3AZGD

Crystal structure of human nucleosome core particle containing h3k115q mutation
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
molecule keywords Histone H3.1
molecule tags Structural protein/dna
source organism Homo sapiens
total genus 35
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azgD00
1HQ3A 3UTBA 5B40C 2JSSA 3W97C 5B1MB 3KUYB 3UT9D 3B6GD 1TZYD 3X1SA 4J8XA 3C1CB 1M18B 4Z2MG 1B6WA 1TAFA 4ZUXA 3REJD 3REIB 4YS3B 3AZGB 5DNNC 1M1AD 3X1UD 4X23C 3NQUA 3WTPB 5GXQB 4HGAB 5CPIC 4KGCD 1M19C 4XUJA 5B0ZC 3B6FB 4G92B 1U35A 4J8WA 3AZMB 1P3BA 3AV1D 1ZLAB 3AZNA 4H9QA 2NQBB 2F8NB 3VH5W 4Z5TD 3W99C 3REHD 1P3ID 3KXBA 4J8UA 5B31A 3REKC 3LJAA 3MGSD 3X1VA 5G49A 2YFWA 3AZIA 1KX4A 4Z2MH 4AWLC 5B2JA 1P3FC 5C3IB 3W96A 5B1MD 3KUYD 3AZFA 5DNNB 4WU8D 4H9SA 3W98B 4WNNA 4ZBJC 4X23B 3C1CD 1M18D 3WKJC 5BT1C 4Z66C 5CPIB 4KHAB 1N1JB 3REID 4YS3D 5F99C 3AZGD 3AZEA 1P34A 3C1BC 3WTPD 1HTAA 3MGRC 5B1LC 4JJNC 5GSUC 5CPKC 3W99B 4DRAA 3B6FD 4KUDC 3B0CT 2HIOA 4H9OA 3REKB 4LD9A 3X1TC 1ZLAD 5GT0A 3LZ1A 2NQBD 2AROD 3AZJC 4XZQC 1P3GC 5AV8A 4QLCC 2YFVB 3MNNC 1BH8A 1KX3C 5CPJD 3AN2C 4AWLB 3AZHC 1P3AD 1P3LA 1P3OA 1P3FB 5B40D 1P3MA 3W97D 5AV9C 3TU4A 4ZBJB 3WA9C 3WKJB 4Z66B 2NZDC 3VH6A 4R8PC 2BYKB 5F99B 3NQJB 2BYMB 5JRGC 4X23D 3MGPA 1R4VA 3C1BB 4J8WC 5B24D 3B0DC 1AOIC 5GT3D 4NE5A 3MGRB 5B1LB 5CPID 4NE3A 5GSUB 4JJNB 5AY8A 5CPKB 5B0ZD 1M19D 5BNVB 3UTAD 4CAYB 5E5AA 3KWQA 3O62A 2LY8A 3MGQC 5B32B 3LJAC 3X1TB 2FJ7A 2F8NG 1HQ3B 3AZJB 3W99D 1ID3A 1P3GB 5GXQC 2IO5C 4QLCB 4J8XB 3MNNB 4J8VA 3REKD 5JA4B 5B0YC 5B2JC 5AV9B 3MVDA 4H9SC 1KX5D 5KDMB 1B67A 4YM6A 3WA9B 3NQUB 3AZKA 1P3KD 1P3FD 2NZDB 2CV5C 4R8PB 4XUJB 5JRGB 4J8WB 1P34C 4WU9C 2RVQC 3WKJD 3B0DB 1AOIB 5BT1D 5AVBD 4Z66D 3UT9A 3B6GA 5AV5C 1TZYA 5F99D 3LZ0C 5AV6C 5CP6C 3C1BD 5C3IC 3MGQB 3REJA 4M6BA 3LJAB 4E44A 5FUGB 3B0CW 5B1LD 3MGRD 1M1AA 3W98C 4H9RA 5GSUD 3X1UA 3LELC 4JJND 5CPKD 5B33C 4KUDD 2IO5B 3VH5A 4KGCA 1WWSA 1P3LC 3X1TD 5B0YB 5B2JB 5DNMC 3V9RA 3AZJD 4XZQD 1P3GD 3AV1A 4QLCD 1F66D 3MNND 1KX3D 3AN2D 3AZHD 4Z5TA 3REHA 1P3IA 2CV5B 5AV9D 3MGSA 2PYOD 1S32C 1P34B 4WU9B 1P3PC 1JFIA 3WA9D 1BH9B 5AV5B 2NZDD 4R8PD 3R45A 3LZ0B 5AV6B 3AZLC 5JRGD 5CP6B 3WAAC 3RELA 3O62C 1AOID 4G91C 5B1MA 3KUYA 3VH6T 4WU8A 3LZ1B 3AFAC 3LELB 3C1CA 1M18A 1EQZC 5B33B 5AV8B 3MGQD 5B32G 4YS3A 1P3LB 2L5AA 3AZGA 3AYWC 5AVCC 5DNMB 3A6NC 3WTPA 3TU4B 5GXQD 5B2IC 3MVDC 4YM6C 3AV2C 3B6FA 5B0YD 3AZMD 5B32C 1S32B 1ZLAA 2NQBA 1P3PB 1HQ3C 3UTBC 2F8ND 2AROA 5BNXB 5BO0B 2CV5D 4J8XC 3X1SC 5CPJA 1P3AA 4NE6A 3AZLB 3B0BA 5B40A 4WU9D 3WAAB 3W97A 2RVQD 4ZUXC 3O62B 3KWQB 4G91B 5AV5D 1H3OB 2FJ7B 3AFAB 1EQZB 3X1UC 3LZ0D 5AV6D 4H9PB 5CP6D 5B31G 4XUJC 5DNND 3AYWB 5AVCB 1U35C 3A6NB 4X23A 4H9NA 3LELD 3W98D 5B24A 5B33D 5B2IB 3MVDB 5GT3A 1KU5A 3AV1C 5CPIA 1P3BC 4CSRA 3AZNC 1N1JA 1M19A 4YM6B 5B0ZA 3AV2B 3UTAA 3KSYA 5DNMD 3KXBC 4J8UC 5B31C 3VH5T 3MGSC 3X1VC 3UTBB 3AZIC 1KX4C 3W99A 3X1SB 3REKA 4EO5C 1S32D 1P3PD 1TAFB 4ZUXB 3REJB 3W96C 3RELC 3AZFC 4WU8C 1KX5A 3X1UB 3VH6W 3AZLD 1P3KA 1P3FA 3WAAD 1U35B 3AFAD 3AZEC 1EQZD 3V9RB 3WKJA 1P3BB 5AVBA 4Z66A 3AV1B 3AZNB 4H9QB 1A7WA 2BYKA 5F99A 4Z5TB 3REHB 3AYWD 3NQJA 2BYMA 5AVCD 3KXBB 3A6ND 3C1BA 4J8UB 2HIOC 2F8NH 5B31B 4LD9C 5B2ID 3MGSB 3X1VB 3MGRA 5B1LA 5G49B 5GT0C 3LZ1C 5GSUA 2YFWB 4JJNA 5CPKA 2AROC 3AZIB 3AV2D 1KX4B 1JFIB 4KUDA 4CAYA 5AV8C 2HUEC 5CPJC 5B32D 1P3AC 4EO5B 3X1TA 1P3OC 1HQ3D 3UTBD 1P3MC 3RELB 3W96B 3AZJA 4XZQA 3AZFB 1P3GA 3TU4C 4WU8B 4QLCA 1F66A 3X1SD 4WNNB 4UUZA 3MNNA 4J8XD 1KX3A 3AN2A 1F1EA 3AZHA 5JA4A 4ZUXD 5AV9A 2PYOA 3AZEB 5KDMA 3MGPC 3WA9A 5B24C 5GT3C 2NZDA 4R8PA 4XUJD 5AY8C 3UTAC 1U35D 5JRGA 5E5AC 4J8WD 2HIOB 4H9OB 4LD9B 3KWQC 1P3BD 1AOIA 4DRBA 1BFMA 2FJ7C 3AZND 5GT0B 1Q9CA 2AROB 1ID3C 5BS7A 3KXBD 2HUEB 4J8UD 3MGQA 5B31D 4J8VC 1BH8B 3REIA 5CPJB 1P3AB 3LJAD 3X1VD 5FUGA 1P3OB 4E45A 5B40B 1P3MB 3W97B 3AZID 1KX4D 5GXQA 1KX5C 3AZKC 5B0YA 1P3KC 5B2JD 3RELD 3W96D 3AZMA 3AZFD 4H9NB 3MGPB 5CHLB 5B24B 4NFTA 2F8NA 5AVBC 5GT3B 3UT9C 2CV5A 4CSRB 3B6GC 1TZYC 1M19B 5AY8B 5B0ZB 3UTAB 3AZED 5E5AB 4WU9A 1P34D 3REJC 1BH9A 5AV5A 1M1AC 3LZ0A 1ID3B 5AV6A 5CP6A 2HIOD 4J8VB 4KGCC 4LD9D 5DNNA 3W98A 5GT0D 3LZ1D 3WTPE 3LELA 5B33A 4WZSB 5AV8D 4KHAA 1F66C 1KX5B 1P3LD 3AZKB 4Z5TC 3REHC 1P3IC 1P3KB 1P3OD 5DNMA 1P3MD 3TU4D 2PYOC 5AVBB 3UT9B 3B6GB 1TZYB 1S32A 4WV4B 3MGPD 1P3PA 5BNXA 5BO0A 5B1MC 3KUYC 1M1AB 2CWEA 2YFVA 4H9RB 3C1CC 5AY8D 1M18C 3AZLA 4KUDB 5BS7C 5E5AD 1ULYA 3WAAA 4KGCB 3KWQD 3O62D 3REIC 4YS3C 3AZGC 1H3OA 2FJ7D 3AFAA 1EQZA 4XZQB 1ID3D 3WTPC 4HGAC 4H9PA 1F66B 4UUZB 4J8VD 1KX3B 3AN2B 3AZHB 1P3IB 3AYWA 3B6FC 5AVCA 4G92C 3A6NA 3AZMC 5B2IA 3MVDD 2F8NK 2PYOB 1ZLAC 2NQBC 4YM6D 3AV2A 3AZKD 5BNVA 1WWIA 3R45B 5B32A
chains in the Genus database with same CATH superfamily
1HQ3A 3UTBA 5B40C 2JSSA 3W97C 5B1MB 3KUYB 3UT9D 3B6GD 1TZYD 3X1SA 4J8XA 3C1CB 1M18B 4Z2MG 1B6WA 1TAFA 4ZUXA 3REJD 3REIB 4YS3B 3AZGB 5DNNC 1M1AD 3X1UD 4X23C 3NQUA 3WTPB 5GXQB 4HGAB 5CPIC 4KGCD 1M19C 4XUJA 5B0ZC 3B6FB 2DQNC 2G5HC 4G92B 1U35A 4J8WA 3AZMB 1P3BA 3AV1D 1ZLAB 3AZNA 4H9QA 2NQBB 2F8NB 3VH5W 4Z5TD 3W99C 3REHD 1P3ID 3KXBA 4J8UA 5B31A 3REKC 3EPHA 3LJAA 3MGSD 3X1VA 5G49A 2YFWA 2Y2QA 3AZIA 3F6TA 1KX4A 4Z2MH 2UWXA 4AWLC 2G5IC 5B2JA 1P3FC 5C3IB 3W96A 2Y2HA 5B1MD 3KUYD 3AZFA 5DNNB 4WU8D 4H9SA 3W98B 4WNNA 4ZBJC 4X23B 3C1CD 1M18D 2J8PA 3WKJC 5BT1C 4Z66C 5CPIB 4KHAB 1N1JB 3REID 4YS3D 5F99C 3AZGD 3AZEA 1P34A 3C1BC 3WTPD 1HTAA 3MGRC 5B1LC 4JJNC 5GSUC 5CPKC 3W99B 4DRAA 3B6FD 4KUDC 3B0CT 2HIOA 4H9OA 3REKB 4LD9A 3X1TC 1ZLAD 5GT0A 3LZ1A 2NQBD 2AROD 3AZJC 4XZQC 1P3GC 5AV8A 4QLCC 2YFVB 3MNNC 1BH8A 1KX3C 5CPJD 3AN2C 4AWLB 3AZHC 2Y2PA 1P3AD 1P3LA 1P3OA 1P3FB 5B40D 1P3MA 3W97D 5AV9C 3TU4A 4ZBJB 3WA9C 3WKJB 4Z66B 2NZDC 4DQYB 3VH6A 4R8PC 2BYKB 2Y2KA 5F99B 3A1KA 2BYMB 3NQJB 5JRGC 4X23D 2FFFB 1R4VA 3MGPA 3C1BB 5B24D 4J8WC 3B0DC 1AOIC 5GT3D 4NE5A 1Z2CB 5B1LB 3MGRB 2ZM5A 5CPID 4NE3A 5GSUB 4JJNB 5AY8A 5CPKB 5B0ZD 1M19D 5BNVB 3UTAD 4CAYB 5E5AA 3KWQA 3O62A 2LY8A 3MGQC 5B32B 3LJAC 3X1TB 2FJ7A 2F8NG 1HQ3B 3AZJB 3W99D 1ID3A 1P3GB 5GXQC 2IO5C 4QLCB 4J8XB 3MNNB 4J8VA 3REKD 2F2AC 5JA4B 5B0YC 5B2JC 5AV9B 3MVDA 3P5JB 4H9SC 1KX5D 5KDMB 1B67A 4YM6A 3WA9B 3NQUB 3AZKA 1P3KD 1P3FD 2NZDB 2CV5C 4R8PB 4XUJB 3AL0C 5JRGB 4J8WB 1P34C 4WU9C 2RVQC 3WKJD 3B0DB 1AOIB 5BT1D 5AVBD 4Z66D 3UT9A 3B6GA 5AV5C 1TZYA 5F99D 3LZ0C 5AV6C 5CP6C 3C1BD 5C3IC 3MGQB 3REJA 4M6BA 3LJAB 4E44A 5FUGB 3B0CW 5B1LD 3MGRD 1M1AA 3W98C 2XD5A 4H9RA 5GSUD 2JE5A 3X1UA 3LELC 4JJND 5B33C 5CPKD 4KUDD 2IO5B 3VH5A 3EPLA 4KGCA 1WWSA 1P3LC 3X1TD 5B0YB 5B2JB 5DNMC 3V9RA 3AZJD 4XZQD 2Y2IA 1P3GD 3AV1A 4QLCD 1F66D 3MNND 1KX3D 3AN2D 3AZHD 4Z5TA 3REHA 1P3IA 2CV5B 2Y2GA 5AV9D 2XD1A 3MGSA 3EPKA 2PYOD 1S32C 1P34B 4WU9B 1P3PC 1JFIA 3WA9D 1BH9B 5AV5B 2NZDD 4R8PD 3R45A 3LZ0B 5AV6B 3AZLC 5JRGD 5CP6B 3WAAC 3RELA 3O62C 1AOID 4G91C 5B1MA 3KUYA 3VH6T 4WU8A 3LZ1B 3AFAC 3LELB 3C1CA 1M18A 1EQZC 5B33B 3H0LC 5AV8B 3MGQD 5B32G 4YS3A 1P3LB 2L5AA 3AZGA 3AYWC 5AVCC 5DNMB 3A6NC 3WTPA 3TU4B 5GXQD 5B2IC 3MVDC 3KFUG 4YM6C 3AV2C 3B6FA 5B0YD 3AZMD 5B32C 1S32B 1ZLAA 2NQBA 1P3PB 1HQ3C 3UTBC 2F8ND 2AROA 5BNXB 5BO0B 2CV5D 3EPJA 4J8XC 3X1SC 3H0RC 5CPJA 1P3AA 4NE6A 3AZLB 3B0BA 5B40A 4WU9D 3WAAB 3W97A 2RVQD 4ZUXC 3O62B 3KWQB 4G91B 5AV5D 1H3OB 2FJ7B 3AFAB 1EQZB 3X1UC 3LZ0D 5AV6D 4H9PB 5CP6D 5B31G 4XUJC 5DNND 3IP4C 3AYWB 5AVCB 1U35C 3A6NB 4X23A 4H9NA 3LELD 3W98D 5B24A 5B33D 5B2IB 3MVDB 5GT3A 1KU5A 3AV1C 5CPIA 2ZY5A 4CSRA 1P3BC 2ZY4A 3AZNC 1N1JA 1M19A 4YM6B 2VQRA 5B0ZA 3AV2B 3UTAA 3KSYA 5DNMD 3KXBC 2ZY2A 4J8UC 5B31C 3VH5T 3MGSC 3X1VC 3UTBB 3AZIC 1KX4C 3W99A 2Y2LA 3X1SB 3REKA 4EO5C 1S32D 1P3PD 1TAFB 4ZUXB 3REJB 3W96C 3RELC 3AZFC 4WU8C 1KX5A 3X1UB 3VH6W 3AZLD 1P3KA 1P3FA 3WAAD 1U35B 3AFAD 3EG5B 3AZEC 1EQZD 3V9RB 4WJ3C 3WKJA 1P3BB 5AVBA 4Z66A 3AV1B 3AZNB 4H9QB 1A7WA 2BYKA 5F99A 4Z5TB 3REHB 3AYWD 3NQJA 2BYMA 5AVCD 3KXBB 3A6ND 3C1BA 4J8UB 2HIOC 2F8NH 5B31B 4LD9C 5B2ID 3MGSB 3X1VB 3MGRA 5B1LA 5G49B 1W2EA 5GT0C 3LZ1C 5GSUA 2YFWB 4JJNA 5CPKA 2AROC 3AZIB 3AV2D 1KX4B 1JFIB 2ZY3A 4KUDA 4CAYA 5AV8C 2HUEC 5CPJC 5B32D 1P3AC 4EO5B 3X1TA 1P3OC 1HQ3D 3UTBD 1P3MC 3RELB 3W96B 3AZJA 1PZRA 3A1IA 4XZQA 3AZFB 1P3GA 3TU4C 4WU8B 4QLCA 1F66A 3X1SD 4WNNB 4UUZA 3MNNA 4J8XD 1KX3A 3AN2A 1F1EA 3AZHA 2Y2OA 5JA4A 4ZUXD 2BG1A 5AV9A 2PYOA 3AZEB 5KDMA 3MGPC 3WA9A 5B24C 5GT3C 2NZDA 4R8PA 4XUJD 5AY8C 3UTAC 1U35D 5JRGA 5E5AC 4J8WD 2HIOB 4H9OB 4LD9B 3KWQC 1P3BD 1AOIA 4DRBA 1BFMA 2FJ7C 3AZND 5GT0B 1Q9CA 2AROB 1ID3C 2Y2JA 5BS7A 3KXBD 2HUEB 4J8UD 3MGQA 5B31D 4J8VC 1BH8B 3REIA 5CPJB 1P3AB 3LJAD 3X1VD 2DF4C 5FUGA 1P3OB 4E45A 5B40B 1P3MB 3W97B 3AZID 1KX4D 5GXQA 1KX5C 3AZKC 5B0YA 1P3KC 5B2JD 3RELD 3W96D 3AZMA 3H0MC 3AZFD 4H9NB 3MGPB 5CHLB 5B24B 4NFTA 2F8NA 5AVBC 5GT3B 3UT9C 2CV5A 4CSRB 3B6GC 1TZYC 1M19B 5AY8B 5B0ZB 3UTAB 3AZED 5E5AB 4WU9A 1P34D 3REJC 2JCHA 1BH9A 5AV5A 1M1AC 3LZ0A 1ID3B 5AV6A 4UPKA 5CP6A 2HIOD 2Y2NA 4J8VB 4KGCC 4LD9D 5DNNA 3W98A 5GT0D 3LZ1D 3WTPE 3LELA 5B33A 4WZSB 5AV8D 4KHAA 1F66C 1KX5B 1P3LD 3AZKB 4Z5TC 3REHC 1P3IC 1P3KB 1P3OD 5DNMA 1P3MD 3TU4D 2PYOC 5AVBB 3UT9B 3B6GB 1TZYB 1S32A 2RIQA 2Y2MA 4WV4B 3MGPD 1P3PA 5BNXA 5BO0A 5B1MC 3KUYC 1M1AB 2CWEA 2YFVA 4H9RB 3C1CC 5AY8D 1M18C 3AZLA 4KUDB 5BS7C 5E5AD 1ULYA 3WAAA 4KGCB 3KWQD 3O62D 3REIC 4YS3C 3FDDA 3AZGC 1H3OA 2FJ7D 3AFAA 1EQZA 4XZQB 1ID3D 3WTPC 4HGAC 4H9PA 1F66B 1T3UA 4UUZB 4J8VD 1KX3B 3AN2B 3AZHB 1P3IB 3AYWA 3B6FC 5AVCA 4G92C 3A6NA 2W8SA 3AZMC 5B2IA 3MVDD 2F8NK 2PYOB 1ZLAC 2NQBC 4YM6D 3AV2A 3AZKD 5BNVA 1WWIA 3R45B 5B32A
chains in the Genus database with same CATH topology
1HQ3A 3UTBA 5B40C 2JSSA 3W97C 5B1MB 3KUYB 3UT9D 3B6GD 1TZYD 3X1SA 4J8XA 3C1CB 1M18B 4Z2MG 1B6WA 1TAFA 4ZUXA 3REJD 3REIB 4YS3B 3AZGB 5DNNC 1M1AD 3X1UD 4X23C 3NQUA 3WTPB 5GXQB 4HGAB 5CPIC 4KGCD 1M19C 4XUJA 5B0ZC 3B6FB 2DQNC 2G5HC 4G92B 1U35A 4J8WA 3AZMB 1P3BA 3AV1D 1ZLAB 3AZNA 4H9QA 2NQBB 2F8NB 3VH5W 4Z5TD 3W99C 3REHD 1P3ID 3KXBA 4J8UA 5B31A 3REKC 3EPHA 3LJAA 3MGSD 3X1VA 5G49A 2YFWA 2Y2QA 3AZIA 3F6TA 1KX4A 4Z2MH 2UWXA 4AWLC 2G5IC 5B2JA 1P3FC 5C3IB 3W96A 2Y2HA 5B1MD 3KUYD 3AZFA 5DNNB 4WU8D 4H9SA 3W98B 4WNNA 4ZBJC 4X23B 3C1CD 1M18D 2J8PA 3WKJC 5BT1C 4Z66C 5CPIB 4KHAB 1N1JB 3REID 4YS3D 5F99C 3AZGD 3AZEA 1P34A 3C1BC 3WTPD 1HTAA 3MGRC 5B1LC 4JJNC 5GSUC 5CPKC 3W99B 4DRAA 3B6FD 4KUDC 3B0CT 2HIOA 4H9OA 3REKB 4LD9A 3X1TC 1ZLAD 5GT0A 3LZ1A 2NQBD 2AROD 3AZJC 4XZQC 1P3GC 5AV8A 4QLCC 2YFVB 3MNNC 1BH8A 1KX3C 5CPJD 3AN2C 4AWLB 3AZHC 2Y2PA 1P3AD 1P3LA 1P3OA 1P3FB 5B40D 1P3MA 3W97D 5AV9C 3TU4A 4ZBJB 3WA9C 3WKJB 4Z66B 2NZDC 4DQYB 3VH6A 4R8PC 2BYKB 2Y2KA 5F99B 3A1KA 2BYMB 3NQJB 5JRGC 4X23D 2FFFB 1R4VA 3MGPA 3C1BB 5B24D 4J8WC 3B0DC 1AOIC 5GT3D 4NE5A 1Z2CB 5B1LB 3MGRB 2ZM5A 5CPID 4NE3A 5GSUB 4JJNB 5AY8A 5CPKB 5B0ZD 1M19D 5BNVB 3UTAD 4CAYB 5E5AA 3KWQA 3O62A 2LY8A 3MGQC 5B32B 3LJAC 3X1TB 2FJ7A 2F8NG 1HQ3B 3AZJB 3W99D 1ID3A 1P3GB 5GXQC 2IO5C 4QLCB 4J8XB 3MNNB 4J8VA 3REKD 2F2AC 5JA4B 5B0YC 5B2JC 5AV9B 3MVDA 3P5JB 4H9SC 1KX5D 5KDMB 1B67A 4YM6A 3WA9B 3NQUB 3AZKA 1P3KD 1P3FD 2NZDB 2CV5C 4R8PB 4XUJB 3AL0C 5JRGB 4J8WB 1P34C 4WU9C 2RVQC 3WKJD 3B0DB 1AOIB 5BT1D 5AVBD 4Z66D 3UT9A 3B6GA 5AV5C 1TZYA 5F99D 3LZ0C 5AV6C 5CP6C 3C1BD 5C3IC 3MGQB 3REJA 4M6BA 3LJAB 4E44A 5FUGB 3B0CW 5B1LD 3MGRD 1M1AA 3W98C 2XD5A 4H9RA 5GSUD 2JE5A 3X1UA 3LELC 4JJND 5B33C 5CPKD 4KUDD 2IO5B 3VH5A 3EPLA 4KGCA 1WWSA 1P3LC 3X1TD 5B0YB 5B2JB 5DNMC 3V9RA 3AZJD 4XZQD 2Y2IA 1P3GD 3AV1A 4QLCD 1F66D 3MNND 1KX3D 3AN2D 3AZHD 4Z5TA 3REHA 1P3IA 2CV5B 2Y2GA 5AV9D 2XD1A 3MGSA 3EPKA 2PYOD 1S32C 1P34B 4WU9B 1P3PC 1JFIA 3WA9D 1BH9B 5AV5B 2NZDD 4R8PD 3R45A 3LZ0B 5AV6B 3AZLC 5JRGD 5CP6B 3WAAC 3RELA 3O62C 1AOID 4G91C 5B1MA 3KUYA 3VH6T 4WU8A 3LZ1B 3AFAC 3LELB 3C1CA 1M18A 1EQZC 5B33B 3H0LC 5AV8B 3MGQD 5B32G 4YS3A 1P3LB 2L5AA 3AZGA 3AYWC 5AVCC 5DNMB 3A6NC 3WTPA 3TU4B 5GXQD 5B2IC 3MVDC 3KFUG 4YM6C 3AV2C 3B6FA 5B0YD 3AZMD 5B32C 1S32B 1ZLAA 2NQBA 1P3PB 1HQ3C 3UTBC 2F8ND 2AROA 5BNXB 5BO0B 2CV5D 3EPJA 4J8XC 3X1SC 3H0RC 5CPJA 1P3AA 4NE6A 3AZLB 3B0BA 5B40A 4WU9D 3WAAB 3W97A 2RVQD 4ZUXC 3O62B 3KWQB 4G91B 5AV5D 1H3OB 2FJ7B 3AFAB 1EQZB 3X1UC 3LZ0D 5AV6D 4H9PB 5CP6D 5B31G 4XUJC 5DNND 3IP4C 3AYWB 5AVCB 1U35C 3A6NB 4X23A 4H9NA 3LELD 3W98D 5B24A 5B33D 5B2IB 3MVDB 5GT3A 1KU5A 3AV1C 5CPIA 2ZY5A 4CSRA 1P3BC 2ZY4A 3AZNC 1N1JA 1M19A 4YM6B 2VQRA 5B0ZA 3AV2B 3UTAA 3KSYA 5DNMD 3KXBC 2ZY2A 4J8UC 5B31C 3VH5T 3MGSC 3X1VC 3UTBB 3AZIC 1KX4C 3W99A 2Y2LA 3X1SB 3REKA 4EO5C 1S32D 1P3PD 1TAFB 4ZUXB 3REJB 3W96C 3RELC 3AZFC 4WU8C 1KX5A 3X1UB 3VH6W 3AZLD 1P3KA 1P3FA 3WAAD 1U35B 3AFAD 3EG5B 3AZEC 1EQZD 3V9RB 4WJ3C 3WKJA 1P3BB 5AVBA 4Z66A 3AV1B 3AZNB 4H9QB 1A7WA 2BYKA 5F99A 4Z5TB 3REHB 3AYWD 3NQJA 2BYMA 5AVCD 3KXBB 3A6ND 3C1BA 4J8UB 2HIOC 2F8NH 5B31B 4LD9C 5B2ID 3MGSB 3X1VB 3MGRA 5B1LA 5G49B 1W2EA 5GT0C 3LZ1C 5GSUA 2YFWB 4JJNA 5CPKA 2AROC 3AZIB 3AV2D 1KX4B 1JFIB 2ZY3A 4KUDA 4CAYA 5AV8C 2HUEC 5CPJC 5B32D 1P3AC 4EO5B 3X1TA 1P3OC 1HQ3D 3UTBD 1P3MC 3RELB 3W96B 3AZJA 1PZRA 3A1IA 4XZQA 3AZFB 1P3GA 3TU4C 4WU8B 4QLCA 1F66A 3X1SD 4WNNB 4UUZA 3MNNA 4J8XD 1KX3A 3AN2A 1F1EA 3AZHA 2Y2OA 5JA4A 4ZUXD 2BG1A 5AV9A 2PYOA 3AZEB 5KDMA 3MGPC 3WA9A 5B24C 5GT3C 2NZDA 4R8PA 4XUJD 5AY8C 3UTAC 1U35D 5JRGA 5E5AC 4J8WD 2HIOB 4H9OB 4LD9B 3KWQC 1P3BD 1AOIA 4DRBA 1BFMA 2FJ7C 3AZND 5GT0B 1Q9CA 2AROB 1ID3C 2Y2JA 5BS7A 3KXBD 2HUEB 4J8UD 3MGQA 5B31D 4J8VC 1BH8B 3REIA 5CPJB 1P3AB 3LJAD 3X1VD 2DF4C 5FUGA 1P3OB 4E45A 5B40B 1P3MB 3W97B 3AZID 1KX4D 5GXQA 1KX5C 3AZKC 5B0YA 1P3KC 5B2JD 3RELD 3W96D 3AZMA 3H0MC 3AZFD 4H9NB 3MGPB 5CHLB 5B24B 4NFTA 2F8NA 5AVBC 5GT3B 3UT9C 2CV5A 4CSRB 3B6GC 1TZYC 1M19B 5AY8B 5B0ZB 3UTAB 3AZED 5E5AB 4WU9A 1P34D 3REJC 2JCHA 1BH9A 5AV5A 1M1AC 3LZ0A 1ID3B 5AV6A 4UPKA 5CP6A 2HIOD 2Y2NA 4J8VB 4KGCC 4LD9D 5DNNA 3W98A 5GT0D 3LZ1D 3WTPE 3LELA 5B33A 4WZSB 5AV8D 4KHAA 1F66C 1KX5B 1P3LD 3AZKB 4Z5TC 3REHC 1P3IC 1P3KB 1P3OD 5DNMA 1P3MD 3TU4D 2PYOC 5AVBB 3UT9B 3B6GB 1TZYB 1S32A 2RIQA 2Y2MA 4WV4B 3MGPD 1P3PA 5BNXA 5BO0A 5B1MC 3KUYC 1M1AB 2CWEA 2YFVA 4H9RB 3C1CC 5AY8D 1M18C 3AZLA 4KUDB 5BS7C 5E5AD 1ULYA 3WAAA 4KGCB 3KWQD 3O62D 3REIC 4YS3C 3FDDA 3AZGC 1H3OA 2FJ7D 3AFAA 1EQZA 4XZQB 1ID3D 3WTPC 4HGAC 4H9PA 1F66B 1T3UA 4UUZB 4J8VD 1KX3B 3AN2B 3AZHB 1P3IB 3AYWA 3B6FC 5AVCA 4G92C 3A6NA 2W8SA 3AZMC 5B2IA 3MVDD 2F8NK 2PYOB 1ZLAC 2NQBC 4YM6D 3AV2A 3AZKD 5BNVA 1WWIA 3R45B 5B32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQ3 A;  3UTB A;  5B40 C;  2JSS A;  3W97 C;  5B1M B;  3KUY B;  3UT9 D;  3B6G D;  1TZY D;  3X1S A;  4J8X A;  3C1C B;  1M18 B;  4Z2M G;  1B6W A;  1TAF A;  4ZUX A;  3REJ D;  3REI B;  4YS3 B;  3AZG B;  5DNN C;  1M1A D;  3X1U D;  4X23 C;  3NQU A;  3WTP B;  5GXQ B;  4HGA B;  5CPI C;  4KGC D;  1M19 C;  4XUJ A;  5B0Z C;  3B6F B;  4G92 B;  1U35 A;  4J8W A;  3AZM B;  1P3B A;  3AV1 D;  1ZLA B;  3AZN A;  4H9Q A;  2NQB B;  2F8N B;  3VH5 W;  4Z5T D;  3W99 C;  3REH D;  1P3I D;  3KXB A;  4J8U A;  5B31 A;  3REK C;  3LJA A;  3MGS D;  3X1V A;  5G49 A;  2YFW A;  3AZI A;  1KX4 A;  4Z2M H;  4AWL C;  5B2J A;  1P3F C;  5C3I B;  3W96 A;  5B1M D;  3KUY D;  3AZF A;  5DNN B;  4WU8 D;  4H9S A;  3W98 B;  4WNN A;  4ZBJ C;  4X23 B;  3C1C D;  1M18 D;  3WKJ C;  5BT1 C;  4Z66 C;  5CPI B;  4KHA B;  1N1J B;  3REI D;  4YS3 D;  5F99 C;  3AZG D;  3AZE A;  1P34 A;  3C1B C;  3WTP D;  1HTA A;  3MGR C;  5B1L C;  4JJN C;  5GSU C;  5CPK C;  3W99 B;  4DRA A;  3B6F D;  4KUD C;  3B0C T;  2HIO A;  4H9O A;  3REK B;  4LD9 A;  3X1T C;  1ZLA D;  5GT0 A;  3LZ1 A;  2NQB D;  2ARO D;  3AZJ C;  4XZQ C;  1P3G C;  5AV8 A;  4QLC C;  2YFV B;  3MNN C;  1BH8 A;  1KX3 C;  5CPJ D;  3AN2 C;  4AWL B;  3AZH C;  1P3A D;  1P3L A;  1P3O A;  1P3F B;  5B40 D;  1P3M A;  3W97 D;  5AV9 C;  3TU4 A;  4ZBJ B;  3WA9 C;  3WKJ B;  4Z66 B;  2NZD C;  3VH6 A;  4R8P C;  2BYK B;  5F99 B;  3NQJ B;  2BYM B;  5JRG C;  4X23 D;  3MGP A;  1R4V A;  3C1B B;  4J8W C;  5B24 D;  3B0D C;  1AOI C;  5GT3 D;  4NE5 A;  3MGR B;  5B1L B;  5CPI D;  4NE3 A;  5GSU B;  4JJN B;  5AY8 A;  5CPK B;  5B0Z D;  1M19 D;  5BNV B;  3UTA D;  4CAY B;  5E5A A;  3KWQ A;  3O62 A;  2LY8 A;  3MGQ C;  5B32 B;  3LJA C;  3X1T B;  2FJ7 A;  2F8N G;  1HQ3 B;  3AZJ B;  3W99 D;  1ID3 A;  1P3G B;  5GXQ C;  2IO5 C;  4QLC B;  4J8X B;  3MNN B;  4J8V A;  3REK D;  5JA4 B;  5B0Y C;  5B2J C;  5AV9 B;  3MVD A;  4H9S C;  1KX5 D;  5KDM B;  1B67 A;  4YM6 A;  3WA9 B;  3NQU B;  3AZK A;  1P3K D;  1P3F D;  2NZD B;  2CV5 C;  4R8P B;  4XUJ B;  5JRG B;  4J8W B;  1P34 C;  4WU9 C;  2RVQ C;  3WKJ D;  3B0D B;  1AOI B;  5BT1 D;  5AVB D;  4Z66 D;  3UT9 A;  3B6G A;  5AV5 C;  1TZY A;  5F99 D;  3LZ0 C;  5AV6 C;  5CP6 C;  3C1B D;  5C3I C;  3MGQ B;  3REJ A;  4M6B A;  3LJA B;  4E44 A;  5FUG B;  3B0C W;  5B1L D;  3MGR D;  1M1A A;  3W98 C;  4H9R A;  5GSU D;  3X1U A;  3LEL C;  4JJN D;  5CPK D;  5B33 C;  4KUD D;  2IO5 B;  3VH5 A;  4KGC A;  1WWS A;  1P3L C;  3X1T D;  5B0Y B;  5B2J B;  5DNM C;  3V9R A;  3AZJ D;  4XZQ D;  1P3G D;  3AV1 A;  4QLC D;  1F66 D;  3MNN D;  1KX3 D;  3AN2 D;  3AZH D;  4Z5T A;  3REH A;  1P3I A;  2CV5 B;  5AV9 D;  3MGS A;  2PYO D;  1S32 C;  1P34 B;  4WU9 B;  1P3P C;  1JFI A;  3WA9 D;  1BH9 B;  5AV5 B;  2NZD D;  4R8P D;  3R45 A;  3LZ0 B;  5AV6 B;  3AZL C;  5JRG D;  5CP6 B;  3WAA C;  3REL A;  3O62 C;  1AOI D;  4G91 C;  5B1M A;  3KUY A;  3VH6 T;  4WU8 A;  3LZ1 B;  3AFA C;  3LEL B;  3C1C A;  1M18 A;  1EQZ C;  5B33 B;  5AV8 B;  3MGQ D;  5B32 G;  4YS3 A;  1P3L B;  2L5A A;  3AZG A;  3AYW C;  5AVC C;  5DNM B;  3A6N C;  3WTP A;  3TU4 B;  5GXQ D;  5B2I C;  3MVD C;  4YM6 C;  3AV2 C;  3B6F A;  5B0Y D;  3AZM D;  5B32 C;  1S32 B;  1ZLA A;  2NQB A;  1P3P B;  1HQ3 C;  3UTB C;  2F8N D;  2ARO A;  5BNX B;  5BO0 B;  2CV5 D;  4J8X C;  3X1S C;  5CPJ A;  1P3A A;  4NE6 A;  3AZL B;  3B0B A;  5B40 A;  4WU9 D;  3WAA B;  3W97 A;  2RVQ D;  4ZUX C;  3O62 B;  3KWQ B;  4G91 B;  5AV5 D;  1H3O B;  2FJ7 B;  3AFA B;  1EQZ B;  3X1U C;  3LZ0 D;  5AV6 D;  4H9P B;  5CP6 D;  5B31 G;  4XUJ C;  5DNN D;  3AYW B;  5AVC B;  1U35 C;  3A6N B;  4X23 A;  4H9N A;  3LEL D;  3W98 D;  5B24 A;  5B33 D;  5B2I B;  3MVD B;  5GT3 A;  1KU5 A;  3AV1 C;  5CPI A;  1P3B C;  4CSR A;  3AZN C;  1N1J A;  1M19 A;  4YM6 B;  5B0Z A;  3AV2 B;  3UTA A;  3KSY A;  5DNM D;  3KXB C;  4J8U C;  5B31 C;  3VH5 T;  3MGS C;  3X1V C;  3UTB B;  3AZI C;  1KX4 C;  3W99 A;  3X1S B;  3REK A;  4EO5 C;  1S32 D;  1P3P D;  1TAF B;  4ZUX B;  3REJ B;  3W96 C;  3REL C;  3AZF C;  4WU8 C;  1KX5 A;  3X1U B;  3VH6 W;  3AZL D;  1P3K A;  1P3F A;  3WAA D;  1U35 B;  3AFA D;  3AZE C;  1EQZ D;  3V9R B;  3WKJ A;  1P3B B;  5AVB A;  4Z66 A;  3AV1 B;  3AZN B;  4H9Q B;  1A7W A;  2BYK A;  5F99 A;  4Z5T B;  3REH B;  3AYW D;  3NQJ A;  2BYM A;  5AVC D;  3KXB B;  3A6N D;  3C1B A;  4J8U B;  2HIO C;  2F8N H;  5B31 B;  4LD9 C;  5B2I D;  3MGS B;  3X1V B;  3MGR A;  5B1L A;  5G49 B;  5GT0 C;  3LZ1 C;  5GSU A;  2YFW B;  4JJN A;  5CPK A;  2ARO C;  3AZI B;  3AV2 D;  1KX4 B;  1JFI B;  4KUD A;  4CAY A;  5AV8 C;  2HUE C;  5CPJ C;  5B32 D;  1P3A C;  4EO5 B;  3X1T A;  1P3O C;  1HQ3 D;  3UTB D;  1P3M C;  3REL B;  3W96 B;  3AZJ A;  4XZQ A;  3AZF B;  1P3G A;  3TU4 C;  4WU8 B;  4QLC A;  1F66 A;  3X1S D;  4WNN B;  4UUZ A;  3MNN A;  4J8X D;  1KX3 A;  3AN2 A;  1F1E A;  3AZH A;  5JA4 A;  4ZUX D;  5AV9 A;  2PYO A;  3AZE B;  5KDM A;  3MGP C;  3WA9 A;  5B24 C;  5GT3 C;  2NZD A;  4R8P A;  4XUJ D;  5AY8 C;  3UTA C;  1U35 D;  5JRG A;  5E5A C;  4J8W D;  2HIO B;  4H9O B;  4LD9 B;  3KWQ C;  1P3B D;  1AOI A;  4DRB A;  1BFM A;  2FJ7 C;  3AZN D;  5GT0 B;  1Q9C A;  2ARO B;  1ID3 C;  5BS7 A;  3KXB D;  2HUE B;  4J8U D;  3MGQ A;  5B31 D;  4J8V C;  1BH8 B;  3REI A;  5CPJ B;  1P3A B;  3LJA D;  3X1V D;  5FUG A;  1P3O B;  4E45 A;  5B40 B;  1P3M B;  3W97 B;  3AZI D;  1KX4 D;  5GXQ A;  1KX5 C;  3AZK C;  5B0Y A;  1P3K C;  5B2J D;  3REL D;  3W96 D;  3AZM A;  3AZF D;  4H9N B;  3MGP B;  5CHL B;  5B24 B;  4NFT A;  2F8N A;  5AVB C;  5GT3 B;  3UT9 C;  2CV5 A;  4CSR B;  3B6G C;  1TZY C;  1M19 B;  5AY8 B;  5B0Z B;  3UTA B;  3AZE D;  5E5A B;  4WU9 A;  1P34 D;  3REJ C;  1BH9 A;  5AV5 A;  1M1A C;  3LZ0 A;  1ID3 B;  5AV6 A;  5CP6 A;  2HIO D;  4J8V B;  4KGC C;  4LD9 D;  5DNN A;  3W98 A;  5GT0 D;  3LZ1 D;  3WTP E;  3LEL A;  5B33 A;  4WZS B;  5AV8 D;  4KHA A;  1F66 C;  1KX5 B;  1P3L D;  3AZK B;  4Z5T C;  3REH C;  1P3I C;  1P3K B;  1P3O D;  5DNM A;  1P3M D;  3TU4 D;  2PYO C;  5AVB B;  3UT9 B;  3B6G B;  1TZY B;  1S32 A;  4WV4 B;  3MGP D;  1P3P A;  5BNX A;  5BO0 A;  5B1M C;  3KUY C;  1M1A B;  2CWE A;  2YFV A;  4H9R B;  3C1C C;  5AY8 D;  1M18 C;  3AZL A;  4KUD B;  5BS7 C;  5E5A D;  1ULY A;  3WAA A;  4KGC B;  3KWQ D;  3O62 D;  3REI C;  4YS3 C;  3AZG C;  1H3O A;  2FJ7 D;  3AFA A;  1EQZ A;  4XZQ B;  1ID3 D;  3WTP C;  4HGA C;  4H9P A;  1F66 B;  4UUZ B;  4J8V D;  1KX3 B;  3AN2 B;  3AZH B;  1P3I B;  3AYW A;  3B6F C;  5AVC A;  4G92 C;  3A6N A;  3AZM C;  5B2I A;  3MVD D;  2F8N K;  2PYO B;  1ZLA C;  2NQB C;  4YM6 D;  3AV2 A;  3AZK D;  5BNV A;  1WWI A;  3R45 B;  5B32 A; 
#chains in the Genus database with same CATH topology
 1HQ3 A;  3UTB A;  5B40 C;  2JSS A;  3W97 C;  5B1M B;  3KUY B;  3UT9 D;  3B6G D;  1TZY D;  3X1S A;  4J8X A;  3C1C B;  1M18 B;  4Z2M G;  1B6W A;  1TAF A;  4ZUX A;  3REJ D;  3REI B;  4YS3 B;  3AZG B;  5DNN C;  1M1A D;  3X1U D;  4X23 C;  3NQU A;  3WTP B;  5GXQ B;  4HGA B;  5CPI C;  4KGC D;  1M19 C;  4XUJ A;  5B0Z C;  3B6F B;  2DQN C;  2G5H C;  4G92 B;  1U35 A;  4J8W A;  3AZM B;  1P3B A;  3AV1 D;  1ZLA B;  3AZN A;  4H9Q A;  2NQB B;  2F8N B;  3VH5 W;  4Z5T D;  3W99 C;  3REH D;  1P3I D;  3KXB A;  4J8U A;  5B31 A;  3REK C;  3EPH A;  3LJA A;  3MGS D;  3X1V A;  5G49 A;  2YFW A;  2Y2Q A;  3AZI A;  3F6T A;  1KX4 A;  4Z2M H;  2UWX A;  4AWL C;  2G5I C;  5B2J A;  1P3F C;  5C3I B;  3W96 A;  2Y2H A;  5B1M D;  3KUY D;  3AZF A;  5DNN B;  4WU8 D;  4H9S A;  3W98 B;  4WNN A;  4ZBJ C;  4X23 B;  3C1C D;  1M18 D;  2J8P A;  3WKJ C;  5BT1 C;  4Z66 C;  5CPI B;  4KHA B;  1N1J B;  3REI D;  4YS3 D;  5F99 C;  3AZG D;  3AZE A;  1P34 A;  3C1B C;  3WTP D;  1HTA A;  3MGR C;  5B1L C;  4JJN C;  5GSU C;  5CPK C;  3W99 B;  4DRA A;  3B6F D;  4KUD C;  3B0C T;  2HIO A;  4H9O A;  3REK B;  4LD9 A;  3X1T C;  1ZLA D;  5GT0 A;  3LZ1 A;  2NQB D;  2ARO D;  3AZJ C;  4XZQ C;  1P3G C;  5AV8 A;  4QLC C;  2YFV B;  3MNN C;  1BH8 A;  1KX3 C;  5CPJ D;  3AN2 C;  4AWL B;  3AZH C;  2Y2P A;  1P3A D;  1P3L A;  1P3O A;  1P3F B;  5B40 D;  1P3M A;  3W97 D;  5AV9 C;  3TU4 A;  4ZBJ B;  3WA9 C;  3WKJ B;  4Z66 B;  2NZD C;  4DQY B;  3VH6 A;  4R8P C;  2BYK B;  2Y2K A;  5F99 B;  3A1K A;  2BYM B;  3NQJ B;  5JRG C;  4X23 D;  2FFF B;  1R4V A;  3MGP A;  3C1B B;  5B24 D;  4J8W C;  3B0D C;  1AOI C;  5GT3 D;  4NE5 A;  1Z2C B;  5B1L B;  3MGR B;  2ZM5 A;  5CPI D;  4NE3 A;  5GSU B;  4JJN B;  5AY8 A;  5CPK B;  5B0Z D;  1M19 D;  5BNV B;  3UTA D;  4CAY B;  5E5A A;  3KWQ A;  3O62 A;  2LY8 A;  3MGQ C;  5B32 B;  3LJA C;  3X1T B;  2FJ7 A;  2F8N G;  1HQ3 B;  3AZJ B;  3W99 D;  1ID3 A;  1P3G B;  5GXQ C;  2IO5 C;  4QLC B;  4J8X B;  3MNN B;  4J8V A;  3REK D;  2F2A C;  5JA4 B;  5B0Y C;  5B2J C;  5AV9 B;  3MVD A;  3P5J B;  4H9S C;  1KX5 D;  5KDM B;  1B67 A;  4YM6 A;  3WA9 B;  3NQU B;  3AZK A;  1P3K D;  1P3F D;  2NZD B;  2CV5 C;  4R8P B;  4XUJ B;  3AL0 C;  5JRG B;  4J8W B;  1P34 C;  4WU9 C;  2RVQ C;  3WKJ D;  3B0D B;  1AOI B;  5BT1 D;  5AVB D;  4Z66 D;  3UT9 A;  3B6G A;  5AV5 C;  1TZY A;  5F99 D;  3LZ0 C;  5AV6 C;  5CP6 C;  3C1B D;  5C3I C;  3MGQ B;  3REJ A;  4M6B A;  3LJA B;  4E44 A;  5FUG B;  3B0C W;  5B1L D;  3MGR D;  1M1A A;  3W98 C;  2XD5 A;  4H9R A;  5GSU D;  2JE5 A;  3X1U A;  3LEL C;  4JJN D;  5B33 C;  5CPK D;  4KUD D;  2IO5 B;  3VH5 A;  3EPL A;  4KGC A;  1WWS A;  1P3L C;  3X1T D;  5B0Y B;  5B2J B;  5DNM C;  3V9R A;  3AZJ D;  4XZQ D;  2Y2I A;  1P3G D;  3AV1 A;  4QLC D;  1F66 D;  3MNN D;  1KX3 D;  3AN2 D;  3AZH D;  4Z5T A;  3REH A;  1P3I A;  2CV5 B;  2Y2G A;  5AV9 D;  2XD1 A;  3MGS A;  3EPK A;  2PYO D;  1S32 C;  1P34 B;  4WU9 B;  1P3P C;  1JFI A;  3WA9 D;  1BH9 B;  5AV5 B;  2NZD D;  4R8P D;  3R45 A;  3LZ0 B;  5AV6 B;  3AZL C;  5JRG D;  5CP6 B;  3WAA C;  3REL A;  3O62 C;  1AOI D;  4G91 C;  5B1M A;  3KUY A;  3VH6 T;  4WU8 A;  3LZ1 B;  3AFA C;  3LEL B;  3C1C A;  1M18 A;  1EQZ C;  5B33 B;  3H0L C;  5AV8 B;  3MGQ D;  5B32 G;  4YS3 A;  1P3L B;  2L5A A;  3AZG A;  3AYW C;  5AVC C;  5DNM B;  3A6N C;  3WTP A;  3TU4 B;  5GXQ D;  5B2I C;  3MVD C;  3KFU G;  4YM6 C;  3AV2 C;  3B6F A;  5B0Y D;  3AZM D;  5B32 C;  1S32 B;  1ZLA A;  2NQB A;  1P3P B;  1HQ3 C;  3UTB C;  2F8N D;  2ARO A;  5BNX B;  5BO0 B;  2CV5 D;  3EPJ A;  4J8X C;  3X1S C;  3H0R C;  5CPJ A;  1P3A A;  4NE6 A;  3AZL B;  3B0B A;  5B40 A;  4WU9 D;  3WAA B;  3W97 A;  2RVQ D;  4ZUX C;  3O62 B;  3KWQ B;  4G91 B;  5AV5 D;  1H3O B;  2FJ7 B;  3AFA B;  1EQZ B;  3X1U C;  3LZ0 D;  5AV6 D;  4H9P B;  5CP6 D;  5B31 G;  4XUJ C;  5DNN D;  3IP4 C;  3AYW B;  5AVC B;  1U35 C;  3A6N B;  4X23 A;  4H9N A;  3LEL D;  3W98 D;  5B24 A;  5B33 D;  5B2I B;  3MVD B;  5GT3 A;  1KU5 A;  3AV1 C;  5CPI A;  2ZY5 A;  4CSR A;  1P3B C;  2ZY4 A;  3AZN C;  1N1J A;  1M19 A;  4YM6 B;  2VQR A;  5B0Z A;  3AV2 B;  3UTA A;  3KSY A;  5DNM D;  3KXB C;  2ZY2 A;  4J8U C;  5B31 C;  3VH5 T;  3MGS C;  3X1V C;  3UTB B;  3AZI C;  1KX4 C;  3W99 A;  2Y2L A;  3X1S B;  3REK A;  4EO5 C;  1S32 D;  1P3P D;  1TAF B;  4ZUX B;  3REJ B;  3W96 C;  3REL C;  3AZF C;  4WU8 C;  1KX5 A;  3X1U B;  3VH6 W;  3AZL D;  1P3K A;  1P3F A;  3WAA D;  1U35 B;  3AFA D;  3EG5 B;  3AZE C;  1EQZ D;  3V9R B;  4WJ3 C;  3WKJ A;  1P3B B;  5AVB A;  4Z66 A;  3AV1 B;  3AZN B;  4H9Q B;  1A7W A;  2BYK A;  5F99 A;  4Z5T B;  3REH B;  3AYW D;  3NQJ A;  2BYM A;  5AVC D;  3KXB B;  3A6N D;  3C1B A;  4J8U B;  2HIO C;  2F8N H;  5B31 B;  4LD9 C;  5B2I D;  3MGS B;  3X1V B;  3MGR A;  5B1L A;  5G49 B;  1W2E A;  5GT0 C;  3LZ1 C;  5GSU A;  2YFW B;  4JJN A;  5CPK A;  2ARO C;  3AZI B;  3AV2 D;  1KX4 B;  1JFI B;  2ZY3 A;  4KUD A;  4CAY A;  5AV8 C;  2HUE C;  5CPJ C;  5B32 D;  1P3A C;  4EO5 B;  3X1T A;  1P3O C;  1HQ3 D;  3UTB D;  1P3M C;  3REL B;  3W96 B;  3AZJ A;  1PZR A;  3A1I A;  4XZQ A;  3AZF B;  1P3G A;  3TU4 C;  4WU8 B;  4QLC A;  1F66 A;  3X1S D;  4WNN B;  4UUZ A;  3MNN A;  4J8X D;  1KX3 A;  3AN2 A;  1F1E A;  3AZH A;  2Y2O A;  5JA4 A;  4ZUX D;  2BG1 A;  5AV9 A;  2PYO A;  3AZE B;  5KDM A;  3MGP C;  3WA9 A;  5B24 C;  5GT3 C;  2NZD A;  4R8P A;  4XUJ D;  5AY8 C;  3UTA C;  1U35 D;  5JRG A;  5E5A C;  4J8W D;  2HIO B;  4H9O B;  4LD9 B;  3KWQ C;  1P3B D;  1AOI A;  4DRB A;  1BFM A;  2FJ7 C;  3AZN D;  5GT0 B;  1Q9C A;  2ARO B;  1ID3 C;  2Y2J A;  5BS7 A;  3KXB D;  2HUE B;  4J8U D;  3MGQ A;  5B31 D;  4J8V C;  1BH8 B;  3REI A;  5CPJ B;  1P3A B;  3LJA D;  3X1V D;  2DF4 C;  5FUG A;  1P3O B;  4E45 A;  5B40 B;  1P3M B;  3W97 B;  3AZI D;  1KX4 D;  5GXQ A;  1KX5 C;  3AZK C;  5B0Y A;  1P3K C;  5B2J D;  3REL D;  3W96 D;  3AZM A;  3H0M C;  3AZF D;  4H9N B;  3MGP B;  5CHL B;  5B24 B;  4NFT A;  2F8N A;  5AVB C;  5GT3 B;  3UT9 C;  2CV5 A;  4CSR B;  3B6G C;  1TZY C;  1M19 B;  5AY8 B;  5B0Z B;  3UTA B;  3AZE D;  5E5A B;  4WU9 A;  1P34 D;  3REJ C;  2JCH A;  1BH9 A;  5AV5 A;  1M1A C;  3LZ0 A;  1ID3 B;  5AV6 A;  4UPK A;  5CP6 A;  2HIO D;  2Y2N A;  4J8V B;  4KGC C;  4LD9 D;  5DNN A;  3W98 A;  5GT0 D;  3LZ1 D;  3WTP E;  3LEL A;  5B33 A;  4WZS B;  5AV8 D;  4KHA A;  1F66 C;  1KX5 B;  1P3L D;  3AZK B;  4Z5T C;  3REH C;  1P3I C;  1P3K B;  1P3O D;  5DNM A;  1P3M D;  3TU4 D;  2PYO C;  5AVB B;  3UT9 B;  3B6G B;  1TZY B;  1S32 A;  2RIQ A;  2Y2M A;  4WV4 B;  3MGP D;  1P3P A;  5BNX A;  5BO0 A;  5B1M C;  3KUY C;  1M1A B;  2CWE A;  2YFV A;  4H9R B;  3C1C C;  5AY8 D;  1M18 C;  3AZL A;  4KUD B;  5BS7 C;  5E5A D;  1ULY A;  3WAA A;  4KGC B;  3KWQ D;  3O62 D;  3REI C;  4YS3 C;  3FDD A;  3AZG C;  1H3O A;  2FJ7 D;  3AFA A;  1EQZ A;  4XZQ B;  1ID3 D;  3WTP C;  4HGA C;  4H9P A;  1F66 B;  1T3U A;  4UUZ B;  4J8V D;  1KX3 B;  3AN2 B;  3AZH B;  1P3I B;  3AYW A;  3B6F C;  5AVC A;  4G92 C;  3A6N A;  2W8S A;  3AZM C;  5B2I A;  3MVD D;  2F8N K;  2PYO B;  1ZLA C;  2NQB C;  4YM6 D;  3AV2 A;  3AZK D;  5BNV A;  1WWI A;  3R45 B;  5B32 A; 
#chains in the Genus database with same CATH homology
 1HQ3 A;  3UTB A;  5B40 C;  2JSS A;  3W97 C;  5B1M B;  3KUY B;  3UT9 D;  3B6G D;  1TZY D;  3X1S A;  4J8X A;  3C1C B;  1M18 B;  4Z2M G;  1B6W A;  1TAF A;  4ZUX A;  3REJ D;  3REI B;  4YS3 B;  3AZG B;  5DNN C;  1M1A D;  3X1U D;  4X23 C;  3NQU A;  3WTP B;  5GXQ B;  4HGA B;  5CPI C;  4KGC D;  1M19 C;  4XUJ A;  5B0Z C;  3B6F B;  2DQN C;  2G5H C;  4G92 B;  1U35 A;  4J8W A;  3AZM B;  1P3B A;  3AV1 D;  1ZLA B;  3AZN A;  4H9Q A;  2NQB B;  2F8N B;  3VH5 W;  4Z5T D;  3W99 C;  3REH D;  1P3I D;  3KXB A;  4J8U A;  5B31 A;  3REK C;  3EPH A;  3LJA A;  3MGS D;  3X1V A;  5G49 A;  2YFW A;  2Y2Q A;  3AZI A;  3F6T A;  1KX4 A;  4Z2M H;  2UWX A;  4AWL C;  2G5I C;  5B2J A;  1P3F C;  5C3I B;  3W96 A;  2Y2H A;  5B1M D;  3KUY D;  3AZF A;  5DNN B;  4WU8 D;  4H9S A;  3W98 B;  4WNN A;  4ZBJ C;  4X23 B;  3C1C D;  1M18 D;  2J8P A;  3WKJ C;  5BT1 C;  4Z66 C;  5CPI B;  4KHA B;  1N1J B;  3REI D;  4YS3 D;  5F99 C;  3AZG D;  3AZE A;  1P34 A;  3C1B C;  3WTP D;  1HTA A;  3MGR C;  5B1L C;  4JJN C;  5GSU C;  5CPK C;  3W99 B;  4DRA A;  3B6F D;  4KUD C;  3B0C T;  2HIO A;  4H9O A;  3REK B;  4LD9 A;  3X1T C;  1ZLA D;  5GT0 A;  3LZ1 A;  2NQB D;  2ARO D;  3AZJ C;  4XZQ C;  1P3G C;  5AV8 A;  4QLC C;  2YFV B;  3MNN C;  1BH8 A;  1KX3 C;  5CPJ D;  3AN2 C;  4AWL B;  3AZH C;  2Y2P A;  1P3A D;  1P3L A;  1P3O A;  1P3F B;  5B40 D;  1P3M A;  3W97 D;  5AV9 C;  3TU4 A;  4ZBJ B;  3WA9 C;  3WKJ B;  4Z66 B;  2NZD C;  4DQY B;  3VH6 A;  4R8P C;  2BYK B;  2Y2K A;  5F99 B;  3A1K A;  2BYM B;  3NQJ B;  5JRG C;  4X23 D;  2FFF B;  1R4V A;  3MGP A;  3C1B B;  5B24 D;  4J8W C;  3B0D C;  1AOI C;  5GT3 D;  4NE5 A;  1Z2C B;  5B1L B;  3MGR B;  2ZM5 A;  5CPI D;  4NE3 A;  5GSU B;  4JJN B;  5AY8 A;  5CPK B;  5B0Z D;  1M19 D;  5BNV B;  3UTA D;  4CAY B;  5E5A A;  3KWQ A;  3O62 A;  2LY8 A;  3MGQ C;  5B32 B;  3LJA C;  3X1T B;  2FJ7 A;  2F8N G;  1HQ3 B;  3AZJ B;  3W99 D;  1ID3 A;  1P3G B;  5GXQ C;  2IO5 C;  4QLC B;  4J8X B;  3MNN B;  4J8V A;  3REK D;  2F2A C;  5JA4 B;  5B0Y C;  5B2J C;  5AV9 B;  3MVD A;  3P5J B;  4H9S C;  1KX5 D;  5KDM B;  1B67 A;  4YM6 A;  3WA9 B;  3NQU B;  3AZK A;  1P3K D;  1P3F D;  2NZD B;  2CV5 C;  4R8P B;  4XUJ B;  3AL0 C;  5JRG B;  4J8W B;  1P34 C;  4WU9 C;  2RVQ C;  3WKJ D;  3B0D B;  1AOI B;  5BT1 D;  5AVB D;  4Z66 D;  3UT9 A;  3B6G A;  5AV5 C;  1TZY A;  5F99 D;  3LZ0 C;  5AV6 C;  5CP6 C;  3C1B D;  5C3I C;  3MGQ B;  3REJ A;  4M6B A;  3LJA B;  4E44 A;  5FUG B;  3B0C W;  5B1L D;  3MGR D;  1M1A A;  3W98 C;  2XD5 A;  4H9R A;  5GSU D;  2JE5 A;  3X1U A;  3LEL C;  4JJN D;  5B33 C;  5CPK D;  4KUD D;  2IO5 B;  3VH5 A;  3EPL A;  4KGC A;  1WWS A;  1P3L C;  3X1T D;  5B0Y B;  5B2J B;  5DNM C;  3V9R A;  3AZJ D;  4XZQ D;  2Y2I A;  1P3G D;  3AV1 A;  4QLC D;  1F66 D;  3MNN D;  1KX3 D;  3AN2 D;  3AZH D;  4Z5T A;  3REH A;  1P3I A;  2CV5 B;  2Y2G A;  5AV9 D;  2XD1 A;  3MGS A;  3EPK A;  2PYO D;  1S32 C;  1P34 B;  4WU9 B;  1P3P C;  1JFI A;  3WA9 D;  1BH9 B;  5AV5 B;  2NZD D;  4R8P D;  3R45 A;  3LZ0 B;  5AV6 B;  3AZL C;  5JRG D;  5CP6 B;  3WAA C;  3REL A;  3O62 C;  1AOI D;  4G91 C;  5B1M A;  3KUY A;  3VH6 T;  4WU8 A;  3LZ1 B;  3AFA C;  3LEL B;  3C1C A;  1M18 A;  1EQZ C;  5B33 B;  3H0L C;  5AV8 B;  3MGQ D;  5B32 G;  4YS3 A;  1P3L B;  2L5A A;  3AZG A;  3AYW C;  5AVC C;  5DNM B;  3A6N C;  3WTP A;  3TU4 B;  5GXQ D;  5B2I C;  3MVD C;  3KFU G;  4YM6 C;  3AV2 C;  3B6F A;  5B0Y D;  3AZM D;  5B32 C;  1S32 B;  1ZLA A;  2NQB A;  1P3P B;  1HQ3 C;  3UTB C;  2F8N D;  2ARO A;  5BNX B;  5BO0 B;  2CV5 D;  3EPJ A;  4J8X C;  3X1S C;  3H0R C;  5CPJ A;  1P3A A;  4NE6 A;  3AZL B;  3B0B A;  5B40 A;  4WU9 D;  3WAA B;  3W97 A;  2RVQ D;  4ZUX C;  3O62 B;  3KWQ B;  4G91 B;  5AV5 D;  1H3O B;  2FJ7 B;  3AFA B;  1EQZ B;  3X1U C;  3LZ0 D;  5AV6 D;  4H9P B;  5CP6 D;  5B31 G;  4XUJ C;  5DNN D;  3IP4 C;  3AYW B;  5AVC B;  1U35 C;  3A6N B;  4X23 A;  4H9N A;  3LEL D;  3W98 D;  5B24 A;  5B33 D;  5B2I B;  3MVD B;  5GT3 A;  1KU5 A;  3AV1 C;  5CPI A;  2ZY5 A;  4CSR A;  1P3B C;  2ZY4 A;  3AZN C;  1N1J A;  1M19 A;  4YM6 B;  2VQR A;  5B0Z A;  3AV2 B;  3UTA A;  3KSY A;  5DNM D;  3KXB C;  2ZY2 A;  4J8U C;  5B31 C;  3VH5 T;  3MGS C;  3X1V C;  3UTB B;  3AZI C;  1KX4 C;  3W99 A;  2Y2L A;  3X1S B;  3REK A;  4EO5 C;  1S32 D;  1P3P D;  1TAF B;  4ZUX B;  3REJ B;  3W96 C;  3REL C;  3AZF C;  4WU8 C;  1KX5 A;  3X1U B;  3VH6 W;  3AZL D;  1P3K A;  1P3F A;  3WAA D;  1U35 B;  3AFA D;  3EG5 B;  3AZE C;  1EQZ D;  3V9R B;  4WJ3 C;  3WKJ A;  1P3B B;  5AVB A;  4Z66 A;  3AV1 B;  3AZN B;  4H9Q B;  1A7W A;  2BYK A;  5F99 A;  4Z5T B;  3REH B;  3AYW D;  3NQJ A;  2BYM A;  5AVC D;  3KXB B;  3A6N D;  3C1B A;  4J8U B;  2HIO C;  2F8N H;  5B31 B;  4LD9 C;  5B2I D;  3MGS B;  3X1V B;  3MGR A;  5B1L A;  5G49 B;  1W2E A;  5GT0 C;  3LZ1 C;  5GSU A;  2YFW B;  4JJN A;  5CPK A;  2ARO C;  3AZI B;  3AV2 D;  1KX4 B;  1JFI B;  2ZY3 A;  4KUD A;  4CAY A;  5AV8 C;  2HUE C;  5CPJ C;  5B32 D;  1P3A C;  4EO5 B;  3X1T A;  1P3O C;  1HQ3 D;  3UTB D;  1P3M C;  3REL B;  3W96 B;  3AZJ A;  1PZR A;  3A1I A;  4XZQ A;  3AZF B;  1P3G A;  3TU4 C;  4WU8 B;  4QLC A;  1F66 A;  3X1S D;  4WNN B;  4UUZ A;  3MNN A;  4J8X D;  1KX3 A;  3AN2 A;  1F1E A;  3AZH A;  2Y2O A;  5JA4 A;  4ZUX D;  2BG1 A;  5AV9 A;  2PYO A;  3AZE B;  5KDM A;  3MGP C;  3WA9 A;  5B24 C;  5GT3 C;  2NZD A;  4R8P A;  4XUJ D;  5AY8 C;  3UTA C;  1U35 D;  5JRG A;  5E5A C;  4J8W D;  2HIO B;  4H9O B;  4LD9 B;  3KWQ C;  1P3B D;  1AOI A;  4DRB A;  1BFM A;  2FJ7 C;  3AZN D;  5GT0 B;  1Q9C A;  2ARO B;  1ID3 C;  2Y2J A;  5BS7 A;  3KXB D;  2HUE B;  4J8U D;  3MGQ A;  5B31 D;  4J8V C;  1BH8 B;  3REI A;  5CPJ B;  1P3A B;  3LJA D;  3X1V D;  2DF4 C;  5FUG A;  1P3O B;  4E45 A;  5B40 B;  1P3M B;  3W97 B;  3AZI D;  1KX4 D;  5GXQ A;  1KX5 C;  3AZK C;  5B0Y A;  1P3K C;  5B2J D;  3REL D;  3W96 D;  3AZM A;  3H0M C;  3AZF D;  4H9N B;  3MGP B;  5CHL B;  5B24 B;  4NFT A;  2F8N A;  5AVB C;  5GT3 B;  3UT9 C;  2CV5 A;  4CSR B;  3B6G C;  1TZY C;  1M19 B;  5AY8 B;  5B0Z B;  3UTA B;  3AZE D;  5E5A B;  4WU9 A;  1P34 D;  3REJ C;  2JCH A;  1BH9 A;  5AV5 A;  1M1A C;  3LZ0 A;  1ID3 B;  5AV6 A;  4UPK A;  5CP6 A;  2HIO D;  2Y2N A;  4J8V B;  4KGC C;  4LD9 D;  5DNN A;  3W98 A;  5GT0 D;  3LZ1 D;  3WTP E;  3LEL A;  5B33 A;  4WZS B;  5AV8 D;  4KHA A;  1F66 C;  1KX5 B;  1P3L D;  3AZK B;  4Z5T C;  3REH C;  1P3I C;  1P3K B;  1P3O D;  5DNM A;  1P3M D;  3TU4 D;  2PYO C;  5AVB B;  3UT9 B;  3B6G B;  1TZY B;  1S32 A;  2RIQ A;  2Y2M A;  4WV4 B;  3MGP D;  1P3P A;  5BNX A;  5BO0 A;  5B1M C;  3KUY C;  1M1A B;  2CWE A;  2YFV A;  4H9R B;  3C1C C;  5AY8 D;  1M18 C;  3AZL A;  4KUD B;  5BS7 C;  5E5A D;  1ULY A;  3WAA A;  4KGC B;  3KWQ D;  3O62 D;  3REI C;  4YS3 C;  3FDD A;  3AZG C;  1H3O A;  2FJ7 D;  3AFA A;  1EQZ A;  4XZQ B;  1ID3 D;  3WTP C;  4HGA C;  4H9P A;  1F66 B;  1T3U A;  4UUZ B;  4J8V D;  1KX3 B;  3AN2 B;  3AZH B;  1P3I B;  3AYW A;  3B6F C;  5AVC A;  4G92 C;  3A6N A;  2W8S A;  3AZM C;  5B2I A;  3MVD D;  2F8N K;  2PYO B;  1ZLA C;  2NQB C;  4YM6 D;  3AV2 A;  3AZK D;  5BNV A;  1WWI A;  3R45 B;  5B32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...