3AZGD

Crystal structure of human nucleosome core particle containing h3k115q mutation
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
b'RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 35
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azgD00
1BH8A 3MGQA 2HIOD 2BYKB 3KWQB 3MVDC 4YM6B 3LJAA 5DNMB 3AZGA 3AZGD 3AZLA 5CPIA 5CPID 3MGRA 4KUDB 3MGRD 4WU9B 4LD9A 3AZED 5AY8A 3AFAB 5AY8D 5GT0A 5JRGC 1U35D 2YFWB 2NZDB 2YFVB 4J8XC 3AZHB 4J8VC 3X1VD 3WAAB 2F8NG 4ZBJC 4XUJD 5E5AA 5F99C 3REJA 3B6FB 1P3MD 1P3PA 1P3KA 4JJNA 1JFIA 3W97C 1M18C 1B67A 4X23A 2FJ7B 5CPKC 3C1BD 3LELC 4H9QB 3AZND 3NQUB 1TZYD 4ZUXB 5B1MB 3TU4A 3AN2C 5B2ID 5AVBD 1H3OA 5BNVA 3MGPA 5B32A 5B32D 2AROB 5CPJB 5AV5B 1KX5B 3X1SD 1AOIC 4CAYB 5GSUB 3AV1D 1M19A 3REKC 1F66B 3AFAD 5B33C 1KX4D 4H9RA 3UTBA 1Q9CA 3UTBD 5AV6C 1M1AC 5AVCC 3MNNC 5B31D 3V9RA 3AZFA 3AZFD 4NE6A 4WU8D 3WA9D 3AZIA 1KX3B 3W96C 4QLCD 3C1CD 3WTPA 3W98B 4EO5B 2HUEB 3AZMC 4H9SA 3VH5T 2NQBB 3MGSC 3LZ1B 2CV5B 5B24C 3RELC 3UT9C 4ZUXD 3LZ0B 4Z5TB 1M18A 3KUYB 3AZKB 3LELA 3B0BA 3X1UA 3X1UD 3X1TD 2HIOC 5AV9A 5AV9D 5CPJD 1EQZA 1EQZD 4KHAA 5B0ZA 5B0ZD 3LJAC 3AZGC 4YS3B 1S32A 3AZLC 5CPIC 1S32D 5B0YA 3MGRC 5FUGA 5GT3B 3VH6T 5BS7C 3A6NB 4LD9C 5AY8C 5GT0C 5B32G 1P3FB 5CP6D 5B40D 3B6GB 1ID3D 2F8NA 1P3GB 4E45A 5B33A 4CSRB 4NFTA 5C3IB 5AV6A 5GXQA 5GXQD 1N1JB 3MNNA 4H9OB 1P3AB 5E5AC 3REHA 3KXBA 3REHD 5B31G 3KXBD 3AV2B 1P3MC 1P3ID 5G49A 1P3KC 1BH9B 2PYOB 4JJNC 2NQBD 1HQ3A 3W96A 3AZNC 3MGQB 5BO0B 4KGCA 5JA4A 4KGCD 4H9NA 1TZYC 4Z5TD 4H9PA 3UTAB 5B1LA 5B1LD 3AZKD 5B2IC 5AVBC 3O62B 3AYWB 1P3OB 5B2JA 5B32C 4Z66B 5GT0B 1F1EA 3X1SC 4DRAA 4G92B 3AV1C 3REID 1M19C 3WKJD 1KX4C 1P3LA 1P3LD 2HIOA 4AWLC 3UTBC 1P3FD 1ZLAB 5BT1C 1WWIA 3REJB 3AZJB 5B31C 3NQJA 3AZFC 1P3GD 2BYMB 4DRBA 5BS7A 1P3PB 3AZEA 4WU8C 4J8UB 3AZIC 4X23B 4J8WB 1U35A 4QLCC 3AV2D 3WTPC 5BNXA 4HGAB 3X1VA 4R8PD 1TAFA 4XZQB 4H9SC 1BFMA 3TU4B 1P34B 5AV8D 5BNVB 4XUJA 2CWEA 3MGPB 1P3MA 5DNNB 1P3BD 3C1BA 2IO5B 3O62D 3X1UC 3AZNA 4Z66D 4H9RB 3X1TC 5AV9C 4G91C 1EQZC 1TZYA 3MVDB 5B0ZC 3W99A 3W99D 1S32C 4Z2MH 5B0YC 3V9RB 5B2IA 5AVBA 2BYKA 3KWQD 5DNMD 4YM6D 1ZLAD 5JRGB 3X1SA 3AZJD 4J8XB 4KUDA 5B40C 4KUDD 3AV1A 1ID3C 4WU9D 4J8VB 3AFAA 1KX4A 4WNNB 4J8UD 4ZBJB 2NZDA 2YFWA 4UUZB 2NZDD 5GXQC 2YFVA 4WV4B 1HTAA 3AZHA 5F99B 3AZHD 5B31A 3REHC 3KXBC 3WAAD 1P3IC 4WU8A 3WA9A 3B0DC 3W97B 1M18B 1HQ3C 5CPKB 3LELB 4QLCA 3C1CA 3B6FD 4KGCC 4KHAB 5B1LC 2FJ7A 2FJ7D 3AN2B 4H9QA 5B2JC 4Z2MG 3NQUA 3MVDD 4ZUXA 5B1MA 5B1MD 1AOIB 3REIC 3WKJC 3REKB 2F8NB 5B33B 1P3LC 1A7WA 2AROD 3X1TA 4NE5A 5JRGD 5AV6B 5AV5A 5CPJA 5AVCB 5AV5D 3MNNB 1M1AB 1KX5A 1KX5D 5GSUD 1F66A 1F66D 5G49B 3AZEC 1U35C 5F99D 3W96B 5CP6A 5B40A 1ID3A 3X1VC 4H9NB 4R8PC 4H9PB 3AZMB 1KX3D 5CPKD 4M6BA 3R45A 5AV8C 4NE3A 5CHLB 4XUJC 3MGSB 5B24B 3RELB 1P3IA 3W98D 3UT9B 1P3BC 2NQBA 3C1BC 3LZ1A 2CV5A 3LZ1D 2CV5D 1BH8B 2HIOB 4Z5TA 3LZ0D 3AZGB 3LJAB 3W99C 3AZLB 3KUYA 5CPIB 3KUYD 3AZKA 3NQJB 3MGRB 4LD9B 5AY8B 3WTPE 1M1AD 3KWQC 5DNMC 4YM6C 4YS3D 3VH5A 3KSYA 4KUDC 3REIA 5GT3D 3WKJA 4WU9C 3A6ND 3AFAC 2NZDC 1P3FA 3AZHC 5E5AB 3B6GD 1P3MB 3WAAC 1P3GA 4CSRA 1P3KB 3WA9C 3AZMD 4JJNB 1JFIB 1N1JA 3MGSD 1P3AD 3B6FC 3C1CC 5B24D 3RELD 3AZNB 3AV2A 3UT9D 1BH9A 2PYOD 1TZYB 4R8PA 2FJ7C 5B2IB 5AV8A 5AVBB 1H3OB 5KDMA 5BO0A 3MGQD 5B32B 3UTAA 3LJAD 3UTAD 4ZUXC 3AZLD 5B1MC 3X1SB 1P3BA 3AV1B 3O62A 1M19B 3B0CW 3AYWA 3AYWD 1P3OA 4LD9D 1P3OD 1KX4B 4Z66A 1B6WA 5GT0D 2AROC 4AWLB 3UTBB 5CPJC 5AV5C 1KX5C 5GSUC 5B31B 1F66C 3AZFB 4WU8B 3WA9B 3KWQA 5DNMA 4YM6A 3AZIB 1ZLAA 3REJD 5E5AD 3AZJA 5CP6C 4QLCB 3C1CB 3WTPB 2BYMA 4WU9A 1P3PD 1P3KD 4JJND 4J8UA 4J8WA 1KX3C 4X23D 4J8WD 3WAAA 3W98C 4EO5C 2HUEC 4XZQA 4XZQD 3TU4D 1P34A 2NQBC 1P34D 2LY8A 3LZ1C 2CV5C 3MGPD 3B6FA 3X1UB 2JSSA 3X1TB 2RVQD 5AV9B 4G91B 1EQZB 3LZ0C 4Z5TC 5B0ZB 5DNNA 5DNND 1S32B 3KUYC 1M19D 5B0YB 3AZKC 5FUGB 3MVDA 4YS3C 5BT1D 5CP6B 5B40B 5GT3C 1ID3B 3A6NC 2AROA 3AZID 5JRGA 1P3FC 5GXQB 3R45B 4CAYA 4J8XA 4J8XD 3WTPD 5GSUA 3B6GC 4J8VA 3REHB 3KXBB 4J8VD 1P3GC 1P3IB 4WNNA 5C3IC 3B0DB 4UUZA 1WWSA 1HQ3B 5F99A 1KU5A 1P3AC 3AV2C 2PYOC 5JA4B 4KGCB 3W97A 3W97D 5B1LB 1M18D 1KX3A 5CPKA 3LELD 3MGQC 5B2JB 3W98A 3UTAC 5B0YD 3AN2A 3AN2D 3VH5W 3REIB 3O62C 3WKJB 3AYWC 1P3OC 1P3LB 4Z66C 2L5AA 2F8NK 1AOIA 3LZ0A 1AOID 4G92C 3REKA 3REKD 2F8ND 1R4VA 5B33D 3AZEB 4E44A 1M1AA 5AV6D 5AVCA 5AVCD 1ZLAC 3MNND 4YS3A 1U35B 3REJC 3AZJC 3VH6W 5GT3A 5BNXB 3X1VB 1P3PC 3A6NA 4R8PB 4J8UC 1TAFB 4X23C 4J8WC 2F8NH 1HQ3D 3W96D 5AV8B 4XUJB 5KDMB 3B6GA 4HGAC 4WZSB 4XZQC 3AZMA 3TU4C 1P3BB 1ULYA 4H9OA 3MGSA 3C1BB 3VH6A 1P34C 1P3AA 3B0CT 3MGPC 5B24A 3RELA 5B2JD 2RVQC 3UT9A 2PYOA 3W99B 5DNNC 2IO5C
chains in the Genus database with same CATH superfamily
1BH8A 3MGQA 2HIOD 2BYKB 3KWQB 3MVDC 4YM6B 3LJAA 5DNMB 3AZGA 3AZGD 3AZLA 5CPIA 5CPID 3MGRA 4KUDB 3MGRD 4WU9B 4LD9A 3AZED 5AY8A 3AFAB 5AY8D 5GT0A 5JRGC 1U35D 2YFWB 2NZDB 3EPKA 2YFVB 4J8XC 3AZHB 4J8VC 3X1VD 3WAAB 2F8NG 4ZBJC 4XUJD 5E5AA 5F99C 3REJA 3B6FB 1P3MD 3AL0C 1P3PA 1P3KA 4JJNA 1JFIA 3W97C 1M18C 1B67A 4X23A 2FJ7B 5CPKC 3C1BD 3LELC 4H9QB 2DF4C 3AZND 3NQUB 2G5HC 1TZYD 4ZUXB 5B1MB 3TU4A 3AN2C 5B2ID 5AVBD 1H3OA 5BNVA 3MGPA 5B32A 2J8PA 5B32D 2AROB 5CPJB 5AV5B 1KX5B 3X1SD 1AOIC 4CAYB 5GSUB 3AV1D 1M19A 3A1KA 3REKC 1F66B 3AFAD 5B33C 1KX4D 4H9RA 3UTBA 1Q9CA 3UTBD 5AV6C 1M1AC 5AVCC 3MNNC 5B31D 3V9RA 3AZFA 3AZFD 4NE6A 4WU8D 3WA9D 3AZIA 1KX3B 3W96C 4QLCD 3C1CD 3WTPA 3W98B 4EO5B 2HUEB 3AZMC 4H9SA 2JCHA 3VH5T 2NQBB 3MGSC 3LZ1B 2CV5B 5B24C 3RELC 3UT9C 4ZUXD 3LZ0B 4Z5TB 1M18A 3KUYB 3AZKB 3LELA 3B0BA 3X1UA 3X1UD 2G5IC 3X1TD 2HIOC 2Y2PA 5AV9A 5AV9D 5CPJD 1EQZA 1EQZD 4KHAA 5B0ZA 5B0ZD 3LJAC 3AZGC 4YS3B 1S32A 3AZLC 5CPIC 1S32D 5B0YA 3MGRC 5FUGA 5GT3B 3VH6T 5BS7C 3A6NB 4LD9C 5AY8C 5GT0C 5B32G 4UPKA 1P3FB 5CP6D 5B40D 3B6GB 1ID3D 2F8NA 1P3GB 4E45A 5B33A 4CSRB 4NFTA 5C3IB 5AV6A 5GXQA 5GXQD 1N1JB 3MNNA 4H9OB 1P3AB 5E5AC 3REHA 3KXBA 3REHD 5B31G 3KXBD 3AV2B 1P3MC 1P3ID 5G49A 1P3KC 1BH9B 2PYOB 4JJNC 2NQBD 1HQ3A 3W96A 3AZNC 3MGQB 5BO0B 4KGCA 5JA4A 4KGCD 4H9NA 1TZYC 4Z5TD 4H9PA 3UTAB 5B1LA 5B1LD 3AZKD 5B2IC 5AVBC 3O62B 3AYWB 1P3OB 5B2JA 3EPLA 5B32C 4Z66B 5GT0B 1F1EA 4DQYB 3X1SC 4DRAA 4G92B 3AV1C 3REID 1M19C 3WKJD 1KX4C 1P3LA 1P3LD 2HIOA 4AWLC 3UTBC 1P3FD 2Y2HA 1ZLAB 5BT1C 1WWIA 3REJB 3AZJB 5B31C 3NQJA 3AZFC 1P3GD 2BYMB 4DRBA 1Z2CB 5BS7A 1P3PB 3AZEA 4WU8C 4J8UB 3AZIC 3KFUG 4X23B 4J8WB 1U35A 4QLCC 3AV2D 3WTPC 5BNXA 4HGAB 3X1VA 3EPHA 4R8PD 1TAFA 4XZQB 4H9SC 1BFMA 3TU4B 3F6TA 5AV8D 5BNVB 4XUJA 1P34B 2CWEA 3MGPB 2FFFB 1P3MA 5DNNB 1P3BD 3C1BA 2IO5B 3O62D 3X1UC 3AZNA 4Z66D 4H9RB 3X1TC 5AV9C 4G91C 1EQZC 1TZYA 3MVDB 5B0ZC 3W99A 3W99D 1S32C 2XD1A 4Z2MH 5B0YC 3V9RB 5B2IA 5AVBA 2BYKA 3KWQD 5DNMD 4YM6D 1ZLAD 5JRGB 3X1SA 3AZJD 4J8XB 4KUDA 5B40C 4KUDD 3AV1A 1ID3C 4WU9D 4J8VB 3AFAA 1KX4A 4WNNB 4J8UD 4ZBJB 2NZDA 2YFWA 4UUZB 2NZDD 5GXQC 2Y2JA 2YFVA 4WV4B 1HTAA 3AZHA 5F99B 3AZHD 5B31A 3REHC 3KXBC 2VQRA 3WAAD 1P3IC 4WU8A 3WA9A 3B0DC 3W97B 1M18B 1HQ3C 5CPKB 3LELB 4QLCA 3C1CA 3B6FD 4KGCC 4KHAB 5B1LC 2FJ7A 2FJ7D 3AN2B 4H9QA 5B2JC 4Z2MG 3NQUA 3MVDD 4ZUXA 5B1MA 5B1MD 1AOIB 3REIC 3WKJC 3REKB 2F8NB 5B33B 1P3LC 1A7WA 2AROD 3X1TA 4NE5A 5JRGD 5AV6B 5AV5A 5CPJA 5AVCB 5AV5D 3MNNB 1M1AB 1KX5A 1KX5D 5GSUD 1F66A 1F66D 5G49B 3AZEC 1U35C 5F99D 3W96B 5CP6A 3IP4C 5B40A 1ID3A 2XD5A 3X1VC 4H9NB 4R8PC 4H9PB 3AZMB 1KX3D 5CPKD 4M6BA 3R45A 5AV8C 4NE3A 5CHLB 4XUJC 3MGSB 3EPJA 5B24B 3RELB 1P3IA 3W98D 3UT9B 1P3BC 2NQBA 3C1BC 3LZ1A 2CV5A 3LZ1D 2CV5D 1BH8B 2HIOB 4Z5TA 3LZ0D 3AZGB 3LJAB 3W99C 3AZLB 3KUYA 5CPIB 3KUYD 3AZKA 3NQJB 3MGRB 4LD9B 5AY8B 3WTPE 1M1AD 3KWQC 5DNMC 4YM6C 4YS3D 3VH5A 3KSYA 2W8SA 4KUDC 3REIA 5GT3D 3WKJA 4WU9C 3A6ND 3AFAC 2NZDC 1P3FA 2ZY5A 3AZHC 5E5AB 3B6GD 1P3MB 3WAAC 1P3GA 4CSRA 1P3KB 3WA9C 3AZMD 4JJNB 1JFIB 1N1JA 3MGSD 1P3AD 3B6FC 3C1CC 5B24D 3RELD 3AZNB 3AV2A 3UT9D 1BH9A 2PYOD 1TZYB 4R8PA 4WJ3C 2FJ7C 5B2IB 5AV8A 5AVBB 1H3OB 5KDMA 5BO0A 3MGQD 5B32B 3UTAA 3LJAD 3UTAD 4ZUXC 3AZLD 5B1MC 3X1SB 1P3BA 3AV1B 3O62A 1M19B 3B0CW 3AYWA 3AYWD 1P3OA 4LD9D 1P3OD 2BG1A 2ZY4A 4Z66A 1B6WA 5GT0D 2AROC 1KX4B 4AWLB 3UTBB 5CPJC 5AV5C 1KX5C 5GSUC 5B31B 2Y2KA 1F66C 3AZFB 4WU8B 3WA9B 3KWQA 5DNMA 4YM6A 3AZIB 1ZLAA 3REJD 5E5AD 3AZJA 5CP6C 3H0MC 4QLCB 3C1CB 3WTPB 2BYMA 4WU9A 1W2EA 2Y2MA 1P3KD 1P3PD 4JJND 4J8UA 4J8WA 1T3UA 4X23D 4J8WD 1KX3C 3WAAA 3W98C 4EO5C 2HUEC 3H0RC 4XZQA 4XZQD 3TU4D 1P34A 2NQBC 1P34D 2LY8A 3LZ1C 2CV5C 3MGPD 3B6FA 3X1UB 2JSSA 3X1TB 2RVQD 5AV9B 4G91B 1EQZB 3LZ0C 4Z5TC 5B0ZB 5DNNA 5DNND 1S32B 3KUYC 1M19D 5B0YB 3AZKC 5FUGB 2JE5A 3H0LC 2Y2QA 2Y2GA 3MVDA 4YS3C 3EG5B 5BT1D 5CP6B 5B40B 5GT3C 1ID3B 3A6NC 2Y2LA 2AROA 3AZID 5JRGA 1P3FC 5GXQB 3R45B 4CAYA 4J8XA 4J8XD 3WTPD 2F2AC 5GSUA 3B6GC 4J8VA 3REHB 3KXBB 4J8VD 2Y2NA 1P3GC 1P3IB 4WNNA 1PZRA 2ZY2A 5C3IC 3B0DB 4UUZA 1WWSA 1HQ3B 5F99A 1KU5A 3FDDA 1P3AC 3AV2C 2RIQA 2PYOC 5JA4B 4KGCB 3W97A 3W97D 5B1LB 1M18D 1KX3A 5CPKA 3LELD 3MGQC 5B2JB 3W98A 3UTAC 5B0YD 3AN2A 3AN2D 3VH5W 3REIB 3O62C 3WKJB 3AYWC 1P3OC 1P3LB 4Z66C 2L5AA 2F8NK 1AOIA 3LZ0A 1AOID 4G92C 3REKA 3REKD 2F8ND 1R4VA 5B33D 3AZEB 4E44A 1M1AA 5AV6D 5AVCA 5AVCD 1ZLAC 3MNND 4YS3A 1U35B 3REJC 3AZJC 2Y2IA 2ZY3A 3VH6W 5BNXB 5GT3A 3X1VB 1P3PC 2Y2OA 3A6NA 2UWXA 4R8PB 4J8UC 1TAFB 3A1IA 4X23C 4J8WC 1HQ3D 2F8NH 3W96D 2DQNC 5AV8B 4XUJB 5KDMB 3B6GA 4HGAC 4WZSB 3P5JB 4XZQC 3AZMA 3TU4C 2ZM5A 1P3BB 1ULYA 4H9OA 3MGSA 3C1BB 3VH6A 1P34C 1P3AA 3B0CT 3MGPC 5B24A 3RELA 5B2JD 2RVQC 3UT9A 2PYOA 3W99B 5DNNC 2IO5C
chains in the Genus database with same CATH topology
1BH8A 3MGQA 2HIOD 2BYKB 3KWQB 3MVDC 4YM6B 3LJAA 5DNMB 3AZGA 3AZGD 3AZLA 5CPIA 5CPID 3MGRA 4KUDB 3MGRD 4WU9B 4LD9A 3AZED 5AY8A 3AFAB 5AY8D 5GT0A 5JRGC 1U35D 2YFWB 2NZDB 3EPKA 2YFVB 4J8XC 3AZHB 4J8VC 3X1VD 3WAAB 2F8NG 4ZBJC 4XUJD 5E5AA 5F99C 3REJA 3B6FB 1P3MD 3AL0C 1P3PA 1P3KA 4JJNA 1JFIA 3W97C 1M18C 1B67A 4X23A 2FJ7B 5CPKC 3C1BD 3LELC 4H9QB 2DF4C 3AZND 3NQUB 2G5HC 1TZYD 4ZUXB 5B1MB 3TU4A 3AN2C 5B2ID 5AVBD 1H3OA 5BNVA 3MGPA 5B32A 2J8PA 5B32D 2AROB 5CPJB 5AV5B 1KX5B 3X1SD 1AOIC 4CAYB 5GSUB 3AV1D 1M19A 3A1KA 3REKC 1F66B 3AFAD 5B33C 1KX4D 4H9RA 3UTBA 1Q9CA 3UTBD 5AV6C 1M1AC 5AVCC 3MNNC 5B31D 3V9RA 3AZFA 3AZFD 4NE6A 4WU8D 3WA9D 3AZIA 1KX3B 3W96C 4QLCD 3C1CD 3WTPA 3W98B 4EO5B 2HUEB 3AZMC 4H9SA 2JCHA 3VH5T 2NQBB 3MGSC 3LZ1B 2CV5B 5B24C 3RELC 3UT9C 4ZUXD 3LZ0B 4Z5TB 1M18A 3KUYB 3AZKB 3LELA 3B0BA 3X1UA 3X1UD 2G5IC 3X1TD 2HIOC 2Y2PA 5AV9A 5AV9D 5CPJD 1EQZA 1EQZD 4KHAA 5B0ZA 5B0ZD 3LJAC 3AZGC 4YS3B 1S32A 3AZLC 5CPIC 1S32D 5B0YA 3MGRC 5FUGA 5GT3B 3VH6T 5BS7C 3A6NB 4LD9C 5AY8C 5GT0C 5B32G 4UPKA 1P3FB 5CP6D 5B40D 3B6GB 1ID3D 2F8NA 1P3GB 4E45A 5B33A 4CSRB 4NFTA 5C3IB 5AV6A 5GXQA 5GXQD 1N1JB 3MNNA 4H9OB 1P3AB 5E5AC 3REHA 3KXBA 3REHD 5B31G 3KXBD 3AV2B 1P3MC 1P3ID 5G49A 1P3KC 1BH9B 2PYOB 4JJNC 2NQBD 1HQ3A 3W96A 3AZNC 3MGQB 5BO0B 4KGCA 5JA4A 4KGCD 4H9NA 1TZYC 4Z5TD 4H9PA 3UTAB 5B1LA 5B1LD 3AZKD 5B2IC 5AVBC 3O62B 3AYWB 1P3OB 5B2JA 3EPLA 5B32C 4Z66B 5GT0B 1F1EA 4DQYB 3X1SC 4DRAA 4G92B 3AV1C 3REID 1M19C 3WKJD 1KX4C 1P3LA 1P3LD 2HIOA 4AWLC 3UTBC 1P3FD 2Y2HA 1ZLAB 5BT1C 1WWIA 3REJB 3AZJB 5B31C 3NQJA 3AZFC 1P3GD 2BYMB 4DRBA 1Z2CB 5BS7A 1P3PB 3AZEA 4WU8C 4J8UB 3AZIC 3KFUG 4X23B 4J8WB 1U35A 4QLCC 3AV2D 3WTPC 5BNXA 4HGAB 3X1VA 3EPHA 4R8PD 1TAFA 4XZQB 4H9SC 1BFMA 3TU4B 3F6TA 5AV8D 5BNVB 4XUJA 1P34B 2CWEA 3MGPB 2FFFB 1P3MA 5DNNB 1P3BD 3C1BA 2IO5B 3O62D 3X1UC 3AZNA 4Z66D 4H9RB 3X1TC 5AV9C 4G91C 1EQZC 1TZYA 3MVDB 5B0ZC 3W99A 3W99D 1S32C 2XD1A 4Z2MH 5B0YC 3V9RB 5B2IA 5AVBA 2BYKA 3KWQD 5DNMD 4YM6D 1ZLAD 5JRGB 3X1SA 3AZJD 4J8XB 4KUDA 5B40C 4KUDD 3AV1A 1ID3C 4WU9D 4J8VB 3AFAA 1KX4A 4WNNB 4J8UD 4ZBJB 2NZDA 2YFWA 4UUZB 2NZDD 5GXQC 2Y2JA 2YFVA 4WV4B 1HTAA 3AZHA 5F99B 3AZHD 5B31A 3REHC 3KXBC 2VQRA 3WAAD 1P3IC 4WU8A 3WA9A 3B0DC 3W97B 1M18B 1HQ3C 5CPKB 3LELB 4QLCA 3C1CA 3B6FD 4KGCC 4KHAB 5B1LC 2FJ7A 2FJ7D 3AN2B 4H9QA 5B2JC 4Z2MG 3NQUA 3MVDD 4ZUXA 5B1MA 5B1MD 1AOIB 3REIC 3WKJC 3REKB 2F8NB 5B33B 1P3LC 1A7WA 2AROD 3X1TA 4NE5A 5JRGD 5AV6B 5AV5A 5CPJA 5AVCB 5AV5D 3MNNB 1M1AB 1KX5A 1KX5D 5GSUD 1F66A 1F66D 5G49B 3AZEC 1U35C 5F99D 3W96B 5CP6A 3IP4C 5B40A 1ID3A 2XD5A 3X1VC 4H9NB 4R8PC 4H9PB 3AZMB 1KX3D 5CPKD 4M6BA 3R45A 5AV8C 4NE3A 5CHLB 4XUJC 3MGSB 3EPJA 5B24B 3RELB 1P3IA 3W98D 3UT9B 1P3BC 2NQBA 3C1BC 3LZ1A 2CV5A 3LZ1D 2CV5D 1BH8B 2HIOB 4Z5TA 3LZ0D 3AZGB 3LJAB 3W99C 3AZLB 3KUYA 5CPIB 3KUYD 3AZKA 3NQJB 3MGRB 4LD9B 5AY8B 3WTPE 1M1AD 3KWQC 5DNMC 4YM6C 4YS3D 3VH5A 3KSYA 2W8SA 4KUDC 3REIA 5GT3D 3WKJA 4WU9C 3A6ND 3AFAC 2NZDC 1P3FA 2ZY5A 3AZHC 5E5AB 3B6GD 1P3MB 3WAAC 1P3GA 4CSRA 1P3KB 3WA9C 3AZMD 4JJNB 1JFIB 1N1JA 3MGSD 1P3AD 3B6FC 3C1CC 5B24D 3RELD 3AZNB 3AV2A 3UT9D 1BH9A 2PYOD 1TZYB 4R8PA 4WJ3C 2FJ7C 5B2IB 5AV8A 5AVBB 1H3OB 5KDMA 5BO0A 3MGQD 5B32B 3UTAA 3LJAD 3UTAD 4ZUXC 3AZLD 5B1MC 3X1SB 1P3BA 3AV1B 3O62A 1M19B 3B0CW 3AYWA 3AYWD 1P3OA 4LD9D 1P3OD 2BG1A 2ZY4A 4Z66A 1B6WA 5GT0D 2AROC 1KX4B 4AWLB 3UTBB 5CPJC 5AV5C 1KX5C 5GSUC 5B31B 2Y2KA 1F66C 3AZFB 4WU8B 3WA9B 3KWQA 5DNMA 4YM6A 3AZIB 1ZLAA 3REJD 5E5AD 3AZJA 5CP6C 3H0MC 4QLCB 3C1CB 3WTPB 2BYMA 4WU9A 1W2EA 2Y2MA 1P3KD 1P3PD 4JJND 4J8UA 4J8WA 1T3UA 4X23D 4J8WD 1KX3C 3WAAA 3W98C 4EO5C 2HUEC 3H0RC 4XZQA 4XZQD 3TU4D 1P34A 2NQBC 1P34D 2LY8A 3LZ1C 2CV5C 3MGPD 3B6FA 3X1UB 2JSSA 3X1TB 2RVQD 5AV9B 4G91B 1EQZB 3LZ0C 4Z5TC 5B0ZB 5DNNA 5DNND 1S32B 3KUYC 1M19D 5B0YB 3AZKC 5FUGB 2JE5A 3H0LC 2Y2QA 2Y2GA 3MVDA 4YS3C 3EG5B 5BT1D 5CP6B 5B40B 5GT3C 1ID3B 3A6NC 2Y2LA 2AROA 3AZID 5JRGA 1P3FC 5GXQB 3R45B 4CAYA 4J8XA 4J8XD 3WTPD 2F2AC 5GSUA 3B6GC 4J8VA 3REHB 3KXBB 4J8VD 2Y2NA 1P3GC 1P3IB 4WNNA 1PZRA 2ZY2A 5C3IC 3B0DB 4UUZA 1WWSA 1HQ3B 5F99A 1KU5A 3FDDA 1P3AC 3AV2C 2RIQA 2PYOC 5JA4B 4KGCB 3W97A 3W97D 5B1LB 1M18D 1KX3A 5CPKA 3LELD 3MGQC 5B2JB 3W98A 3UTAC 5B0YD 3AN2A 3AN2D 3VH5W 3REIB 3O62C 3WKJB 3AYWC 1P3OC 1P3LB 4Z66C 2L5AA 2F8NK 1AOIA 3LZ0A 1AOID 4G92C 3REKA 3REKD 2F8ND 1R4VA 5B33D 3AZEB 4E44A 1M1AA 5AV6D 5AVCA 5AVCD 1ZLAC 3MNND 4YS3A 1U35B 3REJC 3AZJC 2Y2IA 2ZY3A 3VH6W 5BNXB 5GT3A 3X1VB 1P3PC 2Y2OA 3A6NA 2UWXA 4R8PB 4J8UC 1TAFB 3A1IA 4X23C 4J8WC 1HQ3D 2F8NH 3W96D 2DQNC 5AV8B 4XUJB 5KDMB 3B6GA 4HGAC 4WZSB 3P5JB 4XZQC 3AZMA 3TU4C 2ZM5A 1P3BB 1ULYA 4H9OA 3MGSA 3C1BB 3VH6A 1P34C 1P3AA 3B0CT 3MGPC 5B24A 3RELA 5B2JD 2RVQC 3UT9A 2PYOA 3W99B 5DNNC 2IO5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BH8 A;  3MGQ A;  2HIO D;  2BYK B;  3KWQ B;  3MVD C;  4YM6 B;  3LJA A;  5DNM B;  3AZG A;  3AZG D;  3AZL A;  5CPI A;  5CPI D;  3MGR A;  4KUD B;  3MGR D;  4WU9 B;  4LD9 A;  3AZE D;  5AY8 A;  3AFA B;  5AY8 D;  5GT0 A;  5JRG C;  1U35 D;  2YFW B;  2NZD B;  2YFV B;  4J8X C;  3AZH B;  4J8V C;  3X1V D;  3WAA B;  2F8N G;  4ZBJ C;  4XUJ D;  5E5A A;  5F99 C;  3REJ A;  3B6F B;  1P3M D;  1P3P A;  1P3K A;  4JJN A;  1JFI A;  3W97 C;  1M18 C;  1B67 A;  4X23 A;  2FJ7 B;  5CPK C;  3C1B D;  3LEL C;  4H9Q B;  3AZN D;  3NQU B;  1TZY D;  4ZUX B;  5B1M B;  3TU4 A;  3AN2 C;  5B2I D;  5AVB D;  1H3O A;  5BNV A;  3MGP A;  5B32 A;  5B32 D;  2ARO B;  5CPJ B;  5AV5 B;  1KX5 B;  3X1S D;  1AOI C;  4CAY B;  5GSU B;  3AV1 D;  1M19 A;  3REK C;  1F66 B;  3AFA D;  5B33 C;  1KX4 D;  4H9R A;  3UTB A;  1Q9C A;  3UTB D;  5AV6 C;  1M1A C;  5AVC C;  3MNN C;  5B31 D;  3V9R A;  3AZF A;  3AZF D;  4NE6 A;  4WU8 D;  3WA9 D;  3AZI A;  1KX3 B;  3W96 C;  4QLC D;  3C1C D;  3WTP A;  3W98 B;  4EO5 B;  2HUE B;  3AZM C;  4H9S A;  3VH5 T;  2NQB B;  3MGS C;  3LZ1 B;  2CV5 B;  5B24 C;  3REL C;  3UT9 C;  4ZUX D;  3LZ0 B;  4Z5T B;  1M18 A;  3KUY B;  3AZK B;  3LEL A;  3B0B A;  3X1U A;  3X1U D;  3X1T D;  2HIO C;  5AV9 A;  5AV9 D;  5CPJ D;  1EQZ A;  1EQZ D;  4KHA A;  5B0Z A;  5B0Z D;  3LJA C;  3AZG C;  4YS3 B;  1S32 A;  3AZL C;  5CPI C;  1S32 D;  5B0Y A;  3MGR C;  5FUG A;  5GT3 B;  3VH6 T;  5BS7 C;  3A6N B;  4LD9 C;  5AY8 C;  5GT0 C;  5B32 G;  1P3F B;  5CP6 D;  5B40 D;  3B6G B;  1ID3 D;  2F8N A;  1P3G B;  4E45 A;  5B33 A;  4CSR B;  4NFT A;  5C3I B;  5AV6 A;  5GXQ A;  5GXQ D;  1N1J B;  3MNN A;  4H9O B;  1P3A B;  5E5A C;  3REH A;  3KXB A;  3REH D;  5B31 G;  3KXB D;  3AV2 B;  1P3M C;  1P3I D;  5G49 A;  1P3K C;  1BH9 B;  2PYO B;  4JJN C;  2NQB D;  1HQ3 A;  3W96 A;  3AZN C;  3MGQ B;  5BO0 B;  4KGC A;  5JA4 A;  4KGC D;  4H9N A;  1TZY C;  4Z5T D;  4H9P A;  3UTA B;  5B1L A;  5B1L D;  3AZK D;  5B2I C;  5AVB C;  3O62 B;  3AYW B;  1P3O B;  5B2J A;  5B32 C;  4Z66 B;  5GT0 B;  1F1E A;  3X1S C;  4DRA A;  4G92 B;  3AV1 C;  3REI D;  1M19 C;  3WKJ D;  1KX4 C;  1P3L A;  1P3L D;  2HIO A;  4AWL C;  3UTB C;  1P3F D;  1ZLA B;  5BT1 C;  1WWI A;  3REJ B;  3AZJ B;  5B31 C;  3NQJ A;  3AZF C;  1P3G D;  2BYM B;  4DRB A;  5BS7 A;  1P3P B;  3AZE A;  4WU8 C;  4J8U B;  3AZI C;  4X23 B;  4J8W B;  1U35 A;  4QLC C;  3AV2 D;  3WTP C;  5BNX A;  4HGA B;  3X1V A;  4R8P D;  1TAF A;  4XZQ B;  4H9S C;  1BFM A;  3TU4 B;  1P34 B;  5AV8 D;  5BNV B;  4XUJ A;  2CWE A;  3MGP B;  1P3M A;  5DNN B;  1P3B D;  3C1B A;  2IO5 B;  3O62 D;  3X1U C;  3AZN A;  4Z66 D;  4H9R B;  3X1T C;  5AV9 C;  4G91 C;  1EQZ C;  1TZY A;  3MVD B;  5B0Z C;  3W99 A;  3W99 D;  1S32 C;  4Z2M H;  5B0Y C;  3V9R B;  5B2I A;  5AVB A;  2BYK A;  3KWQ D;  5DNM D;  4YM6 D;  1ZLA D;  5JRG B;  3X1S A;  3AZJ D;  4J8X B;  4KUD A;  5B40 C;  4KUD D;  3AV1 A;  1ID3 C;  4WU9 D;  4J8V B;  3AFA A;  1KX4 A;  4WNN B;  4J8U D;  4ZBJ B;  2NZD A;  2YFW A;  4UUZ B;  2NZD D;  5GXQ C;  2YFV A;  4WV4 B;  1HTA A;  3AZH A;  5F99 B;  3AZH D;  5B31 A;  3REH C;  3KXB C;  3WAA D;  1P3I C;  4WU8 A;  3WA9 A;  3B0D C;  3W97 B;  1M18 B;  1HQ3 C;  5CPK B;  3LEL B;  4QLC A;  3C1C A;  3B6F D;  4KGC C;  4KHA B;  5B1L C;  2FJ7 A;  2FJ7 D;  3AN2 B;  4H9Q A;  5B2J C;  4Z2M G;  3NQU A;  3MVD D;  4ZUX A;  5B1M A;  5B1M D;  1AOI B;  3REI C;  3WKJ C;  3REK B;  2F8N B;  5B33 B;  1P3L C;  1A7W A;  2ARO D;  3X1T A;  4NE5 A;  5JRG D;  5AV6 B;  5AV5 A;  5CPJ A;  5AVC B;  5AV5 D;  3MNN B;  1M1A B;  1KX5 A;  1KX5 D;  5GSU D;  1F66 A;  1F66 D;  5G49 B;  3AZE C;  1U35 C;  5F99 D;  3W96 B;  5CP6 A;  5B40 A;  1ID3 A;  3X1V C;  4H9N B;  4R8P C;  4H9P B;  3AZM B;  1KX3 D;  5CPK D;  4M6B A;  3R45 A;  5AV8 C;  4NE3 A;  5CHL B;  4XUJ C;  3MGS B;  5B24 B;  3REL B;  1P3I A;  3W98 D;  3UT9 B;  1P3B C;  2NQB A;  3C1B C;  3LZ1 A;  2CV5 A;  3LZ1 D;  2CV5 D;  1BH8 B;  2HIO B;  4Z5T A;  3LZ0 D;  3AZG B;  3LJA B;  3W99 C;  3AZL B;  3KUY A;  5CPI B;  3KUY D;  3AZK A;  3NQJ B;  3MGR B;  4LD9 B;  5AY8 B;  3WTP E;  1M1A D;  3KWQ C;  5DNM C;  4YM6 C;  4YS3 D;  3VH5 A;  3KSY A;  4KUD C;  3REI A;  5GT3 D;  3WKJ A;  4WU9 C;  3A6N D;  3AFA C;  2NZD C;  1P3F A;  3AZH C;  5E5A B;  3B6G D;  1P3M B;  3WAA C;  1P3G A;  4CSR A;  1P3K B;  3WA9 C;  3AZM D;  4JJN B;  1JFI B;  1N1J A;  3MGS D;  1P3A D;  3B6F C;  3C1C C;  5B24 D;  3REL D;  3AZN B;  3AV2 A;  3UT9 D;  1BH9 A;  2PYO D;  1TZY B;  4R8P A;  2FJ7 C;  5B2I B;  5AV8 A;  5AVB B;  1H3O B;  5KDM A;  5BO0 A;  3MGQ D;  5B32 B;  3UTA A;  3LJA D;  3UTA D;  4ZUX C;  3AZL D;  5B1M C;  3X1S B;  1P3B A;  3AV1 B;  3O62 A;  1M19 B;  3B0C W;  3AYW A;  3AYW D;  1P3O A;  4LD9 D;  1P3O D;  1KX4 B;  4Z66 A;  1B6W A;  5GT0 D;  2ARO C;  4AWL B;  3UTB B;  5CPJ C;  5AV5 C;  1KX5 C;  5GSU C;  5B31 B;  1F66 C;  3AZF B;  4WU8 B;  3WA9 B;  3KWQ A;  5DNM A;  4YM6 A;  3AZI B;  1ZLA A;  3REJ D;  5E5A D;  3AZJ A;  5CP6 C;  4QLC B;  3C1C B;  3WTP B;  2BYM A;  4WU9 A;  1P3P D;  1P3K D;  4JJN D;  4J8U A;  4J8W A;  1KX3 C;  4X23 D;  4J8W D;  3WAA A;  3W98 C;  4EO5 C;  2HUE C;  4XZQ A;  4XZQ D;  3TU4 D;  1P34 A;  2NQB C;  1P34 D;  2LY8 A;  3LZ1 C;  2CV5 C;  3MGP D;  3B6F A;  3X1U B;  2JSS A;  3X1T B;  2RVQ D;  5AV9 B;  4G91 B;  1EQZ B;  3LZ0 C;  4Z5T C;  5B0Z B;  5DNN A;  5DNN D;  1S32 B;  3KUY C;  1M19 D;  5B0Y B;  3AZK C;  5FUG B;  3MVD A;  4YS3 C;  5BT1 D;  5CP6 B;  5B40 B;  5GT3 C;  1ID3 B;  3A6N C;  2ARO A;  3AZI D;  5JRG A;  1P3F C;  5GXQ B;  3R45 B;  4CAY A;  4J8X A;  4J8X D;  3WTP D;  5GSU A;  3B6G C;  4J8V A;  3REH B;  3KXB B;  4J8V D;  1P3G C;  1P3I B;  4WNN A;  5C3I C;  3B0D B;  4UUZ A;  1WWS A;  1HQ3 B;  5F99 A;  1KU5 A;  1P3A C;  3AV2 C;  2PYO C;  5JA4 B;  4KGC B;  3W97 A;  3W97 D;  5B1L B;  1M18 D;  1KX3 A;  5CPK A;  3LEL D;  3MGQ C;  5B2J B;  3W98 A;  3UTA C;  5B0Y D;  3AN2 A;  3AN2 D;  3VH5 W;  3REI B;  3O62 C;  3WKJ B;  3AYW C;  1P3O C;  1P3L B;  4Z66 C;  2L5A A;  2F8N K;  1AOI A;  3LZ0 A;  1AOI D;  4G92 C;  3REK A;  3REK D;  2F8N D;  1R4V A;  5B33 D;  3AZE B;  4E44 A;  1M1A A;  5AV6 D;  5AVC A;  5AVC D;  1ZLA C;  3MNN D;  4YS3 A;  1U35 B;  3REJ C;  3AZJ C;  3VH6 W;  5GT3 A;  5BNX B;  3X1V B;  1P3P C;  3A6N A;  4R8P B;  4J8U C;  1TAF B;  4X23 C;  4J8W C;  2F8N H;  1HQ3 D;  3W96 D;  5AV8 B;  4XUJ B;  5KDM B;  3B6G A;  4HGA C;  4WZS B;  4XZQ C;  3AZM A;  3TU4 C;  1P3B B;  1ULY A;  4H9O A;  3MGS A;  3C1B B;  3VH6 A;  1P34 C;  1P3A A;  3B0C T;  3MGP C;  5B24 A;  3REL A;  5B2J D;  2RVQ C;  3UT9 A;  2PYO A;  3W99 B;  5DNN C;  2IO5 C; 
#chains in the Genus database with same CATH topology
 1BH8 A;  3MGQ A;  2HIO D;  2BYK B;  3KWQ B;  3MVD C;  4YM6 B;  3LJA A;  5DNM B;  3AZG A;  3AZG D;  3AZL A;  5CPI A;  5CPI D;  3MGR A;  4KUD B;  3MGR D;  4WU9 B;  4LD9 A;  3AZE D;  5AY8 A;  3AFA B;  5AY8 D;  5GT0 A;  5JRG C;  1U35 D;  2YFW B;  2NZD B;  3EPK A;  2YFV B;  4J8X C;  3AZH B;  4J8V C;  3X1V D;  3WAA B;  2F8N G;  4ZBJ C;  4XUJ D;  5E5A A;  5F99 C;  3REJ A;  3B6F B;  1P3M D;  3AL0 C;  1P3P A;  1P3K A;  4JJN A;  1JFI A;  3W97 C;  1M18 C;  1B67 A;  4X23 A;  2FJ7 B;  5CPK C;  3C1B D;  3LEL C;  4H9Q B;  2DF4 C;  3AZN D;  3NQU B;  2G5H C;  1TZY D;  4ZUX B;  5B1M B;  3TU4 A;  3AN2 C;  5B2I D;  5AVB D;  1H3O A;  5BNV A;  3MGP A;  5B32 A;  2J8P A;  5B32 D;  2ARO B;  5CPJ B;  5AV5 B;  1KX5 B;  3X1S D;  1AOI C;  4CAY B;  5GSU B;  3AV1 D;  1M19 A;  3A1K A;  3REK C;  1F66 B;  3AFA D;  5B33 C;  1KX4 D;  4H9R A;  3UTB A;  1Q9C A;  3UTB D;  5AV6 C;  1M1A C;  5AVC C;  3MNN C;  5B31 D;  3V9R A;  3AZF A;  3AZF D;  4NE6 A;  4WU8 D;  3WA9 D;  3AZI A;  1KX3 B;  3W96 C;  4QLC D;  3C1C D;  3WTP A;  3W98 B;  4EO5 B;  2HUE B;  3AZM C;  4H9S A;  2JCH A;  3VH5 T;  2NQB B;  3MGS C;  3LZ1 B;  2CV5 B;  5B24 C;  3REL C;  3UT9 C;  4ZUX D;  3LZ0 B;  4Z5T B;  1M18 A;  3KUY B;  3AZK B;  3LEL A;  3B0B A;  3X1U A;  3X1U D;  2G5I C;  3X1T D;  2HIO C;  2Y2P A;  5AV9 A;  5AV9 D;  5CPJ D;  1EQZ A;  1EQZ D;  4KHA A;  5B0Z A;  5B0Z D;  3LJA C;  3AZG C;  4YS3 B;  1S32 A;  3AZL C;  5CPI C;  1S32 D;  5B0Y A;  3MGR C;  5FUG A;  5GT3 B;  3VH6 T;  5BS7 C;  3A6N B;  4LD9 C;  5AY8 C;  5GT0 C;  5B32 G;  4UPK A;  1P3F B;  5CP6 D;  5B40 D;  3B6G B;  1ID3 D;  2F8N A;  1P3G B;  4E45 A;  5B33 A;  4CSR B;  4NFT A;  5C3I B;  5AV6 A;  5GXQ A;  5GXQ D;  1N1J B;  3MNN A;  4H9O B;  1P3A B;  5E5A C;  3REH A;  3KXB A;  3REH D;  5B31 G;  3KXB D;  3AV2 B;  1P3M C;  1P3I D;  5G49 A;  1P3K C;  1BH9 B;  2PYO B;  4JJN C;  2NQB D;  1HQ3 A;  3W96 A;  3AZN C;  3MGQ B;  5BO0 B;  4KGC A;  5JA4 A;  4KGC D;  4H9N A;  1TZY C;  4Z5T D;  4H9P A;  3UTA B;  5B1L A;  5B1L D;  3AZK D;  5B2I C;  5AVB C;  3O62 B;  3AYW B;  1P3O B;  5B2J A;  3EPL A;  5B32 C;  4Z66 B;  5GT0 B;  1F1E A;  4DQY B;  3X1S C;  4DRA A;  4G92 B;  3AV1 C;  3REI D;  1M19 C;  3WKJ D;  1KX4 C;  1P3L A;  1P3L D;  2HIO A;  4AWL C;  3UTB C;  1P3F D;  2Y2H A;  1ZLA B;  5BT1 C;  1WWI A;  3REJ B;  3AZJ B;  5B31 C;  3NQJ A;  3AZF C;  1P3G D;  2BYM B;  4DRB A;  1Z2C B;  5BS7 A;  1P3P B;  3AZE A;  4WU8 C;  4J8U B;  3AZI C;  3KFU G;  4X23 B;  4J8W B;  1U35 A;  4QLC C;  3AV2 D;  3WTP C;  5BNX A;  4HGA B;  3X1V A;  3EPH A;  4R8P D;  1TAF A;  4XZQ B;  4H9S C;  1BFM A;  3TU4 B;  3F6T A;  5AV8 D;  5BNV B;  4XUJ A;  1P34 B;  2CWE A;  3MGP B;  2FFF B;  1P3M A;  5DNN B;  1P3B D;  3C1B A;  2IO5 B;  3O62 D;  3X1U C;  3AZN A;  4Z66 D;  4H9R B;  3X1T C;  5AV9 C;  4G91 C;  1EQZ C;  1TZY A;  3MVD B;  5B0Z C;  3W99 A;  3W99 D;  1S32 C;  2XD1 A;  4Z2M H;  5B0Y C;  3V9R B;  5B2I A;  5AVB A;  2BYK A;  3KWQ D;  5DNM D;  4YM6 D;  1ZLA D;  5JRG B;  3X1S A;  3AZJ D;  4J8X B;  4KUD A;  5B40 C;  4KUD D;  3AV1 A;  1ID3 C;  4WU9 D;  4J8V B;  3AFA A;  1KX4 A;  4WNN B;  4J8U D;  4ZBJ B;  2NZD A;  2YFW A;  4UUZ B;  2NZD D;  5GXQ C;  2Y2J A;  2YFV A;  4WV4 B;  1HTA A;  3AZH A;  5F99 B;  3AZH D;  5B31 A;  3REH C;  3KXB C;  2VQR A;  3WAA D;  1P3I C;  4WU8 A;  3WA9 A;  3B0D C;  3W97 B;  1M18 B;  1HQ3 C;  5CPK B;  3LEL B;  4QLC A;  3C1C A;  3B6F D;  4KGC C;  4KHA B;  5B1L C;  2FJ7 A;  2FJ7 D;  3AN2 B;  4H9Q A;  5B2J C;  4Z2M G;  3NQU A;  3MVD D;  4ZUX A;  5B1M A;  5B1M D;  1AOI B;  3REI C;  3WKJ C;  3REK B;  2F8N B;  5B33 B;  1P3L C;  1A7W A;  2ARO D;  3X1T A;  4NE5 A;  5JRG D;  5AV6 B;  5AV5 A;  5CPJ A;  5AVC B;  5AV5 D;  3MNN B;  1M1A B;  1KX5 A;  1KX5 D;  5GSU D;  1F66 A;  1F66 D;  5G49 B;  3AZE C;  1U35 C;  5F99 D;  3W96 B;  5CP6 A;  3IP4 C;  5B40 A;  1ID3 A;  2XD5 A;  3X1V C;  4H9N B;  4R8P C;  4H9P B;  3AZM B;  1KX3 D;  5CPK D;  4M6B A;  3R45 A;  5AV8 C;  4NE3 A;  5CHL B;  4XUJ C;  3MGS B;  3EPJ A;  5B24 B;  3REL B;  1P3I A;  3W98 D;  3UT9 B;  1P3B C;  2NQB A;  3C1B C;  3LZ1 A;  2CV5 A;  3LZ1 D;  2CV5 D;  1BH8 B;  2HIO B;  4Z5T A;  3LZ0 D;  3AZG B;  3LJA B;  3W99 C;  3AZL B;  3KUY A;  5CPI B;  3KUY D;  3AZK A;  3NQJ B;  3MGR B;  4LD9 B;  5AY8 B;  3WTP E;  1M1A D;  3KWQ C;  5DNM C;  4YM6 C;  4YS3 D;  3VH5 A;  3KSY A;  2W8S A;  4KUD C;  3REI A;  5GT3 D;  3WKJ A;  4WU9 C;  3A6N D;  3AFA C;  2NZD C;  1P3F A;  2ZY5 A;  3AZH C;  5E5A B;  3B6G D;  1P3M B;  3WAA C;  1P3G A;  4CSR A;  1P3K B;  3WA9 C;  3AZM D;  4JJN B;  1JFI B;  1N1J A;  3MGS D;  1P3A D;  3B6F C;  3C1C C;  5B24 D;  3REL D;  3AZN B;  3AV2 A;  3UT9 D;  1BH9 A;  2PYO D;  1TZY B;  4R8P A;  4WJ3 C;  2FJ7 C;  5B2I B;  5AV8 A;  5AVB B;  1H3O B;  5KDM A;  5BO0 A;  3MGQ D;  5B32 B;  3UTA A;  3LJA D;  3UTA D;  4ZUX C;  3AZL D;  5B1M C;  3X1S B;  1P3B A;  3AV1 B;  3O62 A;  1M19 B;  3B0C W;  3AYW A;  3AYW D;  1P3O A;  4LD9 D;  1P3O D;  2BG1 A;  2ZY4 A;  4Z66 A;  1B6W A;  5GT0 D;  2ARO C;  1KX4 B;  4AWL B;  3UTB B;  5CPJ C;  5AV5 C;  1KX5 C;  5GSU C;  5B31 B;  2Y2K A;  1F66 C;  3AZF B;  4WU8 B;  3WA9 B;  3KWQ A;  5DNM A;  4YM6 A;  3AZI B;  1ZLA A;  3REJ D;  5E5A D;  3AZJ A;  5CP6 C;  3H0M C;  4QLC B;  3C1C B;  3WTP B;  2BYM A;  4WU9 A;  1W2E A;  2Y2M A;  1P3K D;  1P3P D;  4JJN D;  4J8U A;  4J8W A;  1T3U A;  4X23 D;  4J8W D;  1KX3 C;  3WAA A;  3W98 C;  4EO5 C;  2HUE C;  3H0R C;  4XZQ A;  4XZQ D;  3TU4 D;  1P34 A;  2NQB C;  1P34 D;  2LY8 A;  3LZ1 C;  2CV5 C;  3MGP D;  3B6F A;  3X1U B;  2JSS A;  3X1T B;  2RVQ D;  5AV9 B;  4G91 B;  1EQZ B;  3LZ0 C;  4Z5T C;  5B0Z B;  5DNN A;  5DNN D;  1S32 B;  3KUY C;  1M19 D;  5B0Y B;  3AZK C;  5FUG B;  2JE5 A;  3H0L C;  2Y2Q A;  2Y2G A;  3MVD A;  4YS3 C;  3EG5 B;  5BT1 D;  5CP6 B;  5B40 B;  5GT3 C;  1ID3 B;  3A6N C;  2Y2L A;  2ARO A;  3AZI D;  5JRG A;  1P3F C;  5GXQ B;  3R45 B;  4CAY A;  4J8X A;  4J8X D;  3WTP D;  2F2A C;  5GSU A;  3B6G C;  4J8V A;  3REH B;  3KXB B;  4J8V D;  2Y2N A;  1P3G C;  1P3I B;  4WNN A;  1PZR A;  2ZY2 A;  5C3I C;  3B0D B;  4UUZ A;  1WWS A;  1HQ3 B;  5F99 A;  1KU5 A;  3FDD A;  1P3A C;  3AV2 C;  2RIQ A;  2PYO C;  5JA4 B;  4KGC B;  3W97 A;  3W97 D;  5B1L B;  1M18 D;  1KX3 A;  5CPK A;  3LEL D;  3MGQ C;  5B2J B;  3W98 A;  3UTA C;  5B0Y D;  3AN2 A;  3AN2 D;  3VH5 W;  3REI B;  3O62 C;  3WKJ B;  3AYW C;  1P3O C;  1P3L B;  4Z66 C;  2L5A A;  2F8N K;  1AOI A;  3LZ0 A;  1AOI D;  4G92 C;  3REK A;  3REK D;  2F8N D;  1R4V A;  5B33 D;  3AZE B;  4E44 A;  1M1A A;  5AV6 D;  5AVC A;  5AVC D;  1ZLA C;  3MNN D;  4YS3 A;  1U35 B;  3REJ C;  3AZJ C;  2Y2I A;  2ZY3 A;  3VH6 W;  5BNX B;  5GT3 A;  3X1V B;  1P3P C;  2Y2O A;  3A6N A;  2UWX A;  4R8P B;  4J8U C;  1TAF B;  3A1I A;  4X23 C;  4J8W C;  1HQ3 D;  2F8N H;  3W96 D;  2DQN C;  5AV8 B;  4XUJ B;  5KDM B;  3B6G A;  4HGA C;  4WZS B;  3P5J B;  4XZQ C;  3AZM A;  3TU4 C;  2ZM5 A;  1P3B B;  1ULY A;  4H9O A;  3MGS A;  3C1B B;  3VH6 A;  1P34 C;  1P3A A;  3B0C T;  3MGP C;  5B24 A;  3REL A;  5B2J D;  2RVQ C;  3UT9 A;  2PYO A;  3W99 B;  5DNN C;  2IO5 C; 
#chains in the Genus database with same CATH homology
 1BH8 A;  3MGQ A;  2HIO D;  2BYK B;  3KWQ B;  3MVD C;  4YM6 B;  3LJA A;  5DNM B;  3AZG A;  3AZG D;  3AZL A;  5CPI A;  5CPI D;  3MGR A;  4KUD B;  3MGR D;  4WU9 B;  4LD9 A;  3AZE D;  5AY8 A;  3AFA B;  5AY8 D;  5GT0 A;  5JRG C;  1U35 D;  2YFW B;  2NZD B;  3EPK A;  2YFV B;  4J8X C;  3AZH B;  4J8V C;  3X1V D;  3WAA B;  2F8N G;  4ZBJ C;  4XUJ D;  5E5A A;  5F99 C;  3REJ A;  3B6F B;  1P3M D;  3AL0 C;  1P3P A;  1P3K A;  4JJN A;  1JFI A;  3W97 C;  1M18 C;  1B67 A;  4X23 A;  2FJ7 B;  5CPK C;  3C1B D;  3LEL C;  4H9Q B;  2DF4 C;  3AZN D;  3NQU B;  2G5H C;  1TZY D;  4ZUX B;  5B1M B;  3TU4 A;  3AN2 C;  5B2I D;  5AVB D;  1H3O A;  5BNV A;  3MGP A;  5B32 A;  2J8P A;  5B32 D;  2ARO B;  5CPJ B;  5AV5 B;  1KX5 B;  3X1S D;  1AOI C;  4CAY B;  5GSU B;  3AV1 D;  1M19 A;  3A1K A;  3REK C;  1F66 B;  3AFA D;  5B33 C;  1KX4 D;  4H9R A;  3UTB A;  1Q9C A;  3UTB D;  5AV6 C;  1M1A C;  5AVC C;  3MNN C;  5B31 D;  3V9R A;  3AZF A;  3AZF D;  4NE6 A;  4WU8 D;  3WA9 D;  3AZI A;  1KX3 B;  3W96 C;  4QLC D;  3C1C D;  3WTP A;  3W98 B;  4EO5 B;  2HUE B;  3AZM C;  4H9S A;  2JCH A;  3VH5 T;  2NQB B;  3MGS C;  3LZ1 B;  2CV5 B;  5B24 C;  3REL C;  3UT9 C;  4ZUX D;  3LZ0 B;  4Z5T B;  1M18 A;  3KUY B;  3AZK B;  3LEL A;  3B0B A;  3X1U A;  3X1U D;  2G5I C;  3X1T D;  2HIO C;  2Y2P A;  5AV9 A;  5AV9 D;  5CPJ D;  1EQZ A;  1EQZ D;  4KHA A;  5B0Z A;  5B0Z D;  3LJA C;  3AZG C;  4YS3 B;  1S32 A;  3AZL C;  5CPI C;  1S32 D;  5B0Y A;  3MGR C;  5FUG A;  5GT3 B;  3VH6 T;  5BS7 C;  3A6N B;  4LD9 C;  5AY8 C;  5GT0 C;  5B32 G;  4UPK A;  1P3F B;  5CP6 D;  5B40 D;  3B6G B;  1ID3 D;  2F8N A;  1P3G B;  4E45 A;  5B33 A;  4CSR B;  4NFT A;  5C3I B;  5AV6 A;  5GXQ A;  5GXQ D;  1N1J B;  3MNN A;  4H9O B;  1P3A B;  5E5A C;  3REH A;  3KXB A;  3REH D;  5B31 G;  3KXB D;  3AV2 B;  1P3M C;  1P3I D;  5G49 A;  1P3K C;  1BH9 B;  2PYO B;  4JJN C;  2NQB D;  1HQ3 A;  3W96 A;  3AZN C;  3MGQ B;  5BO0 B;  4KGC A;  5JA4 A;  4KGC D;  4H9N A;  1TZY C;  4Z5T D;  4H9P A;  3UTA B;  5B1L A;  5B1L D;  3AZK D;  5B2I C;  5AVB C;  3O62 B;  3AYW B;  1P3O B;  5B2J A;  3EPL A;  5B32 C;  4Z66 B;  5GT0 B;  1F1E A;  4DQY B;  3X1S C;  4DRA A;  4G92 B;  3AV1 C;  3REI D;  1M19 C;  3WKJ D;  1KX4 C;  1P3L A;  1P3L D;  2HIO A;  4AWL C;  3UTB C;  1P3F D;  2Y2H A;  1ZLA B;  5BT1 C;  1WWI A;  3REJ B;  3AZJ B;  5B31 C;  3NQJ A;  3AZF C;  1P3G D;  2BYM B;  4DRB A;  1Z2C B;  5BS7 A;  1P3P B;  3AZE A;  4WU8 C;  4J8U B;  3AZI C;  3KFU G;  4X23 B;  4J8W B;  1U35 A;  4QLC C;  3AV2 D;  3WTP C;  5BNX A;  4HGA B;  3X1V A;  3EPH A;  4R8P D;  1TAF A;  4XZQ B;  4H9S C;  1BFM A;  3TU4 B;  3F6T A;  5AV8 D;  5BNV B;  4XUJ A;  1P34 B;  2CWE A;  3MGP B;  2FFF B;  1P3M A;  5DNN B;  1P3B D;  3C1B A;  2IO5 B;  3O62 D;  3X1U C;  3AZN A;  4Z66 D;  4H9R B;  3X1T C;  5AV9 C;  4G91 C;  1EQZ C;  1TZY A;  3MVD B;  5B0Z C;  3W99 A;  3W99 D;  1S32 C;  2XD1 A;  4Z2M H;  5B0Y C;  3V9R B;  5B2I A;  5AVB A;  2BYK A;  3KWQ D;  5DNM D;  4YM6 D;  1ZLA D;  5JRG B;  3X1S A;  3AZJ D;  4J8X B;  4KUD A;  5B40 C;  4KUD D;  3AV1 A;  1ID3 C;  4WU9 D;  4J8V B;  3AFA A;  1KX4 A;  4WNN B;  4J8U D;  4ZBJ B;  2NZD A;  2YFW A;  4UUZ B;  2NZD D;  5GXQ C;  2Y2J A;  2YFV A;  4WV4 B;  1HTA A;  3AZH A;  5F99 B;  3AZH D;  5B31 A;  3REH C;  3KXB C;  2VQR A;  3WAA D;  1P3I C;  4WU8 A;  3WA9 A;  3B0D C;  3W97 B;  1M18 B;  1HQ3 C;  5CPK B;  3LEL B;  4QLC A;  3C1C A;  3B6F D;  4KGC C;  4KHA B;  5B1L C;  2FJ7 A;  2FJ7 D;  3AN2 B;  4H9Q A;  5B2J C;  4Z2M G;  3NQU A;  3MVD D;  4ZUX A;  5B1M A;  5B1M D;  1AOI B;  3REI C;  3WKJ C;  3REK B;  2F8N B;  5B33 B;  1P3L C;  1A7W A;  2ARO D;  3X1T A;  4NE5 A;  5JRG D;  5AV6 B;  5AV5 A;  5CPJ A;  5AVC B;  5AV5 D;  3MNN B;  1M1A B;  1KX5 A;  1KX5 D;  5GSU D;  1F66 A;  1F66 D;  5G49 B;  3AZE C;  1U35 C;  5F99 D;  3W96 B;  5CP6 A;  3IP4 C;  5B40 A;  1ID3 A;  2XD5 A;  3X1V C;  4H9N B;  4R8P C;  4H9P B;  3AZM B;  1KX3 D;  5CPK D;  4M6B A;  3R45 A;  5AV8 C;  4NE3 A;  5CHL B;  4XUJ C;  3MGS B;  3EPJ A;  5B24 B;  3REL B;  1P3I A;  3W98 D;  3UT9 B;  1P3B C;  2NQB A;  3C1B C;  3LZ1 A;  2CV5 A;  3LZ1 D;  2CV5 D;  1BH8 B;  2HIO B;  4Z5T A;  3LZ0 D;  3AZG B;  3LJA B;  3W99 C;  3AZL B;  3KUY A;  5CPI B;  3KUY D;  3AZK A;  3NQJ B;  3MGR B;  4LD9 B;  5AY8 B;  3WTP E;  1M1A D;  3KWQ C;  5DNM C;  4YM6 C;  4YS3 D;  3VH5 A;  3KSY A;  2W8S A;  4KUD C;  3REI A;  5GT3 D;  3WKJ A;  4WU9 C;  3A6N D;  3AFA C;  2NZD C;  1P3F A;  2ZY5 A;  3AZH C;  5E5A B;  3B6G D;  1P3M B;  3WAA C;  1P3G A;  4CSR A;  1P3K B;  3WA9 C;  3AZM D;  4JJN B;  1JFI B;  1N1J A;  3MGS D;  1P3A D;  3B6F C;  3C1C C;  5B24 D;  3REL D;  3AZN B;  3AV2 A;  3UT9 D;  1BH9 A;  2PYO D;  1TZY B;  4R8P A;  4WJ3 C;  2FJ7 C;  5B2I B;  5AV8 A;  5AVB B;  1H3O B;  5KDM A;  5BO0 A;  3MGQ D;  5B32 B;  3UTA A;  3LJA D;  3UTA D;  4ZUX C;  3AZL D;  5B1M C;  3X1S B;  1P3B A;  3AV1 B;  3O62 A;  1M19 B;  3B0C W;  3AYW A;  3AYW D;  1P3O A;  4LD9 D;  1P3O D;  2BG1 A;  2ZY4 A;  4Z66 A;  1B6W A;  5GT0 D;  2ARO C;  1KX4 B;  4AWL B;  3UTB B;  5CPJ C;  5AV5 C;  1KX5 C;  5GSU C;  5B31 B;  2Y2K A;  1F66 C;  3AZF B;  4WU8 B;  3WA9 B;  3KWQ A;  5DNM A;  4YM6 A;  3AZI B;  1ZLA A;  3REJ D;  5E5A D;  3AZJ A;  5CP6 C;  3H0M C;  4QLC B;  3C1C B;  3WTP B;  2BYM A;  4WU9 A;  1W2E A;  2Y2M A;  1P3K D;  1P3P D;  4JJN D;  4J8U A;  4J8W A;  1T3U A;  4X23 D;  4J8W D;  1KX3 C;  3WAA A;  3W98 C;  4EO5 C;  2HUE C;  3H0R C;  4XZQ A;  4XZQ D;  3TU4 D;  1P34 A;  2NQB C;  1P34 D;  2LY8 A;  3LZ1 C;  2CV5 C;  3MGP D;  3B6F A;  3X1U B;  2JSS A;  3X1T B;  2RVQ D;  5AV9 B;  4G91 B;  1EQZ B;  3LZ0 C;  4Z5T C;  5B0Z B;  5DNN A;  5DNN D;  1S32 B;  3KUY C;  1M19 D;  5B0Y B;  3AZK C;  5FUG B;  2JE5 A;  3H0L C;  2Y2Q A;  2Y2G A;  3MVD A;  4YS3 C;  3EG5 B;  5BT1 D;  5CP6 B;  5B40 B;  5GT3 C;  1ID3 B;  3A6N C;  2Y2L A;  2ARO A;  3AZI D;  5JRG A;  1P3F C;  5GXQ B;  3R45 B;  4CAY A;  4J8X A;  4J8X D;  3WTP D;  2F2A C;  5GSU A;  3B6G C;  4J8V A;  3REH B;  3KXB B;  4J8V D;  2Y2N A;  1P3G C;  1P3I B;  4WNN A;  1PZR A;  2ZY2 A;  5C3I C;  3B0D B;  4UUZ A;  1WWS A;  1HQ3 B;  5F99 A;  1KU5 A;  3FDD A;  1P3A C;  3AV2 C;  2RIQ A;  2PYO C;  5JA4 B;  4KGC B;  3W97 A;  3W97 D;  5B1L B;  1M18 D;  1KX3 A;  5CPK A;  3LEL D;  3MGQ C;  5B2J B;  3W98 A;  3UTA C;  5B0Y D;  3AN2 A;  3AN2 D;  3VH5 W;  3REI B;  3O62 C;  3WKJ B;  3AYW C;  1P3O C;  1P3L B;  4Z66 C;  2L5A A;  2F8N K;  1AOI A;  3LZ0 A;  1AOI D;  4G92 C;  3REK A;  3REK D;  2F8N D;  1R4V A;  5B33 D;  3AZE B;  4E44 A;  1M1A A;  5AV6 D;  5AVC A;  5AVC D;  1ZLA C;  3MNN D;  4YS3 A;  1U35 B;  3REJ C;  3AZJ C;  2Y2I A;  2ZY3 A;  3VH6 W;  5BNX B;  5GT3 A;  3X1V B;  1P3P C;  2Y2O A;  3A6N A;  2UWX A;  4R8P B;  4J8U C;  1TAF B;  3A1I A;  4X23 C;  4J8W C;  1HQ3 D;  2F8N H;  3W96 D;  2DQN C;  5AV8 B;  4XUJ B;  5KDM B;  3B6G A;  4HGA C;  4WZS B;  3P5J B;  4XZQ C;  3AZM A;  3TU4 C;  2ZM5 A;  1P3B B;  1ULY A;  4H9O A;  3MGS A;  3C1B B;  3VH6 A;  1P34 C;  1P3A A;  3B0C T;  3MGP C;  5B24 A;  3REL A;  5B2J D;  2RVQ C;  3UT9 A;  2PYO A;  3W99 B;  5DNN C;  2IO5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...