REK A;  1S32 C;  3MGQ D;  5B33 A;  3KXB A;  5AV8 B;  3UTA D;  1EQZ C;  3B6G D;  5GSU D;  3REJ D;  3AFA B;  4KGC C;  4YS3 D;  3AZL A;  1ID3 A;  2PYO B;  3AV1 B;  1P3F A;  1U35 B;  3W98 D;  4XUJ D;  5AVB B;  1H3O A;  2UWX A;  3KFU G;  5AVC A;  4E45 A;  4X23 C;  3X1U A;  5DNM D;  5B2J B;  3MGR B;  1F66 C;  1P3K D;  3WKJ A;  1P3A A;  3AZJ C;  1P3L A;  5B0Z D;  4Z66 D;  1B67 A;  3MVD C;  1P34 C;  5G49 A;  5GT0 A;  2YFV A;  1KU5 A;  3AZM D;  3AZL C;  3AYW B;  1KX3 A;  1ID3 C;  5DNN B;  5AV5 B;  4WU8 D;  1WWS A;  1AOI B;  5BNV B;  3AV2 A;  3REL A;  3LEL C;  4QLC B;  2RVQ C;  4G91 C;  5JA4 B;  3X1U C;  5B0Y A;  3WTP D;  4J8W B;  4XZQ A;  1P3A C;  5AV8 D;  2ZY2 A;  3UTB A;  3W97 C;  3AZN C;  2Y2K A;  2ARO C;  4G92 C;  2YFW A;  1T3U A;  2Y2P A;  3AV1 D;  5CP6 B;  1ZLA B;  3W99 B;  3B6F C;  2CV5 B;  5AVB D;  4ZUX A;  5AV9 C;  3MGR D;  3IP4 C;  5B2J D;  3REL C;  5E5A A;  4J8V A;  3KUY D;  2CWE A;  1M18 B;  4XZQ C;  5AY8 C;  3MGQ A;  3UTA A;  3B6G A;  4CSR A;  2ZY3 A;  5CHL B;  5GSU A;  3REJ A;  4KUD C;  3AZG C;  4YS3 A;  3LZ1 C;  3AYW D;  5DNN D;  5F99 C;  5AV5 D;  3W98 A;  1AOI D;  4XUJ A;  1P3G B;  2BYM A;  1JFI A;  3WAA B;  4QLC D;  3X1T A;  4JJN B;  2FFF B;  5C3I C;  5DNM A;  1W2E A;  3X1S C;  1P3K A;  4H9S A;  4J8W D;  4J8V C;  5BT1 D;  3AZI B;  4Z66 A;  3MGQ C;  3NQJ A;  3UTA C;  2BG1 A;  3AZF D;  5GSU C;  1TAF A;  1ZLA D;  5CP6 D;  3VH5 W;  2ZY4 A;  3W99 D;  2BYK A;  2HIO A;  2Y2Q A;  4YS3 C;  4J8U A;  2CV5 D;  5AV6 C;  1N1J B;  4WU8 A;  5B24 B;  4XUJ C;  1P3I C;  3REH C;  5B33 D;  4WU9 A;  5DNM C;  4H9S C;  3TU4 B;  1M18 D;  3W96 C;  4DRA A;  5AV8 A;  2Y2M A;  2W8S A;  5B0Z C;  3AFA A;  3AN2 B;  1BH8 B;  3AZE B;  2PYO A;  3AV1 A;  4WJ3 C;  1U35 A;  3WA9 C;  3AZM C;  5B1M B;  5AVB A;  1HQ3 B;  3MGP C;  3WAA D;  3B0D B;  5B1L B;  3O62 C;  3C1C B;  3WKJ D;  1ZLA C;  3MGR A;  2G5I C;  5B2J A;  3MNN C;  1P3L D;  3LZ0 B;  2DF4 C;  4EO5 B;  3WTP C;  4DRB A;  3VH6 W;  5GT0 D;  1P3O C;  1TZY D;  3F6T A;  3C1B B;  1BFM A;  5CPI C;  3LJA B;  3AV2 D;  3AYW A;  5B40 B;  5DNN A;  5AV5 A;  2L5A A;  4H9R B;  4NFT A;  5B24 D;  2DQN C;  3R45 B;  5BNV A;  1AOI A;  5AVB C;  4QLC A;  5JA4 A;  4J8W A;  3TU4 D;  3KUY C;  5B2I B;  3AZH B;  4YM6 B;  3AN2 D;  3A6N C;  1ZLA A;  2LY8 A;  5CP6 A;  4ZUX D;  3W99 A;  2NZD B;  3AYW C;  5B1M D;  2CV5 A;  1HQ3 D;  5B1L D;  1M19 B;  3C1C D;  2FJ7 C;  2G5H C;  4R8P B;  4QLC C;  3LZ0 D;  4HGA B;  4WNN B;  5BO0 B;  1M18 A;  4J8W C;  5BT1 C;  4AWL C;  3NQU B;  1ULY A;  3EPL A;  3AZF C;  3X1T D;  2F2A C;  1M1A C;  1P3G A;  2CV5 C;  3WAA A;  2F8N B;  4ZBJ C;  3REK C;  5B33 C;  3FDD A;  3KXB C;  5B2I D;  3AZI A;  4UPK A;  4YM6 D;  1TZY A;  2HIO D;  4WZS B;  4J8U D;  1F1E A;  1P3F C;  2NZD D;  2Y2L A;  5FUG B;  3MGS B;  1BH9 B;  2Y2N A;  1N1J A;  4H9O B;  5AVC C;  3V9R B;  5B24 A;  4WU9 D;  1M19 D;  2HUE B;  2IO5 B;  4R8P D;  2F8N H;  3WKJ C;  1P3L C;  3TU4 A;  3AFA D;  2NQB B;  2PYO D;  5GT0 C;  1U35 D;  1TZY C;  5BS7 A;  1KX3 C;  4H9Q B;  3AN2 A;  1KX4 B;  5JRG B;  3AV2 C;  5B1M A;  1HQ3 A;  3EPJ A;  5B1L A;  2F8N D;  3C1C A;  5B0Y C;  4Z5T B;  1P3M B;  3LZ0 A;  2Y2O A;  1EQZ B;  2F8N G;  3UTB C;  4KGC B;  3TU4 C;  4J8X B;  3KWQ B;  3C1B A;  3LJA A;  5BS7 C;  3MGS D;  5B40 A;  4X23 B;  4H9R A;  4ZUX C;  1F66 B;  5E5A C;  5B1L C;  4UUZ B;  3AZJ B;  3B0B A;  3LZ0 C;  3MVD B;  1P34 B;  3B6G C;  5B2I A;  3REJ C;  2JE5 A;  4Z2M H;  4YM6 A;  3VH6 A;  3AZL B;  5CPK B;  1KX4 D;  5JRG D;  2JSS A;  3W98 C;  2NZD A;  3LEL B;  4G91 B;  3X1T C;  1M19 A;  1P3K C;  4R8P A;  1P3M D;  1EQZ D;  4WNN A;  5BO0 A;  3W97 B;  4Z66 C;  3AZN B;  4KGC D;  2ARO B;  5B31 B;  4G92 B;  3B0C T;  5B2I C;  4H9P B;  4J8X D;  3VH6 T;  4YM6 C;  3NQU A;  3KWQ D;  3B6F B;  2HIO C;  1P3G D;  4J8U C;  2XD5 A;  4WU8 C;  5AV9 B;  4X23 D;  4JJN D;  1F66 D;  3REL B;  3WTP E;  2F8N A;  3P5J B;  4H9N B;  4WU9 C;  4XZQ B;  3AZI D;  5AY8 B;  1P34 D;  5AV8 C;  1WWI A;  4KUD B;  3AZG B;  3AFA C;  3LZ1 B;  5CPK D;  2Y2H A;  5F99 B;  2PYO C;  3AV1 C;  1U35 C;  1A7W A;  5GXQ B;  1P3B B;  5FUG A;  3MGS A;  1BH9 A;  3LEL D;  2XD1 A;  5C3I B;  1HTA A;  4H9O A;  3V9R A;  3REI B;  3MGR C;  5B2J C;  3X1S B;  3EPK A;  3W97 D;  3MGQ B;  3AZN D;  2NQB A;  5B31 D;  5GSU B;  3AZE D;  3H0M C;  2Y2G A;  5AV6 B;  1KX4 A;  5DNN C;  5JRG A;  5AV5 C;  5B31 G;  5AV9 D;  2ZY5 A;  1AOI C;  3A1I A;  1P3I B;  4LD9 B;  3REH B;  3KSY A;  1KX5 B;  3W96 B;  1P3M A;  3UT9 B;  5AY8 D;  1EQZ A;  5B0Z B;  3C1B D;  4KGC A;  3LJA D;  3NQJ B;  3LZ1 D;  5B40 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...