3AYWC

Crystal structure of human nucleosome core particle containing h3k56q mutation
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 108
sequence length 108
chains with identical sequence G
ec nomenclature
pdb deposition date 2011-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aywC00
5B0YC 2YFWA 3LJAC 5GSUA 4H9NB 5DNNA 1TZYA 3B6GD 3REHA 4H9RB 5B33B 3W96A 3AFAC 5B32G 3WTPC 4WU9D 1P34A 4J8XA 1P3OB 3WKJB 1M18D 4J8WC 1P3BB 3B6FB 5B1MD 2AROD 5F99C 2IO5B 1P3GA 2HUEB 3UTBC 4KGCB 1TAFB 4QLCD 3MGRC 2F8ND 5CPJA 5B24D 2NQBA 4R8PD 3RELA 1ID3C 4YS3C 5JRGD 5B33D 3AZFA 3LELA 3VH5A 4CAYB 3MGPC 1KX5B 4Z66B 3X1SC 1BFMA 5B32C 3NQJB 1P3OD 3WKJD 3AV2C 3AZIC 1P3BD 3B6FD 1U35A 3AZNC 5B0YB 3LJAB 3B0CW 4J8XD 3W98C 3C1CA 4KGCD 2PYOC 1P3IA 4JJNA 3MGSA 3TU4A 1P3FD 1P3AA 3O62A 3REKA 1KX3C 4H9QB 5BNXA 4X23A 3KXBD 3AFAB 3W97D 3UTAA 3WTPB 4WU8A 3AZEA 1P3LA 5FUGB 1M1AA 1F66C 5C3IC 3VH5T 4YM6A 3A6NC 3UT9A 3X1TC 3MNND 2HIOC 3AYWB 5F99B 2F8NK 4KUDA 3MVDC 4Z66D 1KX5D 1EQZA 3UTBB 3W99C 5B1LA 4Z5TC 4EO5C 5B0YD 3LJAD 5BO0A 5AV9B 3X1UA 1ID3B 5CP6C 4UUZA 5GT0A 3LZ1D 3KWQA 3AFAD 3MGPB 3AZLA 3WTPD 3AN2C 5BT1D 3AV2B 3AZIB 2NZDC 4XUJD 3KUYC 3AZNB 3AYWD 1ZLAA 5E5AC 3VH6A 2PYOB 3AZJC 5CPIC 1P3MB 4NFTA 3B6GA 3WTPE 2F8NH 4AWLC 5AV9D 4J8UC 1ID3D 3NQUB 1F66B 5C3IB 2RVQC 3AZHC 3A6NB 4WU9A 3X1TB 5GT3C 1S32D 2HIOB 3MVDB 5B40C 1P3PB 3W99B 2BYKA 1M18A 5B1MA 4Z5TB 5GSUC 5DNMB 5GXQB 2AROA 4EO5B 3AZID 1B67A 3AZND 3REHC 4QLCA 1KU5A 2F8NA 3C1BC 5AVBC 3W96C 5B24A 4R8PA 1P3MD 5B2IC 5CP6B 3AZMB 1AOIC 5JRGA 3AZKB 4H9RA 5B33A 3AN2B 5KDMB 5AVCC 5AY8B 1BH8B 1F66D 5B31C 2NZDB 3A6ND 3KUYB 2HIOD 1P3OA 4E44A 5CPJC 3MVDD 5E5AB 1P3PD 3WKJA 4H9PB 1P3BA 3B6FA 3X1VC 5DNMD 3RELC 5GXQD 5CPIB 5B2JD 4WNNB 4KGCA 1TAFA 5AV5B 3AZFC 1P3KB 1P3FA 4J8UB 3AV1C 3KXBA 5CP6D 3W97A 5BS7C 5CPKB 3MGQB 3AZMD 5GT3B 5AV6D 3AZKD 3AN2D 5AV8B 5AY8D 2YFWB 4CAYA 3MNNA 3REJB 1M19B 1KX5A 4Z66A 4JJNC 3B0BA 3KUYD 3REHB 3TU4C 3NQJA 1P3AC 3O62C 1N1JB 4X23C 3C1BB 5AVBB 5B0YA 5CPID 3LJAA 5B2IB 3AZGC 4ZUXC 1M1AC 1JFIA 5AV5D 1P3KD 1AOIB 2YFVA 4J8UD 4YM6C 2BYMB 1Q9CA 4H9QA 3UT9C 3LZ1A 5AVCB 4XZQC 3LZ0C 3AFAA 2JSSA 5B31B 4J8VC 3WTPA 5CPKD 3MGQD 4NE5A 5CPJB 1KX4C 5AV8D 2FJ7C 3X1VB 4XUJA 3REJD 3AYWA 1M19D 4CSRB 3AZFB 4J8WB 5GT0C 5CHLB 3C1BD 3KWQC 5AVBD 3AZLC 3AV1B 4G92C 5B2ID 3MGRB 5AV9A 4E45A 5B0ZC 1ID3A 1AOID 2F8NG 5AVCD 3VH6W 2L5AA 1S32A 4LD9C 5B31D 4YS3B 1F1EA 1P3AB 1ULYA 3O62B 3AZIA 5BNXB 4X23B 3X1VD 3AZNA 3B6GC 3X1SB 4KHAA 5B32B 3AZGB 4ZUXB 1M1AB 4J8WD 3KSYA 1P3MA 4WU9C 4YM6B 5F99D 3UT9B 1BH9B 4XZQB 3AV1D 3LZ0B 3W98B 3UTBD 3MGRD 4J8VB 1HTAA 5G49A 3REIC 1M18C 1KX3B 3WAAC 2CV5C 1KX4B 3WA9C 4M6BA 5BNVB 1F66A 4QLCC 2FJ7B 3A6NA 4HGAC 2HIOA 1H3OA 4YS3D 3MVDA 1P3PA 1R4VA 5B24C 4R8PC 5DNMA 1HQ3C 3V9RB 5GXQA 5GT0B 3MGPD 5B2JA 3X1SD 5JRGC 5B33C 5B32D 3AZGD 4ZUXD 5DNNC 1TZYC 3B0CT 5B0ZB 3AV2D 3R45B 5CP6A 4XZQD 5JA4B 1P3OC 3LZ0D 3W98D 3AZMA 2PYOD 4LD9B 5AV6A 4J8VD 3AZKA 3AN2A 4H9SA 3B6FC 5AY8A 4H9NA 1P34C 1KX3D 2IO5C 4J8XC 2FJ7D 3KUYA 3B6GB 1P3FC 2LY8A 5E5AA 4H9PA 3KXBC 1P3GC 4H9OB 3W97C 3X1TD 5CPIA 4WU9B 4WNNA 5AV5A 3W99D 1P3KA 2NQBC 3AZJB 4Z5TD 1M18B 4J8UA 3REIB 5B0ZD 3MNNC 4WV4B 3WAAB 4Z66C 2CV5B 3WA9B 3VH5W 4QLCB 3LELC 5CPKA 3MGQA 4HGAB 4AWLB 4LD9D 5AV8A 5B24B 4R8PB 1HQ3B 3REJA 3AZHB 1M19A 4Z2MH 5B40B 1U35C 5JRGB 1N1JA 3LZ1C 5GSUB 3C1BA 5DNNB 1TZYB 5AVBA 3C1CC 2NZDD 1P3IC 3MGSC 5B2IA 3REKC 5E5AD 5BT1C 1AOIA 3AZJD 3W96B 4WZSB 2BYMA 4XUJC 3REID 3UTAC 5AVCA 3AYWC 4WU8C 3AZEC 1P34B 1P3LC 3WAAD 4J8XB 2CV5D 3WA9D 4DRAA 5B31A 1P3FB 4KUDC 1P3GB 3KXBB 1EQZC 3X1VA 3W97B 1HQ3D 2RVQD 5B1LC 3AZHD 5AV9C 5FUGA 4CSRA 5GT3D 4ZBJC 1B6WA 5B40D 4J8WA 2NQBB 5GSUD 5DNND 1TZYD 3RELB 5F99A 3MNNB 3AV1A 3X1UC 1S32C 3REHD 3UTBA 3MGRA 5BS7A 3LELB 3W96D 1P34D 4YS3A 1JFIB 1U35B 2YFVB 1P3MC 3LZ1B 1ZLAC 1P3GD 3MGPA 3C1CB 3X1SA 1P3IB 4JJNB 3MGSB 3TU4B 1WWIA 5B32A 3AZGA 5CPJD 4ZUXA 3REKB 3AV2A 2NQBD 3RELD 4XUJB 4G91C 1BH9A 4NE6A 4XZQA 4WU8B 3UTAB 3AZEB 3LZ0A 1P3LB 3W98A 1P3PC 2PYOA 4J8VA 3AZFD 3LELD 2CWEA 5DNMC 1WWSA 5GXQC 1KX3A 5B2JC 1KX4A 4KUDB 5BNVA 2FJ7A 1EQZB 5B1LB 5B1MC 4DRBA 3NQUA 2AROC 4ZBJB 1U35D 3B0DC 3V9RA 3X1TA 5BO0B 3C1CD 3AZMC 1S32B 3X1UB 1P3ID 4JJND 5AV6C 3MGSD 3AZKC 3TU4D 4H9SC 3W99A 1P3AD 3O62D 4Z5TA 5AY8C 3REKD 4UUZB 5B0ZA 3R45A 4X23D 3KWQB 3AZLB 3UTAD 5JA4A 4G92B 4WU8D 3AZED 1P3LD 4KHAB 4NE3A 4LD9A 1M1AD 4YM6D 3UT9D 4KUDD 1ZLAB 1EQZD 3WKJC 5AV5C 1P3KC 5B1LD 1P3BC 5KDMA 5G49B 1BH8A 5B31G 1KX4D 2HUEC 4KGCC 4H9OA 2NZDA 4Z2MG 5CPKC 3MGQC 4G91B 3X1UD 1H3OB 5AV8C 3AZJA 3REIA 5GT0D 3KWQD 3REJC 1M19C 3WAAA 3AZLD 5B2JB 2CV5A 3WA9A 2BYKB 3VH6T 5B1MB 1A7WA 2AROB 1KX5C 3B0DB 1HQ3A 3AZHA 1ZLAD 5GT3A 2F8NB 5B40A 5AV6B
chains in the Genus database with same CATH superfamily
5B0YC 2YFWA 3LJAC 5GSUA 4H9NB 5DNNA 1TZYA 3B6GD 3REHA 4H9RB 5B33B 4WJ3C 3W96A 3AFAC 5B32G 3WTPC 4WU9D 1P34A 4J8XA 1P3OB 3WKJB 1M18D 4J8WC 1P3BB 3B6FB 5B1MD 2AROD 5F99C 2IO5B 1P3GA 2HUEB 3UTBC 4KGCB 1TAFB 2Y2HA 4QLCD 3MGRC 2F8ND 3H0MC 5CPJA 5B24D 2NQBA 4R8PD 3RELA 1ID3C 4YS3C 5JRGD 5B33D 3AZFA 3LELA 3VH5A 4CAYB 3MGPC 3KFUG 1KX5B 4Z66B 3X1SC 1BFMA 5B32C 3NQJB 1P3OD 4UPKA 3AV2C 3AZIC 3WKJD 1P3BD 3B6FD 1U35A 3AZNC 2Y2PA 5B0YB 3LJAB 3B0CW 4J8XD 3W98C 3C1CA 4KGCD 2PYOC 1P3IA 4JJNA 3MGSA 3TU4A 1P3FD 1P3AA 3O62A 3REKA 1KX3C 4H9QB 5BNXA 4X23A 3KXBD 3AFAB 3W97D 3UTAA 2DF4C 3WTPB 4WU8A 2ZY4A 3AZEA 1P3LA 5FUGB 1M1AA 1F66C 5C3IC 2RIQA 3VH5T 4YM6A 3A6NC 3UT9A 3X1TC 3MNND 2HIOC 3AYWB 5F99B 2F8NK 4KUDA 3MVDC 4Z66D 1KX5D 1EQZA 3UTBB 3W99C 5B1LA 2Y2MA 4Z5TC 2Y2NA 4EO5C 4DQYB 5B0YD 3LJAD 2DQNC 5BO0A 5AV9B 3X1UA 1ID3B 5CP6C 4UUZA 5GT0A 3LZ1D 3KWQA 3AFAD 3MGPB 3AZLA 3WTPD 3AN2C 3EPJA 5BT1D 3AV2B 3AZIB 2NZDC 4XUJD 3KUYC 3AZNB 3AYWD 2Y2QA 1ZLAA 5E5AC 3VH6A 2PYOB 3AZJC 2F2AC 5CPIC 1P3MB 4NFTA 3B6GA 3WTPE 2F8NH 4AWLC 5AV9D 4J8UC 1ID3D 3NQUB 1F66B 5C3IB 2RVQC 3AZHC 3A6NB 4WU9A 3X1TB 5GT3C 1S32D 2HIOB 3MVDB 5B40C 1P3PB 3W99B 2BYKA 1M18A 5B1MA 4Z5TB 5GSUC 5DNMB 5GXQB 2AROA 4EO5B 3AZID 1B67A 2ZM5A 3REHC 3AZND 4QLCA 2BG1A 1KU5A 2F8NA 3C1BC 5AVBC 3W96C 5B24A 4R8PA 1P3MD 5B2IC 5CP6B 3AZMB 1AOIC 5JRGA 3AZKB 4H9RA 5B33A 3AN2B 5KDMB 5AVCC 5AY8B 1BH8B 1F66D 5B31C 2NZDB 3A6ND 3KUYB 2HIOD 1P3OA 4E44A 5CPJC 3MVDD 2G5IC 5E5AB 1P3PD 3WKJA 4H9PB 1P3BA 3B6FA 3X1VC 5DNMD 3RELC 5GXQD 5CPIB 5B2JD 4WNNB 4KGCA 1TAFA 5AV5B 3AZFC 1Z2CB 1P3KB 1P3FA 4J8UB 3AV1C 3KXBA 5CP6D 2W8SA 3W97A 5BS7C 5CPKB 3MGQB 3AZMD 5GT3B 5AV6D 3AZKD 3AN2D 5AV8B 5AY8D 2YFWB 4CAYA 3MNNA 3REJB 1M19B 1KX5A 4Z66A 4JJNC 3B0BA 3KUYD 3REHB 3TU4C 3NQJA 1P3AC 3O62C 1N1JB 4X23C 3C1BB 5AVBB 5B0YA 5CPID 3LJAA 2G5HC 5B2IB 3AZGC 4ZUXC 1M1AC 1JFIA 5AV5D 1P3KD 1AOIB 2YFVA 4J8UD 4YM6C 2BYMB 1Q9CA 4H9QA 3UT9C 3LZ1A 5AVCB 4XZQC 3LZ0C 2ZY3A 3AFAA 2Y2KA 2JSSA 5B31B 4J8VC 3WTPA 5CPKD 3MGQD 4NE5A 5CPJB 1KX4C 5AV8D 2Y2LA 2FJ7C 3X1VB 4XUJA 3REJD 3AYWA 1M19D 3EPHA 4CSRB 3IP4C 3AZFB 4J8WB 5GT0C 5CHLB 3C1BD 3KWQC 5AVBD 3AZLC 3AV1B 4G92C 5B2ID 3MGRB 5AV9A 4E45A 5B0ZC 1ID3A 3H0RC 1AOID 3A1KA 2F8NG 5AVCD 3VH6W 2L5AA 1S32A 4LD9C 5B31D 4YS3B 1F1EA 1P3AB 1ULYA 3O62B 3AZIA 5BNXB 4X23B 3X1VD 3AZNA 3B6GC 3X1SB 4KHAA 5B32B 3AZGB 4ZUXB 1M1AB 4J8WD 3KSYA 1P3MA 4WU9C 4YM6B 5F99D 3UT9B 1BH9B 4XZQB 3AV1D 3LZ0B 3W98B 3UTBD 2VQRA 3MGRD 4J8VB 1HTAA 5G49A 3REIC 1M18C 1KX3B 3WAAC 2CV5C 1KX4B 3WA9C 4M6BA 5BNVB 1F66A 4QLCC 2FJ7B 2ZY5A 3A6NA 4HGAC 2HIOA 1H3OA 4YS3D 3MVDA 1P3PA 1R4VA 5B24C 2JE5A 4R8PC 5DNMA 1HQ3C 3V9RB 5GXQA 5GT0B 3MGPD 5B2JA 3X1SD 5JRGC 2Y2OA 5B33C 5B32D 3AZGD 4ZUXD 5DNNC 1TZYC 2Y2IA 3B0CT 5B0ZB 3R45B 3AV2D 5CP6A 4XZQD 5JA4B 1P3OC 3LZ0D 3W98D 3AZMA 2PYOD 4LD9B 5AV6A 4J8VD 3AZKA 3AN2A 4H9SA 3B6FC 5AY8A 4H9NA 1P34C 1KX3D 2IO5C 4J8XC 2FJ7D 3KUYA 3B6GB 1P3FC 2LY8A 5E5AA 4H9PA 3A1IA 3KXBC 1P3GC 4H9OB 3W97C 3X1TD 5CPIA 2XD5A 4WU9B 4WNNA 5AV5A 3W99D 1P3KA 2NQBC 3AZJB 4Z5TD 1M18B 4J8UA 3REIB 5B0ZD 3MNNC 4WV4B 3WAAB 4Z66C 2CV5B 3WA9B 1PZRA 3VH5W 2J8PA 4QLCB 3LELC 3MGQA 5CPKA 4HGAB 4AWLB 4LD9D 5AV8A 5B24B 1W2EA 3EG5B 4R8PB 1HQ3B 3REJA 3AZHB 1M19A 4Z2MH 5B40B 1U35C 5JRGB 1N1JA 3LZ1C 5GSUB 3C1BA 5DNNB 1TZYB 5AVBA 3C1CC 2NZDD 1P3IC 3MGSC 5B2IA 3REKC 5E5AD 5BT1C 1AOIA 3AZJD 3W96B 4WZSB 2BYMA 4XUJC 3REID 3AL0C 3UTAC 5AVCA 3AYWC 4WU8C 3AZEC 1P34B 1P3LC 3WAAD 4J8XB 2CV5D 3WA9D 4DRAA 5B31A 1P3FB 4KUDC 1P3GB 3KXBB 1EQZC 3X1VA 3W97B 1HQ3D 2RVQD 5B1LC 3AZHD 5AV9C 5FUGA 4CSRA 5GT3D 4ZBJC 1B6WA 5B40D 4J8WA 2NQBB 5GSUD 2Y2GA 1TZYD 5DNND 5F99A 3RELB 3MNNB 3AV1A 3X1UC 1S32C 3REHD 3UTBA 3MGRA 5BS7A 3LELB 2JCHA 3W96D 1P34D 4YS3A 1JFIB 1U35B 2YFVB 3H0LC 1P3MC 3LZ1B 1ZLAC 1P3GD 3MGPA 3C1CB 2Y2JA 3X1SA 1P3IB 4JJNB 3MGSB 3TU4B 1WWIA 5B32A 3AZGA 5CPJD 4ZUXA 3REKB 3AV2A 2NQBD 3RELD 4XUJB 4G91C 1BH9A 4NE6A 4XZQA 4WU8B 3UTAB 3AZEB 3LZ0A 1P3LB 3W98A 1P3PC 2PYOA 4J8VA 3AZFD 3LELD 2CWEA 5DNMC 1WWSA 5GXQC 1KX3A 5B2JC 1KX4A 4KUDB 5BNVA 2FJ7A 1EQZB 5B1LB 5B1MC 4DRBA 3NQUA 2AROC 4ZBJB 1U35D 3B0DC 3FDDA 3V9RA 3X1TA 5BO0B 3C1CD 3AZMC 1S32B 3X1UB 1P3ID 4JJND 5AV6C 3MGSD 3AZKC 3TU4D 4H9SC 3W99A 1P3AD 3O62D 4Z5TA 5AY8C 3REKD 3F6TA 2FFFB 4UUZB 3R45A 5B0ZA 4X23D 3KWQB 3AZLB 3UTAD 5JA4A 4G92B 4WU8D 3AZED 1P3LD 4KHAB 4NE3A 4LD9A 1M1AD 3EPLA 4YM6D 3UT9D 4KUDD 1ZLAB 1EQZD 3WKJC 5AV5C 3P5JB 1P3KC 5B1LD 1P3BC 5KDMA 5G49B 1T3UA 1BH8A 5B31G 1KX4D 2HUEC 4KGCC 4H9OA 2NZDA 4Z2MG 5CPKC 3MGQC 4G91B 3X1UD 2XD1A 1H3OB 5AV8C 2UWXA 3AZJA 3REIA 5GT0D 3KWQD 3REJC 1M19C 3WAAA 3AZLD 5B2JB 2CV5A 3WA9A 2BYKB 3VH6T 5B1MB 1A7WA 2AROB 1KX5C 2ZY2A 3B0DB 1HQ3A 3AZHA 1ZLAD 5GT3A 2F8NB 5B40A 3EPKA 5AV6B
chains in the Genus database with same CATH topology
5B0YC 2YFWA 3LJAC 5GSUA 4H9NB 5DNNA 1TZYA 3B6GD 3REHA 4H9RB 5B33B 4WJ3C 3W96A 3AFAC 5B32G 3WTPC 4WU9D 1P34A 4J8XA 1P3OB 3WKJB 1M18D 4J8WC 1P3BB 3B6FB 5B1MD 2AROD 5F99C 2IO5B 1P3GA 2HUEB 3UTBC 4KGCB 1TAFB 2Y2HA 4QLCD 3MGRC 2F8ND 3H0MC 5CPJA 5B24D 2NQBA 4R8PD 3RELA 1ID3C 4YS3C 5JRGD 5B33D 3AZFA 3LELA 3VH5A 4CAYB 3MGPC 3KFUG 1KX5B 4Z66B 3X1SC 1BFMA 5B32C 3NQJB 1P3OD 4UPKA 3AV2C 3AZIC 3WKJD 1P3BD 3B6FD 1U35A 3AZNC 2Y2PA 5B0YB 3LJAB 3B0CW 4J8XD 3W98C 3C1CA 4KGCD 2PYOC 1P3IA 4JJNA 3MGSA 3TU4A 1P3FD 1P3AA 3O62A 3REKA 1KX3C 4H9QB 5BNXA 4X23A 3KXBD 3AFAB 3W97D 3UTAA 2DF4C 3WTPB 4WU8A 2ZY4A 3AZEA 1P3LA 5FUGB 1M1AA 1F66C 5C3IC 2RIQA 3VH5T 4YM6A 3A6NC 3UT9A 3X1TC 3MNND 2HIOC 3AYWB 5F99B 2F8NK 4KUDA 3MVDC 4Z66D 1KX5D 1EQZA 3UTBB 3W99C 5B1LA 2Y2MA 4Z5TC 2Y2NA 4EO5C 4DQYB 5B0YD 3LJAD 2DQNC 5BO0A 5AV9B 3X1UA 1ID3B 5CP6C 4UUZA 5GT0A 3LZ1D 3KWQA 3AFAD 3MGPB 3AZLA 3WTPD 3AN2C 3EPJA 5BT1D 3AV2B 3AZIB 2NZDC 4XUJD 3KUYC 3AZNB 3AYWD 2Y2QA 1ZLAA 5E5AC 3VH6A 2PYOB 3AZJC 2F2AC 5CPIC 1P3MB 4NFTA 3B6GA 3WTPE 2F8NH 4AWLC 5AV9D 4J8UC 1ID3D 3NQUB 1F66B 5C3IB 2RVQC 3AZHC 3A6NB 4WU9A 3X1TB 5GT3C 1S32D 2HIOB 3MVDB 5B40C 1P3PB 3W99B 2BYKA 1M18A 5B1MA 4Z5TB 5GSUC 5DNMB 5GXQB 2AROA 4EO5B 3AZID 1B67A 2ZM5A 3REHC 3AZND 4QLCA 2BG1A 1KU5A 2F8NA 3C1BC 5AVBC 3W96C 5B24A 4R8PA 1P3MD 5B2IC 5CP6B 3AZMB 1AOIC 5JRGA 3AZKB 4H9RA 5B33A 3AN2B 5KDMB 5AVCC 5AY8B 1BH8B 1F66D 5B31C 2NZDB 3A6ND 3KUYB 2HIOD 1P3OA 4E44A 5CPJC 3MVDD 2G5IC 5E5AB 1P3PD 3WKJA 4H9PB 1P3BA 3B6FA 3X1VC 5DNMD 3RELC 5GXQD 5CPIB 5B2JD 4WNNB 4KGCA 1TAFA 5AV5B 3AZFC 1Z2CB 1P3KB 1P3FA 4J8UB 3AV1C 3KXBA 5CP6D 2W8SA 3W97A 5BS7C 5CPKB 3MGQB 3AZMD 5GT3B 5AV6D 3AZKD 3AN2D 5AV8B 5AY8D 2YFWB 4CAYA 3MNNA 3REJB 1M19B 1KX5A 4Z66A 4JJNC 3B0BA 3KUYD 3REHB 3TU4C 3NQJA 1P3AC 3O62C 1N1JB 4X23C 3C1BB 5AVBB 5B0YA 5CPID 3LJAA 2G5HC 5B2IB 3AZGC 4ZUXC 1M1AC 1JFIA 5AV5D 1P3KD 1AOIB 2YFVA 4J8UD 4YM6C 2BYMB 1Q9CA 4H9QA 3UT9C 3LZ1A 5AVCB 4XZQC 3LZ0C 2ZY3A 3AFAA 2Y2KA 2JSSA 5B31B 4J8VC 3WTPA 5CPKD 3MGQD 4NE5A 5CPJB 1KX4C 5AV8D 2Y2LA 2FJ7C 3X1VB 4XUJA 3REJD 3AYWA 1M19D 3EPHA 4CSRB 3IP4C 3AZFB 4J8WB 5GT0C 5CHLB 3C1BD 3KWQC 5AVBD 3AZLC 3AV1B 4G92C 5B2ID 3MGRB 5AV9A 4E45A 5B0ZC 1ID3A 3H0RC 1AOID 3A1KA 2F8NG 5AVCD 3VH6W 2L5AA 1S32A 4LD9C 5B31D 4YS3B 1F1EA 1P3AB 1ULYA 3O62B 3AZIA 5BNXB 4X23B 3X1VD 3AZNA 3B6GC 3X1SB 4KHAA 5B32B 3AZGB 4ZUXB 1M1AB 4J8WD 3KSYA 1P3MA 4WU9C 4YM6B 5F99D 3UT9B 1BH9B 4XZQB 3AV1D 3LZ0B 3W98B 3UTBD 2VQRA 3MGRD 4J8VB 1HTAA 5G49A 3REIC 1M18C 1KX3B 3WAAC 2CV5C 1KX4B 3WA9C 4M6BA 5BNVB 1F66A 4QLCC 2FJ7B 2ZY5A 3A6NA 4HGAC 2HIOA 1H3OA 4YS3D 3MVDA 1P3PA 1R4VA 5B24C 2JE5A 4R8PC 5DNMA 1HQ3C 3V9RB 5GXQA 5GT0B 3MGPD 5B2JA 3X1SD 5JRGC 2Y2OA 5B33C 5B32D 3AZGD 4ZUXD 5DNNC 1TZYC 2Y2IA 3B0CT 5B0ZB 3R45B 3AV2D 5CP6A 4XZQD 5JA4B 1P3OC 3LZ0D 3W98D 3AZMA 2PYOD 4LD9B 5AV6A 4J8VD 3AZKA 3AN2A 4H9SA 3B6FC 5AY8A 4H9NA 1P34C 1KX3D 2IO5C 4J8XC 2FJ7D 3KUYA 3B6GB 1P3FC 2LY8A 5E5AA 4H9PA 3A1IA 3KXBC 1P3GC 4H9OB 3W97C 3X1TD 5CPIA 2XD5A 4WU9B 4WNNA 5AV5A 3W99D 1P3KA 2NQBC 3AZJB 4Z5TD 1M18B 4J8UA 3REIB 5B0ZD 3MNNC 4WV4B 3WAAB 4Z66C 2CV5B 3WA9B 1PZRA 3VH5W 2J8PA 4QLCB 3LELC 3MGQA 5CPKA 4HGAB 4AWLB 4LD9D 5AV8A 5B24B 1W2EA 3EG5B 4R8PB 1HQ3B 3REJA 3AZHB 1M19A 4Z2MH 5B40B 1U35C 5JRGB 1N1JA 3LZ1C 5GSUB 3C1BA 5DNNB 1TZYB 5AVBA 3C1CC 2NZDD 1P3IC 3MGSC 5B2IA 3REKC 5E5AD 5BT1C 1AOIA 3AZJD 3W96B 4WZSB 2BYMA 4XUJC 3REID 3AL0C 3UTAC 5AVCA 3AYWC 4WU8C 3AZEC 1P34B 1P3LC 3WAAD 4J8XB 2CV5D 3WA9D 4DRAA 5B31A 1P3FB 4KUDC 1P3GB 3KXBB 1EQZC 3X1VA 3W97B 1HQ3D 2RVQD 5B1LC 3AZHD 5AV9C 5FUGA 4CSRA 5GT3D 4ZBJC 1B6WA 5B40D 4J8WA 2NQBB 5GSUD 2Y2GA 1TZYD 5DNND 5F99A 3RELB 3MNNB 3AV1A 3X1UC 1S32C 3REHD 3UTBA 3MGRA 5BS7A 3LELB 2JCHA 3W96D 1P34D 4YS3A 1JFIB 1U35B 2YFVB 3H0LC 1P3MC 3LZ1B 1ZLAC 1P3GD 3MGPA 3C1CB 2Y2JA 3X1SA 1P3IB 4JJNB 3MGSB 3TU4B 1WWIA 5B32A 3AZGA 5CPJD 4ZUXA 3REKB 3AV2A 2NQBD 3RELD 4XUJB 4G91C 1BH9A 4NE6A 4XZQA 4WU8B 3UTAB 3AZEB 3LZ0A 1P3LB 3W98A 1P3PC 2PYOA 4J8VA 3AZFD 3LELD 2CWEA 5DNMC 1WWSA 5GXQC 1KX3A 5B2JC 1KX4A 4KUDB 5BNVA 2FJ7A 1EQZB 5B1LB 5B1MC 4DRBA 3NQUA 2AROC 4ZBJB 1U35D 3B0DC 3FDDA 3V9RA 3X1TA 5BO0B 3C1CD 3AZMC 1S32B 3X1UB 1P3ID 4JJND 5AV6C 3MGSD 3AZKC 3TU4D 4H9SC 3W99A 1P3AD 3O62D 4Z5TA 5AY8C 3REKD 3F6TA 2FFFB 4UUZB 3R45A 5B0ZA 4X23D 3KWQB 3AZLB 3UTAD 5JA4A 4G92B 4WU8D 3AZED 1P3LD 4KHAB 4NE3A 4LD9A 1M1AD 3EPLA 4YM6D 3UT9D 4KUDD 1ZLAB 1EQZD 3WKJC 5AV5C 3P5JB 1P3KC 5B1LD 1P3BC 5KDMA 5G49B 1T3UA 1BH8A 5B31G 1KX4D 2HUEC 4KGCC 4H9OA 2NZDA 4Z2MG 5CPKC 3MGQC 4G91B 3X1UD 2XD1A 1H3OB 5AV8C 2UWXA 3AZJA 3REIA 5GT0D 3KWQD 3REJC 1M19C 3WAAA 3AZLD 5B2JB 2CV5A 3WA9A 2BYKB 3VH6T 5B1MB 1A7WA 2AROB 1KX5C 2ZY2A 3B0DB 1HQ3A 3AZHA 1ZLAD 5GT3A 2F8NB 5B40A 3EPKA 5AV6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Y C;  2YFW A;  3LJA C;  5GSU A;  4H9N B;  5DNN A;  1TZY A;  3B6G D;  3REH A;  4H9R B;  5B33 B;  3W96 A;  3AFA C;  5B32 G;  3WTP C;  4WU9 D;  1P34 A;  4J8X A;  1P3O B;  3WKJ B;  1M18 D;  4J8W C;  1P3B B;  3B6F B;  5B1M D;  2ARO D;  5F99 C;  2IO5 B;  1P3G A;  2HUE B;  3UTB C;  4KGC B;  1TAF B;  4QLC D;  3MGR C;  2F8N D;  5CPJ A;  5B24 D;  2NQB A;  4R8P D;  3REL A;  1ID3 C;  4YS3 C;  5JRG D;  5B33 D;  3AZF A;  3LEL A;  3VH5 A;  4CAY B;  3MGP C;  1KX5 B;  4Z66 B;  3X1S C;  1BFM A;  5B32 C;  3NQJ B;  1P3O D;  3WKJ D;  3AV2 C;  3AZI C;  1P3B D;  3B6F D;  1U35 A;  3AZN C;  5B0Y B;  3LJA B;  3B0C W;  4J8X D;  3W98 C;  3C1C A;  4KGC D;  2PYO C;  1P3I A;  4JJN A;  3MGS A;  3TU4 A;  1P3F D;  1P3A A;  3O62 A;  3REK A;  1KX3 C;  4H9Q B;  5BNX A;  4X23 A;  3KXB D;  3AFA B;  3W97 D;  3UTA A;  3WTP B;  4WU8 A;  3AZE A;  1P3L A;  5FUG B;  1M1A A;  1F66 C;  5C3I C;  3VH5 T;  4YM6 A;  3A6N C;  3UT9 A;  3X1T C;  3MNN D;  2HIO C;  3AYW B;  5F99 B;  2F8N K;  4KUD A;  3MVD C;  4Z66 D;  1KX5 D;  1EQZ A;  3UTB B;  3W99 C;  5B1L A;  4Z5T C;  4EO5 C;  5B0Y D;  3LJA D;  5BO0 A;  5AV9 B;  3X1U A;  1ID3 B;  5CP6 C;  4UUZ A;  5GT0 A;  3LZ1 D;  3KWQ A;  3AFA D;  3MGP B;  3AZL A;  3WTP D;  3AN2 C;  5BT1 D;  3AV2 B;  3AZI B;  2NZD C;  4XUJ D;  3KUY C;  3AZN B;  3AYW D;  1ZLA A;  5E5A C;  3VH6 A;  2PYO B;  3AZJ C;  5CPI C;  1P3M B;  4NFT A;  3B6G A;  3WTP E;  2F8N H;  4AWL C;  5AV9 D;  4J8U C;  1ID3 D;  3NQU B;  1F66 B;  5C3I B;  2RVQ C;  3AZH C;  3A6N B;  4WU9 A;  3X1T B;  5GT3 C;  1S32 D;  2HIO B;  3MVD B;  5B40 C;  1P3P B;  3W99 B;  2BYK A;  1M18 A;  5B1M A;  4Z5T B;  5GSU C;  5DNM B;  5GXQ B;  2ARO A;  4EO5 B;  3AZI D;  1B67 A;  3AZN D;  3REH C;  4QLC A;  1KU5 A;  2F8N A;  3C1B C;  5AVB C;  3W96 C;  5B24 A;  4R8P A;  1P3M D;  5B2I C;  5CP6 B;  3AZM B;  1AOI C;  5JRG A;  3AZK B;  4H9R A;  5B33 A;  3AN2 B;  5KDM B;  5AVC C;  5AY8 B;  1BH8 B;  1F66 D;  5B31 C;  2NZD B;  3A6N D;  3KUY B;  2HIO D;  1P3O A;  4E44 A;  5CPJ C;  3MVD D;  5E5A B;  1P3P D;  3WKJ A;  4H9P B;  1P3B A;  3B6F A;  3X1V C;  5DNM D;  3REL C;  5GXQ D;  5CPI B;  5B2J D;  4WNN B;  4KGC A;  1TAF A;  5AV5 B;  3AZF C;  1P3K B;  1P3F A;  4J8U B;  3AV1 C;  3KXB A;  5CP6 D;  3W97 A;  5BS7 C;  5CPK B;  3MGQ B;  3AZM D;  5GT3 B;  5AV6 D;  3AZK D;  3AN2 D;  5AV8 B;  5AY8 D;  2YFW B;  4CAY A;  3MNN A;  3REJ B;  1M19 B;  1KX5 A;  4Z66 A;  4JJN C;  3B0B A;  3KUY D;  3REH B;  3TU4 C;  3NQJ A;  1P3A C;  3O62 C;  1N1J B;  4X23 C;  3C1B B;  5AVB B;  5B0Y A;  5CPI D;  3LJA A;  5B2I B;  3AZG C;  4ZUX C;  1M1A C;  1JFI A;  5AV5 D;  1P3K D;  1AOI B;  2YFV A;  4J8U D;  4YM6 C;  2BYM B;  1Q9C A;  4H9Q A;  3UT9 C;  3LZ1 A;  5AVC B;  4XZQ C;  3LZ0 C;  3AFA A;  2JSS A;  5B31 B;  4J8V C;  3WTP A;  5CPK D;  3MGQ D;  4NE5 A;  5CPJ B;  1KX4 C;  5AV8 D;  2FJ7 C;  3X1V B;  4XUJ A;  3REJ D;  3AYW A;  1M19 D;  4CSR B;  3AZF B;  4J8W B;  5GT0 C;  5CHL B;  3C1B D;  3KWQ C;  5AVB D;  3AZL C;  3AV1 B;  4G92 C;  5B2I D;  3MGR B;  5AV9 A;  4E45 A;  5B0Z C;  1ID3 A;  1AOI D;  2F8N G;  5AVC D;  3VH6 W;  2L5A A;  1S32 A;  4LD9 C;  5B31 D;  4YS3 B;  1F1E A;  1P3A B;  1ULY A;  3O62 B;  3AZI A;  5BNX B;  4X23 B;  3X1V D;  3AZN A;  3B6G C;  3X1S B;  4KHA A;  5B32 B;  3AZG B;  4ZUX B;  1M1A B;  4J8W D;  3KSY A;  1P3M A;  4WU9 C;  4YM6 B;  5F99 D;  3UT9 B;  1BH9 B;  4XZQ B;  3AV1 D;  3LZ0 B;  3W98 B;  3UTB D;  3MGR D;  4J8V B;  1HTA A;  5G49 A;  3REI C;  1M18 C;  1KX3 B;  3WAA C;  2CV5 C;  1KX4 B;  3WA9 C;  4M6B A;  5BNV B;  1F66 A;  4QLC C;  2FJ7 B;  3A6N A;  4HGA C;  2HIO A;  1H3O A;  4YS3 D;  3MVD A;  1P3P A;  1R4V A;  5B24 C;  4R8P C;  5DNM A;  1HQ3 C;  3V9R B;  5GXQ A;  5GT0 B;  3MGP D;  5B2J A;  3X1S D;  5JRG C;  5B33 C;  5B32 D;  3AZG D;  4ZUX D;  5DNN C;  1TZY C;  3B0C T;  5B0Z B;  3AV2 D;  3R45 B;  5CP6 A;  4XZQ D;  5JA4 B;  1P3O C;  3LZ0 D;  3W98 D;  3AZM A;  2PYO D;  4LD9 B;  5AV6 A;  4J8V D;  3AZK A;  3AN2 A;  4H9S A;  3B6F C;  5AY8 A;  4H9N A;  1P34 C;  1KX3 D;  2IO5 C;  4J8X C;  2FJ7 D;  3KUY A;  3B6G B;  1P3F C;  2LY8 A;  5E5A A;  4H9P A;  3KXB C;  1P3G C;  4H9O B;  3W97 C;  3X1T D;  5CPI A;  4WU9 B;  4WNN A;  5AV5 A;  3W99 D;  1P3K A;  2NQB C;  3AZJ B;  4Z5T D;  1M18 B;  4J8U A;  3REI B;  5B0Z D;  3MNN C;  4WV4 B;  3WAA B;  4Z66 C;  2CV5 B;  3WA9 B;  3VH5 W;  4QLC B;  3LEL C;  5CPK A;  3MGQ A;  4HGA B;  4AWL B;  4LD9 D;  5AV8 A;  5B24 B;  4R8P B;  1HQ3 B;  3REJ A;  3AZH B;  1M19 A;  4Z2M H;  5B40 B;  1U35 C;  5JRG B;  1N1J A;  3LZ1 C;  5GSU B;  3C1B A;  5DNN B;  1TZY B;  5AVB A;  3C1C C;  2NZD D;  1P3I C;  3MGS C;  5B2I A;  3REK C;  5E5A D;  5BT1 C;  1AOI A;  3AZJ D;  3W96 B;  4WZS B;  2BYM A;  4XUJ C;  3REI D;  3UTA C;  5AVC A;  3AYW C;  4WU8 C;  3AZE C;  1P34 B;  1P3L C;  3WAA D;  4J8X B;  2CV5 D;  3WA9 D;  4DRA A;  5B31 A;  1P3F B;  4KUD C;  1P3G B;  3KXB B;  1EQZ C;  3X1V A;  3W97 B;  1HQ3 D;  2RVQ D;  5B1L C;  3AZH D;  5AV9 C;  5FUG A;  4CSR A;  5GT3 D;  4ZBJ C;  1B6W A;  5B40 D;  4J8W A;  2NQB B;  5GSU D;  5DNN D;  1TZY D;  3REL B;  5F99 A;  3MNN B;  3AV1 A;  3X1U C;  1S32 C;  3REH D;  3UTB A;  3MGR A;  5BS7 A;  3LEL B;  3W96 D;  1P34 D;  4YS3 A;  1JFI B;  1U35 B;  2YFV B;  1P3M C;  3LZ1 B;  1ZLA C;  1P3G D;  3MGP A;  3C1C B;  3X1S A;  1P3I B;  4JJN B;  3MGS B;  3TU4 B;  1WWI A;  5B32 A;  3AZG A;  5CPJ D;  4ZUX A;  3REK B;  3AV2 A;  2NQB D;  3REL D;  4XUJ B;  4G91 C;  1BH9 A;  4NE6 A;  4XZQ A;  4WU8 B;  3UTA B;  3AZE B;  3LZ0 A;  1P3L B;  3W98 A;  1P3P C;  2PYO A;  4J8V A;  3AZF D;  3LEL D;  2CWE A;  5DNM C;  1WWS A;  5GXQ C;  1KX3 A;  5B2J C;  1KX4 A;  4KUD B;  5BNV A;  2FJ7 A;  1EQZ B;  5B1L B;  5B1M C;  4DRB A;  3NQU A;  2ARO C;  4ZBJ B;  1U35 D;  3B0D C;  3V9R A;  3X1T A;  5BO0 B;  3C1C D;  3AZM C;  1S32 B;  3X1U B;  1P3I D;  4JJN D;  5AV6 C;  3MGS D;  3AZK C;  3TU4 D;  4H9S C;  3W99 A;  1P3A D;  3O62 D;  4Z5T A;  5AY8 C;  3REK D;  4UUZ B;  5B0Z A;  3R45 A;  4X23 D;  3KWQ B;  3AZL B;  3UTA D;  5JA4 A;  4G92 B;  4WU8 D;  3AZE D;  1P3L D;  4KHA B;  4NE3 A;  4LD9 A;  1M1A D;  4YM6 D;  3UT9 D;  4KUD D;  1ZLA B;  1EQZ D;  3WKJ C;  5AV5 C;  1P3K C;  5B1L D;  1P3B C;  5KDM A;  5G49 B;  1BH8 A;  5B31 G;  1KX4 D;  2HUE C;  4KGC C;  4H9O A;  2NZD A;  4Z2M G;  5CPK C;  3MGQ C;  4G91 B;  3X1U D;  1H3O B;  5AV8 C;  3AZJ A;  3REI A;  5GT0 D;  3KWQ D;  3REJ C;  1M19 C;  3WAA A;  3AZL D;  5B2J B;  2CV5 A;  3WA9 A;  2BYK B;  3VH6 T;  5B1M B;  1A7W A;  2ARO B;  1KX5 C;  3B0D B;  1HQ3 A;  3AZH A;  1ZLA D;  5GT3 A;  2F8N B;  5B40 A;  5AV6 B; 
#chains in the Genus database with same CATH topology
 5B0Y C;  2YFW A;  3LJA C;  5GSU A;  4H9N B;  5DNN A;  1TZY A;  3B6G D;  3REH A;  4H9R B;  5B33 B;  4WJ3 C;  3W96 A;  3AFA C;  5B32 G;  3WTP C;  4WU9 D;  1P34 A;  4J8X A;  1P3O B;  3WKJ B;  1M18 D;  4J8W C;  1P3B B;  3B6F B;  5B1M D;  2ARO D;  5F99 C;  2IO5 B;  1P3G A;  2HUE B;  3UTB C;  4KGC B;  1TAF B;  2Y2H A;  4QLC D;  3MGR C;  2F8N D;  3H0M C;  5CPJ A;  5B24 D;  2NQB A;  4R8P D;  3REL A;  1ID3 C;  4YS3 C;  5JRG D;  5B33 D;  3AZF A;  3LEL A;  3VH5 A;  4CAY B;  3MGP C;  3KFU G;  1KX5 B;  4Z66 B;  3X1S C;  1BFM A;  5B32 C;  3NQJ B;  1P3O D;  4UPK A;  3AV2 C;  3AZI C;  3WKJ D;  1P3B D;  3B6F D;  1U35 A;  3AZN C;  2Y2P A;  5B0Y B;  3LJA B;  3B0C W;  4J8X D;  3W98 C;  3C1C A;  4KGC D;  2PYO C;  1P3I A;  4JJN A;  3MGS A;  3TU4 A;  1P3F D;  1P3A A;  3O62 A;  3REK A;  1KX3 C;  4H9Q B;  5BNX A;  4X23 A;  3KXB D;  3AFA B;  3W97 D;  3UTA A;  2DF4 C;  3WTP B;  4WU8 A;  2ZY4 A;  3AZE A;  1P3L A;  5FUG B;  1M1A A;  1F66 C;  5C3I C;  2RIQ A;  3VH5 T;  4YM6 A;  3A6N C;  3UT9 A;  3X1T C;  3MNN D;  2HIO C;  3AYW B;  5F99 B;  2F8N K;  4KUD A;  3MVD C;  4Z66 D;  1KX5 D;  1EQZ A;  3UTB B;  3W99 C;  5B1L A;  2Y2M A;  4Z5T C;  2Y2N A;  4EO5 C;  4DQY B;  5B0Y D;  3LJA D;  2DQN C;  5BO0 A;  5AV9 B;  3X1U A;  1ID3 B;  5CP6 C;  4UUZ A;  5GT0 A;  3LZ1 D;  3KWQ A;  3AFA D;  3MGP B;  3AZL A;  3WTP D;  3AN2 C;  3EPJ A;  5BT1 D;  3AV2 B;  3AZI B;  2NZD C;  4XUJ D;  3KUY C;  3AZN B;  3AYW D;  2Y2Q A;  1ZLA A;  5E5A C;  3VH6 A;  2PYO B;  3AZJ C;  2F2A C;  5CPI C;  1P3M B;  4NFT A;  3B6G A;  3WTP E;  2F8N H;  4AWL C;  5AV9 D;  4J8U C;  1ID3 D;  3NQU B;  1F66 B;  5C3I B;  2RVQ C;  3AZH C;  3A6N B;  4WU9 A;  3X1T B;  5GT3 C;  1S32 D;  2HIO B;  3MVD B;  5B40 C;  1P3P B;  3W99 B;  2BYK A;  1M18 A;  5B1M A;  4Z5T B;  5GSU C;  5DNM B;  5GXQ B;  2ARO A;  4EO5 B;  3AZI D;  1B67 A;  2ZM5 A;  3REH C;  3AZN D;  4QLC A;  2BG1 A;  1KU5 A;  2F8N A;  3C1B C;  5AVB C;  3W96 C;  5B24 A;  4R8P A;  1P3M D;  5B2I C;  5CP6 B;  3AZM B;  1AOI C;  5JRG A;  3AZK B;  4H9R A;  5B33 A;  3AN2 B;  5KDM B;  5AVC C;  5AY8 B;  1BH8 B;  1F66 D;  5B31 C;  2NZD B;  3A6N D;  3KUY B;  2HIO D;  1P3O A;  4E44 A;  5CPJ C;  3MVD D;  2G5I C;  5E5A B;  1P3P D;  3WKJ A;  4H9P B;  1P3B A;  3B6F A;  3X1V C;  5DNM D;  3REL C;  5GXQ D;  5CPI B;  5B2J D;  4WNN B;  4KGC A;  1TAF A;  5AV5 B;  3AZF C;  1Z2C B;  1P3K B;  1P3F A;  4J8U B;  3AV1 C;  3KXB A;  5CP6 D;  2W8S A;  3W97 A;  5BS7 C;  5CPK B;  3MGQ B;  3AZM D;  5GT3 B;  5AV6 D;  3AZK D;  3AN2 D;  5AV8 B;  5AY8 D;  2YFW B;  4CAY A;  3MNN A;  3REJ B;  1M19 B;  1KX5 A;  4Z66 A;  4JJN C;  3B0B A;  3KUY D;  3REH B;  3TU4 C;  3NQJ A;  1P3A C;  3O62 C;  1N1J B;  4X23 C;  3C1B B;  5AVB B;  5B0Y A;  5CPI D;  3LJA A;  2G5H C;  5B2I B;  3AZG C;  4ZUX C;  1M1A C;  1JFI A;  5AV5 D;  1P3K D;  1AOI B;  2YFV A;  4J8U D;  4YM6 C;  2BYM B;  1Q9C A;  4H9Q A;  3UT9 C;  3LZ1 A;  5AVC B;  4XZQ C;  3LZ0 C;  2ZY3 A;  3AFA A;  2Y2K A;  2JSS A;  5B31 B;  4J8V C;  3WTP A;  5CPK D;  3MGQ D;  4NE5 A;  5CPJ B;  1KX4 C;  5AV8 D;  2Y2L A;  2FJ7 C;  3X1V B;  4XUJ A;  3REJ D;  3AYW A;  1M19 D;  3EPH A;  4CSR B;  3IP4 C;  3AZF B;  4J8W B;  5GT0 C;  5CHL B;  3C1B D;  3KWQ C;  5AVB D;  3AZL C;  3AV1 B;  4G92 C;  5B2I D;  3MGR B;  5AV9 A;  4E45 A;  5B0Z C;  1ID3 A;  3H0R C;  1AOI D;  3A1K A;  2F8N G;  5AVC D;  3VH6 W;  2L5A A;  1S32 A;  4LD9 C;  5B31 D;  4YS3 B;  1F1E A;  1P3A B;  1ULY A;  3O62 B;  3AZI A;  5BNX B;  4X23 B;  3X1V D;  3AZN A;  3B6G C;  3X1S B;  4KHA A;  5B32 B;  3AZG B;  4ZUX B;  1M1A B;  4J8W D;  3KSY A;  1P3M A;  4WU9 C;  4YM6 B;  5F99 D;  3UT9 B;  1BH9 B;  4XZQ B;  3AV1 D;  3LZ0 B;  3W98 B;  3UTB D;  2VQR A;  3MGR D;  4J8V B;  1HTA A;  5G49 A;  3REI C;  1M18 C;  1KX3 B;  3WAA C;  2CV5 C;  1KX4 B;  3WA9 C;  4M6B A;  5BNV B;  1F66 A;  4QLC C;  2FJ7 B;  2ZY5 A;  3A6N A;  4HGA C;  2HIO A;  1H3O A;  4YS3 D;  3MVD A;  1P3P A;  1R4V A;  5B24 C;  2JE5 A;  4R8P C;  5DNM A;  1HQ3 C;  3V9R B;  5GXQ A;  5GT0 B;  3MGP D;  5B2J A;  3X1S D;  5JRG C;  2Y2O A;  5B33 C;  5B32 D;  3AZG D;  4ZUX D;  5DNN C;  1TZY C;  2Y2I A;  3B0C T;  5B0Z B;  3R45 B;  3AV2 D;  5CP6 A;  4XZQ D;  5JA4 B;  1P3O C;  3LZ0 D;  3W98 D;  3AZM A;  2PYO D;  4LD9 B;  5AV6 A;  4J8V D;  3AZK A;  3AN2 A;  4H9S A;  3B6F C;  5AY8 A;  4H9N A;  1P34 C;  1KX3 D;  2IO5 C;  4J8X C;  2FJ7 D;  3KUY A;  3B6G B;  1P3F C;  2LY8 A;  5E5A A;  4H9P A;  3A1I A;  3KXB C;  1P3G C;  4H9O B;  3W97 C;  3X1T D;  5CPI A;  2XD5 A;  4WU9 B;  4WNN A;  5AV5 A;  3W99 D;  1P3K A;  2NQB C;  3AZJ B;  4Z5T D;  1M18 B;  4J8U A;  3REI B;  5B0Z D;  3MNN C;  4WV4 B;  3WAA B;  4Z66 C;  2CV5 B;  3WA9 B;  1PZR A;  3VH5 W;  2J8P A;  4QLC B;  3LEL C;  3MGQ A;  5CPK A;  4HGA B;  4AWL B;  4LD9 D;  5AV8 A;  5B24 B;  1W2E A;  3EG5 B;  4R8P B;  1HQ3 B;  3REJ A;  3AZH B;  1M19 A;  4Z2M H;  5B40 B;  1U35 C;  5JRG B;  1N1J A;  3LZ1 C;  5GSU B;  3C1B A;  5DNN B;  1TZY B;  5AVB A;  3C1C C;  2NZD D;  1P3I C;  3MGS C;  5B2I A;  3REK C;  5E5A D;  5BT1 C;  1AOI A;  3AZJ D;  3W96 B;  4WZS B;  2BYM A;  4XUJ C;  3REI D;  3AL0 C;  3UTA C;  5AVC A;  3AYW C;  4WU8 C;  3AZE C;  1P34 B;  1P3L C;  3WAA D;  4J8X B;  2CV5 D;  3WA9 D;  4DRA A;  5B31 A;  1P3F B;  4KUD C;  1P3G B;  3KXB B;  1EQZ C;  3X1V A;  3W97 B;  1HQ3 D;  2RVQ D;  5B1L C;  3AZH D;  5AV9 C;  5FUG A;  4CSR A;  5GT3 D;  4ZBJ C;  1B6W A;  5B40 D;  4J8W A;  2NQB B;  5GSU D;  2Y2G A;  1TZY D;  5DNN D;  5F99 A;  3REL B;  3MNN B;  3AV1 A;  3X1U C;  1S32 C;  3REH D;  3UTB A;  3MGR A;  5BS7 A;  3LEL B;  2JCH A;  3W96 D;  1P34 D;  4YS3 A;  1JFI B;  1U35 B;  2YFV B;  3H0L C;  1P3M C;  3LZ1 B;  1ZLA C;  1P3G D;  3MGP A;  3C1C B;  2Y2J A;  3X1S A;  1P3I B;  4JJN B;  3MGS B;  3TU4 B;  1WWI A;  5B32 A;  3AZG A;  5CPJ D;  4ZUX A;  3REK B;  3AV2 A;  2NQB D;  3REL D;  4XUJ B;  4G91 C;  1BH9 A;  4NE6 A;  4XZQ A;  4WU8 B;  3UTA B;  3AZE B;  3LZ0 A;  1P3L B;  3W98 A;  1P3P C;  2PYO A;  4J8V A;  3AZF D;  3LEL D;  2CWE A;  5DNM C;  1WWS A;  5GXQ C;  1KX3 A;  5B2J C;  1KX4 A;  4KUD B;  5BNV A;  2FJ7 A;  1EQZ B;  5B1L B;  5B1M C;  4DRB A;  3NQU A;  2ARO C;  4ZBJ B;  1U35 D;  3B0D C;  3FDD A;  3V9R A;  3X1T A;  5BO0 B;  3C1C D;  3AZM C;  1S32 B;  3X1U B;  1P3I D;  4JJN D;  5AV6 C;  3MGS D;  3AZK C;  3TU4 D;  4H9S C;  3W99 A;  1P3A D;  3O62 D;  4Z5T A;  5AY8 C;  3REK D;  3F6T A;  2FFF B;  4UUZ B;  3R45 A;  5B0Z A;  4X23 D;  3KWQ B;  3AZL B;  3UTA D;  5JA4 A;  4G92 B;  4WU8 D;  3AZE D;  1P3L D;  4KHA B;  4NE3 A;  4LD9 A;  1M1A D;  3EPL A;  4YM6 D;  3UT9 D;  4KUD D;  1ZLA B;  1EQZ D;  3WKJ C;  5AV5 C;  3P5J B;  1P3K C;  5B1L D;  1P3B C;  5KDM A;  5G49 B;  1T3U A;  1BH8 A;  5B31 G;  1KX4 D;  2HUE C;  4KGC C;  4H9O A;  2NZD A;  4Z2M G;  5CPK C;  3MGQ C;  4G91 B;  3X1U D;  2XD1 A;  1H3O B;  5AV8 C;  2UWX A;  3AZJ A;  3REI A;  5GT0 D;  3KWQ D;  3REJ C;  1M19 C;  3WAA A;  3AZL D;  5B2J B;  2CV5 A;  3WA9 A;  2BYK B;  3VH6 T;  5B1M B;  1A7W A;  2ARO B;  1KX5 C;  2ZY2 A;  3B0D B;  1HQ3 A;  3AZH A;  1ZLA D;  5GT3 A;  2F8N B;  5B40 A;  3EPK A;  5AV6 B; 
#chains in the Genus database with same CATH homology
 5B0Y C;  2YFW A;  3LJA C;  5GSU A;  4H9N B;  5DNN A;  1TZY A;  3B6G D;  3REH A;  4H9R B;  5B33 B;  4WJ3 C;  3W96 A;  3AFA C;  5B32 G;  3WTP C;  4WU9 D;  1P34 A;  4J8X A;  1P3O B;  3WKJ B;  1M18 D;  4J8W C;  1P3B B;  3B6F B;  5B1M D;  2ARO D;  5F99 C;  2IO5 B;  1P3G A;  2HUE B;  3UTB C;  4KGC B;  1TAF B;  2Y2H A;  4QLC D;  3MGR C;  2F8N D;  3H0M C;  5CPJ A;  5B24 D;  2NQB A;  4R8P D;  3REL A;  1ID3 C;  4YS3 C;  5JRG D;  5B33 D;  3AZF A;  3LEL A;  3VH5 A;  4CAY B;  3MGP C;  3KFU G;  1KX5 B;  4Z66 B;  3X1S C;  1BFM A;  5B32 C;  3NQJ B;  1P3O D;  4UPK A;  3AV2 C;  3AZI C;  3WKJ D;  1P3B D;  3B6F D;  1U35 A;  3AZN C;  2Y2P A;  5B0Y B;  3LJA B;  3B0C W;  4J8X D;  3W98 C;  3C1C A;  4KGC D;  2PYO C;  1P3I A;  4JJN A;  3MGS A;  3TU4 A;  1P3F D;  1P3A A;  3O62 A;  3REK A;  1KX3 C;  4H9Q B;  5BNX A;  4X23 A;  3KXB D;  3AFA B;  3W97 D;  3UTA A;  2DF4 C;  3WTP B;  4WU8 A;  2ZY4 A;  3AZE A;  1P3L A;  5FUG B;  1M1A A;  1F66 C;  5C3I C;  2RIQ A;  3VH5 T;  4YM6 A;  3A6N C;  3UT9 A;  3X1T C;  3MNN D;  2HIO C;  3AYW B;  5F99 B;  2F8N K;  4KUD A;  3MVD C;  4Z66 D;  1KX5 D;  1EQZ A;  3UTB B;  3W99 C;  5B1L A;  2Y2M A;  4Z5T C;  2Y2N A;  4EO5 C;  4DQY B;  5B0Y D;  3LJA D;  2DQN C;  5BO0 A;  5AV9 B;  3X1U A;  1ID3 B;  5CP6 C;  4UUZ A;  5GT0 A;  3LZ1 D;  3KWQ A;  3AFA D;  3MGP B;  3AZL A;  3WTP D;  3AN2 C;  3EPJ A;  5BT1 D;  3AV2 B;  3AZI B;  2NZD C;  4XUJ D;  3KUY C;  3AZN B;  3AYW D;  2Y2Q A;  1ZLA A;  5E5A C;  3VH6 A;  2PYO B;  3AZJ C;  2F2A C;  5CPI C;  1P3M B;  4NFT A;  3B6G A;  3WTP E;  2F8N H;  4AWL C;  5AV9 D;  4J8U C;  1ID3 D;  3NQU B;  1F66 B;  5C3I B;  2RVQ C;  3AZH C;  3A6N B;  4WU9 A;  3X1T B;  5GT3 C;  1S32 D;  2HIO B;  3MVD B;  5B40 C;  1P3P B;  3W99 B;  2BYK A;  1M18 A;  5B1M A;  4Z5T B;  5GSU C;  5DNM B;  5GXQ B;  2ARO A;  4EO5 B;  3AZI D;  1B67 A;  2ZM5 A;  3REH C;  3AZN D;  4QLC A;  2BG1 A;  1KU5 A;  2F8N A;  3C1B C;  5AVB C;  3W96 C;  5B24 A;  4R8P A;  1P3M D;  5B2I C;  5CP6 B;  3AZM B;  1AOI C;  5JRG A;  3AZK B;  4H9R A;  5B33 A;  3AN2 B;  5KDM B;  5AVC C;  5AY8 B;  1BH8 B;  1F66 D;  5B31 C;  2NZD B;  3A6N D;  3KUY B;  2HIO D;  1P3O A;  4E44 A;  5CPJ C;  3MVD D;  2G5I C;  5E5A B;  1P3P D;  3WKJ A;  4H9P B;  1P3B A;  3B6F A;  3X1V C;  5DNM D;  3REL C;  5GXQ D;  5CPI B;  5B2J D;  4WNN B;  4KGC A;  1TAF A;  5AV5 B;  3AZF C;  1Z2C B;  1P3K B;  1P3F A;  4J8U B;  3AV1 C;  3KXB A;  5CP6 D;  2W8S A;  3W97 A;  5BS7 C;  5CPK B;  3MGQ B;  3AZM D;  5GT3 B;  5AV6 D;  3AZK D;  3AN2 D;  5AV8 B;  5AY8 D;  2YFW B;  4CAY A;  3MNN A;  3REJ B;  1M19 B;  1KX5 A;  4Z66 A;  4JJN C;  3B0B A;  3KUY D;  3REH B;  3TU4 C;  3NQJ A;  1P3A C;  3O62 C;  1N1J B;  4X23 C;  3C1B B;  5AVB B;  5B0Y A;  5CPI D;  3LJA A;  2G5H C;  5B2I B;  3AZG C;  4ZUX C;  1M1A C;  1JFI A;  5AV5 D;  1P3K D;  1AOI B;  2YFV A;  4J8U D;  4YM6 C;  2BYM B;  1Q9C A;  4H9Q A;  3UT9 C;  3LZ1 A;  5AVC B;  4XZQ C;  3LZ0 C;  2ZY3 A;  3AFA A;  2Y2K A;  2JSS A;  5B31 B;  4J8V C;  3WTP A;  5CPK D;  3MGQ D;  4NE5 A;  5CPJ B;  1KX4 C;  5AV8 D;  2Y2L A;  2FJ7 C;  3X1V B;  4XUJ A;  3REJ D;  3AYW A;  1M19 D;  3EPH A;  4CSR B;  3IP4 C;  3AZF B;  4J8W B;  5GT0 C;  5CHL B;  3C1B D;  3KWQ C;  5AVB D;  3AZL C;  3AV1 B;  4G92 C;  5B2I D;  3MGR B;  5AV9 A;  4E45 A;  5B0Z C;  1ID3 A;  3H0R C;  1AOI D;  3A1K A;  2F8N G;  5AVC D;  3VH6 W;  2L5A A;  1S32 A;  4LD9 C;  5B31 D;  4YS3 B;  1F1E A;  1P3A B;  1ULY A;  3O62 B;  3AZI A;  5BNX B;  4X23 B;  3X1V D;  3AZN A;  3B6G C;  3X1S B;  4KHA A;  5B32 B;  3AZG B;  4ZUX B;  1M1A B;  4J8W D;  3KSY A;  1P3M A;  4WU9 C;  4YM6 B;  5F99 D;  3UT9 B;  1BH9 B;  4XZQ B;  3AV1 D;  3LZ0 B;  3W98 B;  3UTB D;  2VQR A;  3MGR D;  4J8V B;  1HTA A;  5G49 A;  3REI C;  1M18 C;  1KX3 B;  3WAA C;  2CV5 C;  1KX4 B;  3WA9 C;  4M6B A;  5BNV B;  1F66 A;  4QLC C;  2FJ7 B;  2ZY5 A;  3A6N A;  4HGA C;  2HIO A;  1H3O A;  4YS3 D;  3MVD A;  1P3P A;  1R4V A;  5B24 C;  2JE5 A;  4R8P C;  5DNM A;  1HQ3 C;  3V9R B;  5GXQ A;  5GT0 B;  3MGP D;  5B2J A;  3X1S D;  5JRG C;  2Y2O A;  5B33 C;  5B32 D;  3AZG D;  4ZUX D;  5DNN C;  1TZY C;  2Y2I A;  3B0C T;  5B0Z B;  3R45 B;  3AV2 D;  5CP6 A;  4XZQ D;  5JA4 B;  1P3O C;  3LZ0 D;  3W98 D;  3AZM A;  2PYO D;  4LD9 B;  5AV6 A;  4J8V D;  3AZK A;  3AN2 A;  4H9S A;  3B6F C;  5AY8 A;  4H9N A;  1P34 C;  1KX3 D;  2IO5 C;  4J8X C;  2FJ7 D;  3KUY A;  3B6G B;  1P3F C;  2LY8 A;  5E5A A;  4H9P A;  3A1I A;  3KXB C;  1P3G C;  4H9O B;  3W97 C;  3X1T D;  5CPI A;  2XD5 A;  4WU9 B;  4WNN A;  5AV5 A;  3W99 D;  1P3K A;  2NQB C;  3AZJ B;  4Z5T D;  1M18 B;  4J8U A;  3REI B;  5B0Z D;  3MNN C;  4WV4 B;  3WAA B;  4Z66 C;  2CV5 B;  3WA9 B;  1PZR A;  3VH5 W;  2J8P A;  4QLC B;  3LEL C;  3MGQ A;  5CPK A;  4HGA B;  4AWL B;  4LD9 D;  5AV8 A;  5B24 B;  1W2E A;  3EG5 B;  4R8P B;  1HQ3 B;  3REJ A;  3AZH B;  1M19 A;  4Z2M H;  5B40 B;  1U35 C;  5JRG B;  1N1J A;  3LZ1 C;  5GSU B;  3C1B A;  5DNN B;  1TZY B;  5AVB A;  3C1C C;  2NZD D;  1P3I C;  3MGS C;  5B2I A;  3REK C;  5E5A D;  5BT1 C;  1AOI A;  3AZJ D;  3W96 B;  4WZS B;  2BYM A;  4XUJ C;  3REI D;  3AL0 C;  3UTA C;  5AVC A;  3AYW C;  4WU8 C;  3AZE C;  1P34 B;  1P3L C;  3WAA D;  4J8X B;  2CV5 D;  3WA9 D;  4DRA A;  5B31 A;  1P3F B;  4KUD C;  1P3G B;  3KXB B;  1EQZ C;  3X1V A;  3W97 B;  1HQ3 D;  2RVQ D;  5B1L C;  3AZH D;  5AV9 C;  5FUG A;  4CSR A;  5GT3 D;  4ZBJ C;  1B6W A;  5B40 D;  4J8W A;  2NQB B;  5GSU D;  2Y2G A;  1TZY D;  5DNN D;  5F99 A;  3REL B;  3MNN B;  3AV1 A;  3X1U C;  1S32 C;  3REH D;  3UTB A;  3MGR A;  5BS7 A;  3LEL B;  2JCH A;  3W96 D;  1P34 D;  4YS3 A;  1JFI B;  1U35 B;  2YFV B;  3H0L C;  1P3M C;  3LZ1 B;  1ZLA C;  1P3G D;  3MGP A;  3C1C B;  2Y2J A;  3X1S A;  1P3I B;  4JJN B;  3MGS B;  3TU4 B;  1WWI A;  5B32 A;  3AZG A;  5CPJ D;  4ZUX A;  3REK B;  3AV2 A;  2NQB D;  3REL D;  4XUJ B;  4G91 C;  1BH9 A;  4NE6 A;  4XZQ A;  4WU8 B;  3UTA B;  3AZE B;  3LZ0 A;  1P3L B;  3W98 A;  1P3P C;  2PYO A;  4J8V A;  3AZF D;  3LEL D;  2CWE A;  5DNM C;  1WWS A;  5GXQ C;  1KX3 A;  5B2J C;  1KX4 A;  4KUD B;  5BNV A;  2FJ7 A;  1EQZ B;  5B1L B;  5B1M C;  4DRB A;  3NQU A;  2ARO C;  4ZBJ B;  1U35 D;  3B0D C;  3FDD A;  3V9R A;  3X1T A;  5BO0 B;  3C1C D;  3AZM C;  1S32 B;  3X1U B;  1P3I D;  4JJN D;  5AV6 C;  3MGS D;  3AZK C;  3TU4 D;  4H9S C;  3W99 A;  1P3A D;  3O62 D;  4Z5T A;  5AY8 C;  3REK D;  3F6T A;  2FFF B;  4UUZ B;  3R45 A;  5B0Z A;  4X23 D;  3KWQ B;  3AZL B;  3UTA D;  5JA4 A;  4G92 B;  4WU8 D;  3AZE D;  1P3L D;  4KHA B;  4NE3 A;  4LD9 A;  1M1A D;  3EPL A;  4YM6 D;  3UT9 D;  4KUD D;  1ZLA B;  1EQZ D;  3WKJ C;  5AV5 C;  3P5J B;  1P3K C;  5B1L D;  1P3B C;  5KDM A;  5G49 B;  1T3U A;  1BH8 A;  5B31 G;  1KX4 D;  2HUE C;  4KGC C;  4H9O A;  2NZD A;  4Z2M G;  5CPK C;  3MGQ C;  4G91 B;  3X1U D;  2XD1 A;  1H3O B;  5AV8 C;  2UWX A;  3AZJ A;  3REI A;  5GT0 D;  3KWQ D;  3REJ C;  1M19 C;  3WAA A;  3AZL D;  5B2J B;  2CV5 A;  3WA9 A;  2BYK B;  3VH6 T;  5B1M B;  1A7W A;  2ARO B;  1KX5 C;  2ZY2 A;  3B0D B;  1HQ3 A;  3AZH A;  1ZLA D;  5GT3 A;  2F8N B;  5B40 A;  3EPK A;  5AV6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...