3AZIB

Crystal structure of human nucleosome core particle containing h4k31q mutation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
b'NIQGITQPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aziB00
5AV9B 2F8NA 1M19B 3AZJA 3W96D 2CV5A 3MVDB 4XUJD 2HUEB 4WZSB 2PYOA 3B6GD 4H9NB 3AYWC 2FJ7A 5AVCD 3LZ1A 3RELC 5F99A 5DNNA 4Z5TC 4Z66D 5B2IC 4R8PD 2F8NG 5C3IC 1P3KA 4KHAB 2HIOD 3AZLD 3W97D 1H3OB 1M1AD 1P3FC 4WNNB 2F8ND 1B6WA 2L5AA 3AZJD 3AYWB 1KX3A 3RELB 2YFWA 2CV5D 3W99C 4Z5TB 5B40A 5B2IB 3REHD 2PYOD 4H9PB 5B1MC 3AZIA 2F8NH 5C3IB 1P3PC 1Q9CA 3LZ1D 1P3FB 5F99D 5DNND 5DNMA 3VH6T 4EO5C 1P3KD 1KU5A 3W99B 5CP6C 5AV5C 3AZKC 5B1MB 5AV9A 3AV2C 1S32A 1P3PB 4XZQC 1M19A 1KX3D 4DRAA 3MVDA 5B40D 1WWIA 3AZID 4EO5B 3AZFC 1AOIC 2F8NK 5B0YC 4H9NA 1P3GD 5CP6B 5DNMD 5AV5B 4M6BA 3AZKB 4YM6B 3AV2B 1M18C 4KHAA 4XZQB 4YS3C 1H3OA 3REKA 4WNNA 5AV9D 3AZFB 1AOIB 1S32D 4KUDC 5B0YB 3O62A 1M19D 3AYWA 2LY8A 3RELA 3MVDD 4Z5TA 3B0BA 5B2IA 1M18B 4J8UB 5FUGB 4YS3B 1P3FA 5B1LC 4E44A 3B6FC 4KUDB 3W99A 3REKD 1P34C 5E5AC 4WU8C 5B1MA 3UT9C 3O62D 1P3PA 3AYWD 3RELD 5B1LB 4Z5TD 5B2ID 3B6FB 5AVBC 4NE5A 2CWEA 1P3BC 4H9SC 4WU9C 2BYKB 4NE6A 1P3FD 5CP6A 5G49B 5AV5A 3AZKA 5E5AB 4WU8B 3UT9B 1P34B 5AV6C 3AV2A 4XZQA 3W99D 5BT1D 5GSUA 5AVBB 5B1MD 1P3LC 3WTPC 3AZFA 1AOIA 3VH5W 1P3PD 1P3BB 5B0YA 4WU9B 5CHLB 3MNNC 4G92C 5AV6B 3VH6W 5GT0C 3MGQC 1M18A 5CPKC 4YS3A 4KGCC 5CP6D 5AV5D 5B2JC 3AZKD 5GXQC 3NQUB 5BS7C 3WTPB 1P3LB 3WTPE 3AV2D 4KUDA 4XZQD 1P3AC 3C1BC 3MNNB 4G92B 3TU4C 4JJNC 5GSUD 5BNVB 3AZFD 1AOID 1P3MC 5GT0B 3MGQB 5B0YD 4J8VC 5CPKB 4KGCB 5B32D 1A7WA 5B1LA 5B2JB 5GXQB 3X1SA 3B6FA 1M18D 2AROC 1P3AB 1EQZC 5JA4B 4YS3D 3C1BB 3WAAC 4JJNB 5G49A 3MGSD 1P34A 5E5AA 4WU8A 3UT9A 1P3MB 4KUDD 4J8VB 3AN2A 2BYMA 1BH9B 5AVBA 1U35C 2AROB 1EQZB 1P3BA 4H9SA 3W98C 4WU9A 3WAAB 5B1LD 3X1SD 3B6FD 3KWQC 5AV6A 3MGPC 1P34D 4LD9C 5E5AD 4WU8D 3NQUA 3UT9D 3WTPA 1P3LA 1U35B 4WV4B 3W98B 3MNNA 3AN2D 5BNVA 5AVBD 3KWQB 3AZNC 3MGPB 5CPJA 5GT0A 3MGQA 1P3BD 4WU9D 5CPKA 3B0CW 4LD9B 5B2JA 5GXQA 5BS7A 5AV6D 3UTBC 1P3AA 5KDMB 5JA4A 2FJ7D 3C1BA 3TU4A 4JJNA 1P3LD 3AZNB 3WTPD 1P3MA 3REIC 1B67A 4J8VA 2RVQC 3MNND 2NQBA 1BH9A 5B24C 4YM6C 5CPJD 5GT0D 3MGQD 2AROA 3UTBB 1EQZA 5CPKD 3WAAA 3A6NC 5B2JD 5GXQD 3REIB 1P3AD 3C1BD 3TU4D 4JJND 3R45B 4Z2MG 5B24B 1P3MD 1U35A 4J8UC 4J8VD 3W98A 3NQJB 3A6NB 2NQBD 1HQ3D 1BH8B 3KWQA 3UTAC 2AROD 1EQZD 3WAAD 4Z2MH 4H9PA 3AZEC 3C1CC 5B31C 5KDMA 3REJC 3LJAB 3AZNA 3UTAB 1U35D 4J8XC 3W98D 3X1UC 1JFIB 3KWQD 3AZEB 3WA9C 3C1CB 5B31B 3REJB 3KUYC 3LELC 3REIA 4J8XB 4H9QB 1KX5C 3X1UB 1F1EA 2NZDC 1P3IC 3R45A 3AZND 5B24A 4YM6A 3AZMC 3WA9B 1ID3C 4NFTA 3NQJA 3A6NA 3KUYB 1BH8A 3LELB 1KX5B 2NZDB 1P3IB 3AZLC 4H9OB 1M1AC 3REID 3AZMB 4J8UA 4ZBJC 4J8WC 2RVQD 5FUGA 1ID3B 4CAYB 3AZJC 5B24D 4YM6D 3UTAA 3REHC 5AV8C 3A6ND 1JFIA 3AZLB 4X23C 1M1AB 3AZEA 4ZBJB 4J8WB 5B31A 4DRBA 3REJA 5JRGC 3AZJB 5B0ZC 4J8UD 3REHB 4J8XA 2JSSA 4H9QA 2BYKA 3X1UA 5AV8B 4X23B 3UTAD 5B40C 3WA9A 5B31G 5JRGB 5B0ZB 3KUYA 1P3GC 3LELA 3AZED 4NE3A 5B31D 3REJD 1KX5A 2NZDA 1P3IA 2YFVB 3AZMA 5B40B 4J8XD 1ID3A 3KSYA 4HGAC 3X1UD 4CAYA 1P3GB 5BO0B 3WA9D 3B0DC 3AZHC 5BNXB 3KUYD 3LELD 1M1AA 3X1VC 4J8WA 4HGAB 1KX5D 4KGCA 2NZDD 1S32B 1N1JB 1P3ID 1TZYC 3AZMD 1F66C 3REHA 3REKC 3AZGC 3B0DB 1ID3D 3AZHB 5AV8A 3O62C 4X23A 2IO5C 3KXBC 3X1VB 5JRGA 1TZYB 5B0ZA 1F66B 4J8WD 3REKB 3AZGB 4KGCD 3O62B 2YFVA 2IO5B 3KXBB 1WWSA 3MGRC 5BT1C 1HTAA 3VH5T 5AV8D 3WKJC 5AY8C 4QLCC 4X23D 4UUZB 1P3GA 5BO0A 3AFAC 1KX4C 1P3OC 1TAFB 5JRGD 5GT3C 3LJAC 5BNXA 5B0ZD 4H9RB 3MGRB 3MGPA 4AWLC 1ZLAC 1N1JA 4ZUXC 5AY8B 3WKJB 4QLCB 3LZ0C 5CPIC 4LD9A 5GSUC 3AFAB 1KX4B 1P3OB 3AZHA 5GT3B 5B32C 5B33C 3X1VA 4AWLB 1ZLAB 4ZUXB 1TZYA 3LZ0B 5CPIB 3MGPD 1F66A 5GSUB 3MGSC 3UTBA 3AZGA 4E45A 4LD9D 5B32B 3KXBA 5B33B 1HQ3C 3X1TC 3AV1C 1R4VA 3AZHD 3W96C 4CSRB 4UUZA 4XUJC 3X1VD 3MGSB 3X1SC 1TAFA 1TZYD 3B6GC 3V9RB 4H9RA 5AVCC 3MGRA 1F66D 1HQ3B 3X1TB 4Z66C 3UTBD 3AZGD 3AV1B 4R8PC 2HIOC 3WKJA 5AY8A 3W96B 4QLCA 3W97C 1BFMA 3KXBD 3AN2C 4XUJB 3X1SB 3AFAA 1KX4A 1P3OA 4G91C 5GT3A 3B6GB 3LJAA 3B0CT 5AVCB 2CV5C 4Z66B 2PYOC 4R8PB 1ZLAA 2HIOB 4ZUXA 3W97B 3LZ0A 5CPIA 2FJ7C 3LZ1C 3MGRD 3AN2B 5F99C 2BYMB 5DNNC 3C1CA 2F8NB 4G91B 1P3KC 3VH5A 3WKJD 5AY8D 4QLCD 2CV5B 5B32A 5B33A 2PYOB 3AFAD 1KX4D 1P3OD 5CPJC 3VH6A 5GT3D 3LJAD 4CSRA 1KX3C 3LZ1B 2FJ7B 5F99B 5DNNB 3MGSA 3AZIC 1P3KB 1ZLAD 4ZUXD 3LZ0D 5CPID 3V9RA 5B32G 1HQ3A 5DNMC 3C1CD 1ULYA 3AV1A 3X1TA 5CPJB 3W96A 4H9OA 1KX3B 2YFWB 5B33D 4XUJA 2NQBC 3AZIB 5AV9C 1S32C 1M19C 3B6GA 5AVCA 3MVDC 3TU4B 2HUEC 5DNMB 4Z66A 4R8PA 2HIOA 3AZLA 3W97A 3X1TD 3AV1D 2NQBB
chains in the Genus database with same CATH superfamily
5AV9B 2F8NA 1M19B 3AZJA 3W96D 2CV5A 3MVDB 4XUJD 2HUEB 4WZSB 3KFUG 2PYOA 3B6GD 4H9NB 3AYWC 2FJ7A 5AVCD 3LZ1A 3RELC 5F99A 5DNNA 4Z5TC 4Z66D 5B2IC 4R8PD 2F8NG 5C3IC 1P3KA 4KHAB 2HIOD 3AZLD 3W97D 1H3OB 1M1AD 1P3FC 3H0LC 3X1TD 4WNNB 2F8ND 1B6WA 2L5AA 3AZJD 3AYWB 1KX3A 3RELB 2YFWA 2CV5D 3W99C 4Z5TB 5B40A 5B2IB 3REHD 2PYOD 4H9PB 5B1MC 3AZIA 2F8NH 5C3IB 1P3PC 1Q9CA 3LZ1D 1P3FB 5F99D 5DNND 5DNMA 3VH6T 4EO5C 1P3KD 3EPJA 1KU5A 3W99B 5CP6C 5AV5C 3AZKC 5B1MB 5AV9A 3AV2C 1S32A 1P3PB 4XZQC 1M19A 1KX3D 4DRAA 3MVDA 5B40D 1WWIA 3AZID 4EO5B 3AZFC 1AOIC 2F8NK 5B0YC 4H9NA 1P3GD 5CP6B 5DNMD 5AV5B 4M6BA 3AZKB 4YM6B 3AV2B 1M18C 4KHAA 4XZQB 4YS3C 1H3OA 3REKA 3P5JB 4WNNA 5AV9D 3AZFB 1AOIB 1S32D 2Y2GA 4KUDC 5B0YB 3O62A 1M19D 3AYWA 2LY8A 3RELA 3MVDD 4Z5TA 3B0BA 5B2IA 1M18B 4J8UB 5FUGB 4YS3B 1P3FA 5B1LC 4E44A 3B6FC 4KUDB 2DF4C 3W99A 3REKD 1P34C 5E5AC 4WU8C 5B1MA 3UT9C 3O62D 1P3PA 3AYWD 3RELD 5B1LB 4Z5TD 5B2ID 3B6FB 5AVBC 4NE5A 3H0MC 2CWEA 1P3BC 4H9SC 4WU9C 2BYKB 4NE6A 1P3FD 5CP6A 5G49B 5AV5A 3AZKA 5E5AB 4WU8B 2FFFB 3UT9B 1P34B 5AV6C 3AV2A 4XZQA 3W99D 5BT1D 5GSUA 5AVBB 5B1MD 1P3LC 3WTPC 3AZFA 1AOIA 3VH5W 1P3PD 1P3BB 5B0YA 4WU9B 5CHLB 3MNNC 4G92C 5AV6B 3VH6W 5GT0C 3MGQC 1M18A 5CPKC 4YS3A 4KGCC 5CP6D 5AV5D 5B2JC 3AZKD 5GXQC 3NQUB 5BS7C 3WTPB 1P3LB 3WTPE 3AV2D 4KUDA 4XZQD 1P3AC 3C1BC 3MNNB 4G92B 3TU4C 4JJNC 3EPHA 2UWXA 5BNVB 5GSUD 3AZFD 1AOID 1P3MC 5GT0B 3MGQB 5B0YD 4J8VC 2Y2MA 5CPKB 4KGCB 5B32D 1A7WA 5B1LA 5B2JB 5GXQB 3X1SA 3B6FA 1M18D 2AROC 1P3AB 1EQZC 5JA4B 4YS3D 3C1BB 3WAAC 4JJNB 5G49A 3MGSD 1P34A 5E5AA 4WU8A 3UT9A 1P3MB 4KUDD 4J8VB 3AN2A 2BYMA 2DQNC 1BH9B 5AVBA 1U35C 2AROB 1EQZB 1P3BA 4H9SA 3W98C 4WU9A 3WAAB 5B1LD 3X1SD 3B6FD 3KWQC 5AV6A 3MGPC 2W8SA 2Y2LA 1P34D 4LD9C 5E5AD 4WU8D 3NQUA 3UT9D 3WTPA 1P3LA 1U35B 4WV4B 3W98B 3MNNA 3AN2D 5BNVA 5AVBD 3KWQB 3AZNC 3MGPB 5CPJA 5GT0A 3MGQA 1P3BD 4WU9D 5CPKA 3B0CW 4LD9B 5B2JA 5GXQA 5BS7A 5AV6D 3UTBC 1P3AA 5KDMB 5JA4A 2ZM5A 2FJ7D 3C1BA 3TU4A 4JJNA 2Y2NA 1P3LD 3AZNB 3WTPD 1P3MA 3REIC 1B67A 4J8VA 2RVQC 2XD5A 3MNND 2NQBA 1BH9A 5B24C 4YM6C 5CPJD 5GT0D 3MGQD 2AROA 3UTBB 1EQZA 5CPKD 3WAAA 2G5IC 3A6NC 5B2JD 5GXQD 3REIB 1P3AD 3C1BD 3TU4D 4JJND 3R45B 4Z2MG 5B24B 1P3MD 1U35A 4J8UC 4J8VD 3W98A 3NQJB 3A6NB 2NQBD 4UPKA 1BH8B 1W2EA 3KWQA 3UTAC 2AROD 1EQZD 3WAAD 4Z2MH 4H9PA 3AZEC 3C1CC 5B31C 5KDMA 3REJC 3LJAB 3AZNA 2Y2HA 3UTAB 1U35D 2ZY4A 4J8XC 2Y2IA 3W98D 3X1UC 1JFIB 3KWQD 3AZEB 3WA9C 3C1CB 5B31B 4DQYB 2RIQA 3REJB 2ZY3A 2Y2PA 3KUYC 3LELC 3REIA 4J8XB 4H9QB 1KX5C 3X1UB 1F1EA 2NZDC 1P3IC 3R45A 3AZND 5B24A 4YM6A 3AZMC 3WA9B 3IP4C 1ID3C 4NFTA 3NQJA 3A6NA 2JCHA 3KUYB 1BH8A 3LELB 1KX5B 2NZDB 1P3IB 3AZLC 4H9OB 1M1AC 3REID 3AZMB 4J8UA 4ZBJC 4J8WC 2RVQD 5FUGA 1ID3B 4CAYB 3AZJC 5B24D 4YM6D 3UTAA 3REHC 2G5HC 5AV8C 3A6ND 1JFIA 3AZLB 4X23C 1M1AB 3AZEA 4ZBJB 4J8WB 5B31A 4DRBA 3REJA 5JRGC 3AZJB 5B0ZC 4J8UD 3REHB 4J8XA 2JSSA 1PZRA 4H9QA 2BYKA 3X1UA 5AV8B 4X23B 3UTAD 5B40C 3WA9A 5B31G 5JRGB 5B0ZB 3KUYA 1P3GC 3LELA 3AZED 4NE3A 5B31D 3REJD 1KX5A 2NZDA 1P3IA 2YFVB 3AZMA 5B40B 4J8XD 1ID3A 3KSYA 4HGAC 3X1UD 4CAYA 1P3GB 5BO0B 3WA9D 3B0DC 3AZHC 5BNXB 3KUYD 3LELD 1M1AA 3X1VC 4J8WA 4HGAB 1KX5D 4KGCA 2NZDD 1S32B 1N1JB 3H0RC 1P3ID 1TZYC 3AZMD 1F66C 3REHA 3REKC 3AZGC 3B0DB 1ID3D 3AZHB 5AV8A 3O62C 4X23A 2IO5C 3KXBC 3X1VB 5JRGA 1TZYB 2Y2JA 5B0ZA 1F66B 4J8WD 3REKB 3AZGB 4KGCD 3O62B 2YFVA 2IO5B 3KXBB 1WWSA 3MGRC 5BT1C 1HTAA 3VH5T 2Y2OA 5AV8D 2BG1A 3WKJC 5AY8C 4QLCC 4X23D 4UUZB 1P3GA 5BO0A 3EPLA 2Y2KA 3AFAC 1KX4C 1P3OC 1TAFB 5JRGD 5GT3C 2Y2QA 3LJAC 5BNXA 5B0ZD 3AL0C 4H9RB 3MGRB 3MGPA 4AWLC 1Z2CB 1ZLAC 1N1JA 4ZUXC 5AY8B 3WKJB 4QLCB 3LZ0C 5CPIC 4LD9A 5GSUC 3AFAB 1KX4B 1P3OB 3AZHA 5GT3B 5B32C 5B33C 3X1VA 4AWLB 1ZLAB 4ZUXB 1TZYA 3LZ0B 5CPIB 1T3UA 3MGPD 1F66A 5GSUB 3MGSC 3UTBA 3AZGA 4E45A 4LD9D 3A1KA 5B32B 3KXBA 5B33B 1HQ3C 3X1TC 3AV1C 1R4VA 3A1IA 3AZHD 3W96C 4CSRB 4UUZA 4XUJC 3X1VD 3MGSB 3X1SC 1TAFA 1TZYD 3B6GC 3V9RB 4H9RA 5AVCC 3MGRA 3EPKA 1F66D 1HQ3B 3X1TB 4Z66C 3UTBD 3AZGD 3AV1B 4R8PC 2HIOC 3WKJA 5AY8A 3W96B 4QLCA 3W97C 1BFMA 3KXBD 3AN2C 4XUJB 2ZY5A 3X1SB 3AFAA 1KX4A 1P3OA 4G91C 5GT3A 3B6GB 3LJAA 3B0CT 3FDDA 2J8PA 2JE5A 5AVCB 2CV5C 3F6TA 4Z66B 2PYOC 4R8PB 1ZLAA 2HIOB 4ZUXA 2F2AC 3W97B 3LZ0A 5CPIA 2FJ7C 3LZ1C 3MGRD 3AN2B 5F99C 2BYMB 5DNNC 3C1CA 2F8NB 4G91B 1P3KC 3VH5A 3WKJD 5AY8D 4QLCD 2CV5B 5B32A 5B33A 2PYOB 3AFAD 1KX4D 1P3OD 5CPJC 3VH6A 5GT3D 3LJAD 4CSRA 1KX3C 3LZ1B 2FJ7B 5F99B 5DNNB 3MGSA 3AZIC 1P3KB 2ZY2A 1ZLAD 4ZUXD 3LZ0D 5CPID 3V9RA 5B32G 1HQ3A 5DNMC 3C1CD 1ULYA 3AV1A 3X1TA 2XD1A 5CPJB 3W96A 4H9OA 1KX3B 2YFWB 4WJ3C 5B33D 4XUJA 2NQBC 3AZIB 5AV9C 3EG5B 1S32C 1M19C 3B6GA 5AVCA 3MVDC 3TU4B 2HUEC 5DNMB 2VQRA 4Z66A 4R8PA 2HIOA 3AZLA 3W97A 1HQ3D 3AV1D 2NQBB
chains in the Genus database with same CATH topology
5AV9B 2F8NA 1M19B 3AZJA 3W96D 2CV5A 3MVDB 4XUJD 2HUEB 4WZSB 3KFUG 2PYOA 3B6GD 4H9NB 3AYWC 2FJ7A 5AVCD 3LZ1A 3RELC 5F99A 5DNNA 4Z5TC 4Z66D 5B2IC 4R8PD 2F8NG 5C3IC 1P3KA 4KHAB 2HIOD 3AZLD 3W97D 1H3OB 1M1AD 1P3FC 3H0LC 3X1TD 4WNNB 2F8ND 1B6WA 2L5AA 3AZJD 3AYWB 1KX3A 3RELB 2YFWA 2CV5D 3W99C 4Z5TB 5B40A 5B2IB 3REHD 2PYOD 4H9PB 5B1MC 3AZIA 2F8NH 5C3IB 1P3PC 1Q9CA 3LZ1D 1P3FB 5F99D 5DNND 5DNMA 3VH6T 4EO5C 1P3KD 3EPJA 1KU5A 3W99B 5CP6C 5AV5C 3AZKC 5B1MB 5AV9A 3AV2C 1S32A 1P3PB 4XZQC 1M19A 1KX3D 4DRAA 3MVDA 5B40D 1WWIA 3AZID 4EO5B 3AZFC 1AOIC 2F8NK 5B0YC 4H9NA 1P3GD 5CP6B 5DNMD 5AV5B 4M6BA 3AZKB 4YM6B 3AV2B 1M18C 4KHAA 4XZQB 4YS3C 1H3OA 3REKA 3P5JB 4WNNA 5AV9D 3AZFB 1AOIB 1S32D 2Y2GA 4KUDC 5B0YB 3O62A 1M19D 3AYWA 2LY8A 3RELA 3MVDD 4Z5TA 3B0BA 5B2IA 1M18B 4J8UB 5FUGB 4YS3B 1P3FA 5B1LC 4E44A 3B6FC 4KUDB 2DF4C 3W99A 3REKD 1P34C 5E5AC 4WU8C 5B1MA 3UT9C 3O62D 1P3PA 3AYWD 3RELD 5B1LB 4Z5TD 5B2ID 3B6FB 5AVBC 4NE5A 3H0MC 2CWEA 1P3BC 4H9SC 4WU9C 2BYKB 4NE6A 1P3FD 5CP6A 5G49B 5AV5A 3AZKA 5E5AB 4WU8B 2FFFB 3UT9B 1P34B 5AV6C 3AV2A 4XZQA 3W99D 5BT1D 5GSUA 5AVBB 5B1MD 1P3LC 3WTPC 3AZFA 1AOIA 3VH5W 1P3PD 1P3BB 5B0YA 4WU9B 5CHLB 3MNNC 4G92C 5AV6B 3VH6W 5GT0C 3MGQC 1M18A 5CPKC 4YS3A 4KGCC 5CP6D 5AV5D 5B2JC 3AZKD 5GXQC 3NQUB 5BS7C 3WTPB 1P3LB 3WTPE 3AV2D 4KUDA 4XZQD 1P3AC 3C1BC 3MNNB 4G92B 3TU4C 4JJNC 3EPHA 2UWXA 5BNVB 5GSUD 3AZFD 1AOID 1P3MC 5GT0B 3MGQB 5B0YD 4J8VC 2Y2MA 5CPKB 4KGCB 5B32D 1A7WA 5B1LA 5B2JB 5GXQB 3X1SA 3B6FA 1M18D 2AROC 1P3AB 1EQZC 5JA4B 4YS3D 3C1BB 3WAAC 4JJNB 5G49A 3MGSD 1P34A 5E5AA 4WU8A 3UT9A 1P3MB 4KUDD 4J8VB 3AN2A 2BYMA 2DQNC 1BH9B 5AVBA 1U35C 2AROB 1EQZB 1P3BA 4H9SA 3W98C 4WU9A 3WAAB 5B1LD 3X1SD 3B6FD 3KWQC 5AV6A 3MGPC 2W8SA 2Y2LA 1P34D 4LD9C 5E5AD 4WU8D 3NQUA 3UT9D 3WTPA 1P3LA 1U35B 4WV4B 3W98B 3MNNA 3AN2D 5BNVA 5AVBD 3KWQB 3AZNC 3MGPB 5CPJA 5GT0A 3MGQA 1P3BD 4WU9D 5CPKA 3B0CW 4LD9B 5B2JA 5GXQA 5BS7A 5AV6D 3UTBC 1P3AA 5KDMB 5JA4A 2ZM5A 2FJ7D 3C1BA 3TU4A 4JJNA 2Y2NA 1P3LD 3AZNB 3WTPD 1P3MA 3REIC 1B67A 4J8VA 2RVQC 2XD5A 3MNND 2NQBA 1BH9A 5B24C 4YM6C 5CPJD 5GT0D 3MGQD 2AROA 3UTBB 1EQZA 5CPKD 3WAAA 2G5IC 3A6NC 5B2JD 5GXQD 3REIB 1P3AD 3C1BD 3TU4D 4JJND 3R45B 4Z2MG 5B24B 1P3MD 1U35A 4J8UC 4J8VD 3W98A 3NQJB 3A6NB 2NQBD 4UPKA 1BH8B 1W2EA 3KWQA 3UTAC 2AROD 1EQZD 3WAAD 4Z2MH 4H9PA 3AZEC 3C1CC 5B31C 5KDMA 3REJC 3LJAB 3AZNA 2Y2HA 3UTAB 1U35D 2ZY4A 4J8XC 2Y2IA 3W98D 3X1UC 1JFIB 3KWQD 3AZEB 3WA9C 3C1CB 5B31B 4DQYB 2RIQA 3REJB 2ZY3A 2Y2PA 3KUYC 3LELC 3REIA 4J8XB 4H9QB 1KX5C 3X1UB 1F1EA 2NZDC 1P3IC 3R45A 3AZND 5B24A 4YM6A 3AZMC 3WA9B 3IP4C 1ID3C 4NFTA 3NQJA 3A6NA 2JCHA 3KUYB 1BH8A 3LELB 1KX5B 2NZDB 1P3IB 3AZLC 4H9OB 1M1AC 3REID 3AZMB 4J8UA 4ZBJC 4J8WC 2RVQD 5FUGA 1ID3B 4CAYB 3AZJC 5B24D 4YM6D 3UTAA 3REHC 2G5HC 5AV8C 3A6ND 1JFIA 3AZLB 4X23C 1M1AB 3AZEA 4ZBJB 4J8WB 5B31A 4DRBA 3REJA 5JRGC 3AZJB 5B0ZC 4J8UD 3REHB 4J8XA 2JSSA 1PZRA 4H9QA 2BYKA 3X1UA 5AV8B 4X23B 3UTAD 5B40C 3WA9A 5B31G 5JRGB 5B0ZB 3KUYA 1P3GC 3LELA 3AZED 4NE3A 5B31D 3REJD 1KX5A 2NZDA 1P3IA 2YFVB 3AZMA 5B40B 4J8XD 1ID3A 3KSYA 4HGAC 3X1UD 4CAYA 1P3GB 5BO0B 3WA9D 3B0DC 3AZHC 5BNXB 3KUYD 3LELD 1M1AA 3X1VC 4J8WA 4HGAB 1KX5D 4KGCA 2NZDD 1S32B 1N1JB 3H0RC 1P3ID 1TZYC 3AZMD 1F66C 3REHA 3REKC 3AZGC 3B0DB 1ID3D 3AZHB 5AV8A 3O62C 4X23A 2IO5C 3KXBC 3X1VB 5JRGA 1TZYB 2Y2JA 5B0ZA 1F66B 4J8WD 3REKB 3AZGB 4KGCD 3O62B 2YFVA 2IO5B 3KXBB 1WWSA 3MGRC 5BT1C 1HTAA 3VH5T 2Y2OA 5AV8D 2BG1A 3WKJC 5AY8C 4QLCC 4X23D 4UUZB 1P3GA 5BO0A 3EPLA 2Y2KA 3AFAC 1KX4C 1P3OC 1TAFB 5JRGD 5GT3C 2Y2QA 3LJAC 5BNXA 5B0ZD 3AL0C 4H9RB 3MGRB 3MGPA 4AWLC 1Z2CB 1ZLAC 1N1JA 4ZUXC 5AY8B 3WKJB 4QLCB 3LZ0C 5CPIC 4LD9A 5GSUC 3AFAB 1KX4B 1P3OB 3AZHA 5GT3B 5B32C 5B33C 3X1VA 4AWLB 1ZLAB 4ZUXB 1TZYA 3LZ0B 5CPIB 1T3UA 3MGPD 1F66A 5GSUB 3MGSC 3UTBA 3AZGA 4E45A 4LD9D 3A1KA 5B32B 3KXBA 5B33B 1HQ3C 3X1TC 3AV1C 1R4VA 3A1IA 3AZHD 3W96C 4CSRB 4UUZA 4XUJC 3X1VD 3MGSB 3X1SC 1TAFA 1TZYD 3B6GC 3V9RB 4H9RA 5AVCC 3MGRA 3EPKA 1F66D 1HQ3B 3X1TB 4Z66C 3UTBD 3AZGD 3AV1B 4R8PC 2HIOC 3WKJA 5AY8A 3W96B 4QLCA 3W97C 1BFMA 3KXBD 3AN2C 4XUJB 2ZY5A 3X1SB 3AFAA 1KX4A 1P3OA 4G91C 5GT3A 3B6GB 3LJAA 3B0CT 3FDDA 2J8PA 2JE5A 5AVCB 2CV5C 3F6TA 4Z66B 2PYOC 4R8PB 1ZLAA 2HIOB 4ZUXA 2F2AC 3W97B 3LZ0A 5CPIA 2FJ7C 3LZ1C 3MGRD 3AN2B 5F99C 2BYMB 5DNNC 3C1CA 2F8NB 4G91B 1P3KC 3VH5A 3WKJD 5AY8D 4QLCD 2CV5B 5B32A 5B33A 2PYOB 3AFAD 1KX4D 1P3OD 5CPJC 3VH6A 5GT3D 3LJAD 4CSRA 1KX3C 3LZ1B 2FJ7B 5F99B 5DNNB 3MGSA 3AZIC 1P3KB 2ZY2A 1ZLAD 4ZUXD 3LZ0D 5CPID 3V9RA 5B32G 1HQ3A 5DNMC 3C1CD 1ULYA 3AV1A 3X1TA 2XD1A 5CPJB 3W96A 4H9OA 1KX3B 2YFWB 4WJ3C 5B33D 4XUJA 2NQBC 3AZIB 5AV9C 3EG5B 1S32C 1M19C 3B6GA 5AVCA 3MVDC 3TU4B 2HUEC 5DNMB 2VQRA 4Z66A 4R8PA 2HIOA 3AZLA 3W97A 1HQ3D 3AV1D 2NQBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV9 B;  2F8N A;  1M19 B;  3AZJ A;  3W96 D;  2CV5 A;  3MVD B;  4XUJ D;  2HUE B;  4WZS B;  2PYO A;  3B6G D;  4H9N B;  3AYW C;  2FJ7 A;  5AVC D;  3LZ1 A;  3REL C;  5F99 A;  5DNN A;  4Z5T C;  4Z66 D;  5B2I C;  4R8P D;  2F8N G;  5C3I C;  1P3K A;  4KHA B;  2HIO D;  3AZL D;  3W97 D;  1H3O B;  1M1A D;  1P3F C;  4WNN B;  2F8N D;  1B6W A;  2L5A A;  3AZJ D;  3AYW B;  1KX3 A;  3REL B;  2YFW A;  2CV5 D;  3W99 C;  4Z5T B;  5B40 A;  5B2I B;  3REH D;  2PYO D;  4H9P B;  5B1M C;  3AZI A;  2F8N H;  5C3I B;  1P3P C;  1Q9C A;  3LZ1 D;  1P3F B;  5F99 D;  5DNN D;  5DNM A;  3VH6 T;  4EO5 C;  1P3K D;  1KU5 A;  3W99 B;  5CP6 C;  5AV5 C;  3AZK C;  5B1M B;  5AV9 A;  3AV2 C;  1S32 A;  1P3P B;  4XZQ C;  1M19 A;  1KX3 D;  4DRA A;  3MVD A;  5B40 D;  1WWI A;  3AZI D;  4EO5 B;  3AZF C;  1AOI C;  2F8N K;  5B0Y C;  4H9N A;  1P3G D;  5CP6 B;  5DNM D;  5AV5 B;  4M6B A;  3AZK B;  4YM6 B;  3AV2 B;  1M18 C;  4KHA A;  4XZQ B;  4YS3 C;  1H3O A;  3REK A;  4WNN A;  5AV9 D;  3AZF B;  1AOI B;  1S32 D;  4KUD C;  5B0Y B;  3O62 A;  1M19 D;  3AYW A;  2LY8 A;  3REL A;  3MVD D;  4Z5T A;  3B0B A;  5B2I A;  1M18 B;  4J8U B;  5FUG B;  4YS3 B;  1P3F A;  5B1L C;  4E44 A;  3B6F C;  4KUD B;  3W99 A;  3REK D;  1P34 C;  5E5A C;  4WU8 C;  5B1M A;  3UT9 C;  3O62 D;  1P3P A;  3AYW D;  3REL D;  5B1L B;  4Z5T D;  5B2I D;  3B6F B;  5AVB C;  4NE5 A;  2CWE A;  1P3B C;  4H9S C;  4WU9 C;  2BYK B;  4NE6 A;  1P3F D;  5CP6 A;  5G49 B;  5AV5 A;  3AZK A;  5E5A B;  4WU8 B;  3UT9 B;  1P34 B;  5AV6 C;  3AV2 A;  4XZQ A;  3W99 D;  5BT1 D;  5GSU A;  5AVB B;  5B1M D;  1P3L C;  3WTP C;  3AZF A;  1AOI A;  3VH5 W;  1P3P D;  1P3B B;  5B0Y A;  4WU9 B;  5CHL B;  3MNN C;  4G92 C;  5AV6 B;  3VH6 W;  5GT0 C;  3MGQ C;  1M18 A;  5CPK C;  4YS3 A;  4KGC C;  5CP6 D;  5AV5 D;  5B2J C;  3AZK D;  5GXQ C;  3NQU B;  5BS7 C;  3WTP B;  1P3L B;  3WTP E;  3AV2 D;  4KUD A;  4XZQ D;  1P3A C;  3C1B C;  3MNN B;  4G92 B;  3TU4 C;  4JJN C;  5GSU D;  5BNV B;  3AZF D;  1AOI D;  1P3M C;  5GT0 B;  3MGQ B;  5B0Y D;  4J8V C;  5CPK B;  4KGC B;  5B32 D;  1A7W A;  5B1L A;  5B2J B;  5GXQ B;  3X1S A;  3B6F A;  1M18 D;  2ARO C;  1P3A B;  1EQZ C;  5JA4 B;  4YS3 D;  3C1B B;  3WAA C;  4JJN B;  5G49 A;  3MGS D;  1P34 A;  5E5A A;  4WU8 A;  3UT9 A;  1P3M B;  4KUD D;  4J8V B;  3AN2 A;  2BYM A;  1BH9 B;  5AVB A;  1U35 C;  2ARO B;  1EQZ B;  1P3B A;  4H9S A;  3W98 C;  4WU9 A;  3WAA B;  5B1L D;  3X1S D;  3B6F D;  3KWQ C;  5AV6 A;  3MGP C;  1P34 D;  4LD9 C;  5E5A D;  4WU8 D;  3NQU A;  3UT9 D;  3WTP A;  1P3L A;  1U35 B;  4WV4 B;  3W98 B;  3MNN A;  3AN2 D;  5BNV A;  5AVB D;  3KWQ B;  3AZN C;  3MGP B;  5CPJ A;  5GT0 A;  3MGQ A;  1P3B D;  4WU9 D;  5CPK A;  3B0C W;  4LD9 B;  5B2J A;  5GXQ A;  5BS7 A;  5AV6 D;  3UTB C;  1P3A A;  5KDM B;  5JA4 A;  2FJ7 D;  3C1B A;  3TU4 A;  4JJN A;  1P3L D;  3AZN B;  3WTP D;  1P3M A;  3REI C;  1B67 A;  4J8V A;  2RVQ C;  3MNN D;  2NQB A;  1BH9 A;  5B24 C;  4YM6 C;  5CPJ D;  5GT0 D;  3MGQ D;  2ARO A;  3UTB B;  1EQZ A;  5CPK D;  3WAA A;  3A6N C;  5B2J D;  5GXQ D;  3REI B;  1P3A D;  3C1B D;  3TU4 D;  4JJN D;  3R45 B;  4Z2M G;  5B24 B;  1P3M D;  1U35 A;  4J8U C;  4J8V D;  3W98 A;  3NQJ B;  3A6N B;  2NQB D;  1HQ3 D;  1BH8 B;  3KWQ A;  3UTA C;  2ARO D;  1EQZ D;  3WAA D;  4Z2M H;  4H9P A;  3AZE C;  3C1C C;  5B31 C;  5KDM A;  3REJ C;  3LJA B;  3AZN A;  3UTA B;  1U35 D;  4J8X C;  3W98 D;  3X1U C;  1JFI B;  3KWQ D;  3AZE B;  3WA9 C;  3C1C B;  5B31 B;  3REJ B;  3KUY C;  3LEL C;  3REI A;  4J8X B;  4H9Q B;  1KX5 C;  3X1U B;  1F1E A;  2NZD C;  1P3I C;  3R45 A;  3AZN D;  5B24 A;  4YM6 A;  3AZM C;  3WA9 B;  1ID3 C;  4NFT A;  3NQJ A;  3A6N A;  3KUY B;  1BH8 A;  3LEL B;  1KX5 B;  2NZD B;  1P3I B;  3AZL C;  4H9O B;  1M1A C;  3REI D;  3AZM B;  4J8U A;  4ZBJ C;  4J8W C;  2RVQ D;  5FUG A;  1ID3 B;  4CAY B;  3AZJ C;  5B24 D;  4YM6 D;  3UTA A;  3REH C;  5AV8 C;  3A6N D;  1JFI A;  3AZL B;  4X23 C;  1M1A B;  3AZE A;  4ZBJ B;  4J8W B;  5B31 A;  4DRB A;  3REJ A;  5JRG C;  3AZJ B;  5B0Z C;  4J8U D;  3REH B;  4J8X A;  2JSS A;  4H9Q A;  2BYK A;  3X1U A;  5AV8 B;  4X23 B;  3UTA D;  5B40 C;  3WA9 A;  5B31 G;  5JRG B;  5B0Z B;  3KUY A;  1P3G C;  3LEL A;  3AZE D;  4NE3 A;  5B31 D;  3REJ D;  1KX5 A;  2NZD A;  1P3I A;  2YFV B;  3AZM A;  5B40 B;  4J8X D;  1ID3 A;  3KSY A;  4HGA C;  3X1U D;  4CAY A;  1P3G B;  5BO0 B;  3WA9 D;  3B0D C;  3AZH C;  5BNX B;  3KUY D;  3LEL D;  1M1A A;  3X1V C;  4J8W A;  4HGA B;  1KX5 D;  4KGC A;  2NZD D;  1S32 B;  1N1J B;  1P3I D;  1TZY C;  3AZM D;  1F66 C;  3REH A;  3REK C;  3AZG C;  3B0D B;  1ID3 D;  3AZH B;  5AV8 A;  3O62 C;  4X23 A;  2IO5 C;  3KXB C;  3X1V B;  5JRG A;  1TZY B;  5B0Z A;  1F66 B;  4J8W D;  3REK B;  3AZG B;  4KGC D;  3O62 B;  2YFV A;  2IO5 B;  3KXB B;  1WWS A;  3MGR C;  5BT1 C;  1HTA A;  3VH5 T;  5AV8 D;  3WKJ C;  5AY8 C;  4QLC C;  4X23 D;  4UUZ B;  1P3G A;  5BO0 A;  3AFA C;  1KX4 C;  1P3O C;  1TAF B;  5JRG D;  5GT3 C;  3LJA C;  5BNX A;  5B0Z D;  4H9R B;  3MGR B;  3MGP A;  4AWL C;  1ZLA C;  1N1J A;  4ZUX C;  5AY8 B;  3WKJ B;  4QLC B;  3LZ0 C;  5CPI C;  4LD9 A;  5GSU C;  3AFA B;  1KX4 B;  1P3O B;  3AZH A;  5GT3 B;  5B32 C;  5B33 C;  3X1V A;  4AWL B;  1ZLA B;  4ZUX B;  1TZY A;  3LZ0 B;  5CPI B;  3MGP D;  1F66 A;  5GSU B;  3MGS C;  3UTB A;  3AZG A;  4E45 A;  4LD9 D;  5B32 B;  3KXB A;  5B33 B;  1HQ3 C;  3X1T C;  3AV1 C;  1R4V A;  3AZH D;  3W96 C;  4CSR B;  4UUZ A;  4XUJ C;  3X1V D;  3MGS B;  3X1S C;  1TAF A;  1TZY D;  3B6G C;  3V9R B;  4H9R A;  5AVC C;  3MGR A;  1F66 D;  1HQ3 B;  3X1T B;  4Z66 C;  3UTB D;  3AZG D;  3AV1 B;  4R8P C;  2HIO C;  3WKJ A;  5AY8 A;  3W96 B;  4QLC A;  3W97 C;  1BFM A;  3KXB D;  3AN2 C;  4XUJ B;  3X1S B;  3AFA A;  1KX4 A;  1P3O A;  4G91 C;  5GT3 A;  3B6G B;  3LJA A;  3B0C T;  5AVC B;  2CV5 C;  4Z66 B;  2PYO C;  4R8P B;  1ZLA A;  2HIO B;  4ZUX A;  3W97 B;  3LZ0 A;  5CPI A;  2FJ7 C;  3LZ1 C;  3MGR D;  3AN2 B;  5F99 C;  2BYM B;  5DNN C;  3C1C A;  2F8N B;  4G91 B;  1P3K C;  3VH5 A;  3WKJ D;  5AY8 D;  4QLC D;  2CV5 B;  5B32 A;  5B33 A;  2PYO B;  3AFA D;  1KX4 D;  1P3O D;  5CPJ C;  3VH6 A;  5GT3 D;  3LJA D;  4CSR A;  1KX3 C;  3LZ1 B;  2FJ7 B;  5F99 B;  5DNN B;  3MGS A;  3AZI C;  1P3K B;  1ZLA D;  4ZUX D;  3LZ0 D;  5CPI D;  3V9R A;  5B32 G;  1HQ3 A;  5DNM C;  3C1C D;  1ULY A;  3AV1 A;  3X1T A;  5CPJ B;  3W96 A;  4H9O A;  1KX3 B;  2YFW B;  5B33 D;  4XUJ A;  2NQB C;  3AZI B;  5AV9 C;  1S32 C;  1M19 C;  3B6G A;  5AVC A;  3MVD C;  3TU4 B;  2HUE C;  5DNM B;  4Z66 A;  4R8P A;  2HIO A;  3AZL A;  3W97 A;  3X1T D;  3AV1 D;  2NQB B; 
#chains in the Genus database with same CATH topology
 5AV9 B;  2F8N A;  1M19 B;  3AZJ A;  3W96 D;  2CV5 A;  3MVD B;  4XUJ D;  2HUE B;  4WZS B;  3KFU G;  2PYO A;  3B6G D;  4H9N B;  3AYW C;  2FJ7 A;  5AVC D;  3LZ1 A;  3REL C;  5F99 A;  5DNN A;  4Z5T C;  4Z66 D;  5B2I C;  4R8P D;  2F8N G;  5C3I C;  1P3K A;  4KHA B;  2HIO D;  3AZL D;  3W97 D;  1H3O B;  1M1A D;  1P3F C;  3H0L C;  3X1T D;  4WNN B;  2F8N D;  1B6W A;  2L5A A;  3AZJ D;  3AYW B;  1KX3 A;  3REL B;  2YFW A;  2CV5 D;  3W99 C;  4Z5T B;  5B40 A;  5B2I B;  3REH D;  2PYO D;  4H9P B;  5B1M C;  3AZI A;  2F8N H;  5C3I B;  1P3P C;  1Q9C A;  3LZ1 D;  1P3F B;  5F99 D;  5DNN D;  5DNM A;  3VH6 T;  4EO5 C;  1P3K D;  3EPJ A;  1KU5 A;  3W99 B;  5CP6 C;  5AV5 C;  3AZK C;  5B1M B;  5AV9 A;  3AV2 C;  1S32 A;  1P3P B;  4XZQ C;  1M19 A;  1KX3 D;  4DRA A;  3MVD A;  5B40 D;  1WWI A;  3AZI D;  4EO5 B;  3AZF C;  1AOI C;  2F8N K;  5B0Y C;  4H9N A;  1P3G D;  5CP6 B;  5DNM D;  5AV5 B;  4M6B A;  3AZK B;  4YM6 B;  3AV2 B;  1M18 C;  4KHA A;  4XZQ B;  4YS3 C;  1H3O A;  3REK A;  3P5J B;  4WNN A;  5AV9 D;  3AZF B;  1AOI B;  1S32 D;  2Y2G A;  4KUD C;  5B0Y B;  3O62 A;  1M19 D;  3AYW A;  2LY8 A;  3REL A;  3MVD D;  4Z5T A;  3B0B A;  5B2I A;  1M18 B;  4J8U B;  5FUG B;  4YS3 B;  1P3F A;  5B1L C;  4E44 A;  3B6F C;  4KUD B;  2DF4 C;  3W99 A;  3REK D;  1P34 C;  5E5A C;  4WU8 C;  5B1M A;  3UT9 C;  3O62 D;  1P3P A;  3AYW D;  3REL D;  5B1L B;  4Z5T D;  5B2I D;  3B6F B;  5AVB C;  4NE5 A;  3H0M C;  2CWE A;  1P3B C;  4H9S C;  4WU9 C;  2BYK B;  4NE6 A;  1P3F D;  5CP6 A;  5G49 B;  5AV5 A;  3AZK A;  5E5A B;  4WU8 B;  2FFF B;  3UT9 B;  1P34 B;  5AV6 C;  3AV2 A;  4XZQ A;  3W99 D;  5BT1 D;  5GSU A;  5AVB B;  5B1M D;  1P3L C;  3WTP C;  3AZF A;  1AOI A;  3VH5 W;  1P3P D;  1P3B B;  5B0Y A;  4WU9 B;  5CHL B;  3MNN C;  4G92 C;  5AV6 B;  3VH6 W;  5GT0 C;  3MGQ C;  1M18 A;  5CPK C;  4YS3 A;  4KGC C;  5CP6 D;  5AV5 D;  5B2J C;  3AZK D;  5GXQ C;  3NQU B;  5BS7 C;  3WTP B;  1P3L B;  3WTP E;  3AV2 D;  4KUD A;  4XZQ D;  1P3A C;  3C1B C;  3MNN B;  4G92 B;  3TU4 C;  4JJN C;  3EPH A;  2UWX A;  5BNV B;  5GSU D;  3AZF D;  1AOI D;  1P3M C;  5GT0 B;  3MGQ B;  5B0Y D;  4J8V C;  2Y2M A;  5CPK B;  4KGC B;  5B32 D;  1A7W A;  5B1L A;  5B2J B;  5GXQ B;  3X1S A;  3B6F A;  1M18 D;  2ARO C;  1P3A B;  1EQZ C;  5JA4 B;  4YS3 D;  3C1B B;  3WAA C;  4JJN B;  5G49 A;  3MGS D;  1P34 A;  5E5A A;  4WU8 A;  3UT9 A;  1P3M B;  4KUD D;  4J8V B;  3AN2 A;  2BYM A;  2DQN C;  1BH9 B;  5AVB A;  1U35 C;  2ARO B;  1EQZ B;  1P3B A;  4H9S A;  3W98 C;  4WU9 A;  3WAA B;  5B1L D;  3X1S D;  3B6F D;  3KWQ C;  5AV6 A;  3MGP C;  2W8S A;  2Y2L A;  1P34 D;  4LD9 C;  5E5A D;  4WU8 D;  3NQU A;  3UT9 D;  3WTP A;  1P3L A;  1U35 B;  4WV4 B;  3W98 B;  3MNN A;  3AN2 D;  5BNV A;  5AVB D;  3KWQ B;  3AZN C;  3MGP B;  5CPJ A;  5GT0 A;  3MGQ A;  1P3B D;  4WU9 D;  5CPK A;  3B0C W;  4LD9 B;  5B2J A;  5GXQ A;  5BS7 A;  5AV6 D;  3UTB C;  1P3A A;  5KDM B;  5JA4 A;  2ZM5 A;  2FJ7 D;  3C1B A;  3TU4 A;  4JJN A;  2Y2N A;  1P3L D;  3AZN B;  3WTP D;  1P3M A;  3REI C;  1B67 A;  4J8V A;  2RVQ C;  2XD5 A;  3MNN D;  2NQB A;  1BH9 A;  5B24 C;  4YM6 C;  5CPJ D;  5GT0 D;  3MGQ D;  2ARO A;  3UTB B;  1EQZ A;  5CPK D;  3WAA A;  2G5I C;  3A6N C;  5B2J D;  5GXQ D;  3REI B;  1P3A D;  3C1B D;  3TU4 D;  4JJN D;  3R45 B;  4Z2M G;  5B24 B;  1P3M D;  1U35 A;  4J8U C;  4J8V D;  3W98 A;  3NQJ B;  3A6N B;  2NQB D;  4UPK A;  1BH8 B;  1W2E A;  3KWQ A;  3UTA C;  2ARO D;  1EQZ D;  3WAA D;  4Z2M H;  4H9P A;  3AZE C;  3C1C C;  5B31 C;  5KDM A;  3REJ C;  3LJA B;  3AZN A;  2Y2H A;  3UTA B;  1U35 D;  2ZY4 A;  4J8X C;  2Y2I A;  3W98 D;  3X1U C;  1JFI B;  3KWQ D;  3AZE B;  3WA9 C;  3C1C B;  5B31 B;  4DQY B;  2RIQ A;  3REJ B;  2ZY3 A;  2Y2P A;  3KUY C;  3LEL C;  3REI A;  4J8X B;  4H9Q B;  1KX5 C;  3X1U B;  1F1E A;  2NZD C;  1P3I C;  3R45 A;  3AZN D;  5B24 A;  4YM6 A;  3AZM C;  3WA9 B;  3IP4 C;  1ID3 C;  4NFT A;  3NQJ A;  3A6N A;  2JCH A;  3KUY B;  1BH8 A;  3LEL B;  1KX5 B;  2NZD B;  1P3I B;  3AZL C;  4H9O B;  1M1A C;  3REI D;  3AZM B;  4J8U A;  4ZBJ C;  4J8W C;  2RVQ D;  5FUG A;  1ID3 B;  4CAY B;  3AZJ C;  5B24 D;  4YM6 D;  3UTA A;  3REH C;  2G5H C;  5AV8 C;  3A6N D;  1JFI A;  3AZL B;  4X23 C;  1M1A B;  3AZE A;  4ZBJ B;  4J8W B;  5B31 A;  4DRB A;  3REJ A;  5JRG C;  3AZJ B;  5B0Z C;  4J8U D;  3REH B;  4J8X A;  2JSS A;  1PZR A;  4H9Q A;  2BYK A;  3X1U A;  5AV8 B;  4X23 B;  3UTA D;  5B40 C;  3WA9 A;  5B31 G;  5JRG B;  5B0Z B;  3KUY A;  1P3G C;  3LEL A;  3AZE D;  4NE3 A;  5B31 D;  3REJ D;  1KX5 A;  2NZD A;  1P3I A;  2YFV B;  3AZM A;  5B40 B;  4J8X D;  1ID3 A;  3KSY A;  4HGA C;  3X1U D;  4CAY A;  1P3G B;  5BO0 B;  3WA9 D;  3B0D C;  3AZH C;  5BNX B;  3KUY D;  3LEL D;  1M1A A;  3X1V C;  4J8W A;  4HGA B;  1KX5 D;  4KGC A;  2NZD D;  1S32 B;  1N1J B;  3H0R C;  1P3I D;  1TZY C;  3AZM D;  1F66 C;  3REH A;  3REK C;  3AZG C;  3B0D B;  1ID3 D;  3AZH B;  5AV8 A;  3O62 C;  4X23 A;  2IO5 C;  3KXB C;  3X1V B;  5JRG A;  1TZY B;  2Y2J A;  5B0Z A;  1F66 B;  4J8W D;  3REK B;  3AZG B;  4KGC D;  3O62 B;  2YFV A;  2IO5 B;  3KXB B;  1WWS A;  3MGR C;  5BT1 C;  1HTA A;  3VH5 T;  2Y2O A;  5AV8 D;  2BG1 A;  3WKJ C;  5AY8 C;  4QLC C;  4X23 D;  4UUZ B;  1P3G A;  5BO0 A;  3EPL A;  2Y2K A;  3AFA C;  1KX4 C;  1P3O C;  1TAF B;  5JRG D;  5GT3 C;  2Y2Q A;  3LJA C;  5BNX A;  5B0Z D;  3AL0 C;  4H9R B;  3MGR B;  3MGP A;  4AWL C;  1Z2C B;  1ZLA C;  1N1J A;  4ZUX C;  5AY8 B;  3WKJ B;  4QLC B;  3LZ0 C;  5CPI C;  4LD9 A;  5GSU C;  3AFA B;  1KX4 B;  1P3O B;  3AZH A;  5GT3 B;  5B32 C;  5B33 C;  3X1V A;  4AWL B;  1ZLA B;  4ZUX B;  1TZY A;  3LZ0 B;  5CPI B;  1T3U A;  3MGP D;  1F66 A;  5GSU B;  3MGS C;  3UTB A;  3AZG A;  4E45 A;  4LD9 D;  3A1K A;  5B32 B;  3KXB A;  5B33 B;  1HQ3 C;  3X1T C;  3AV1 C;  1R4V A;  3A1I A;  3AZH D;  3W96 C;  4CSR B;  4UUZ A;  4XUJ C;  3X1V D;  3MGS B;  3X1S C;  1TAF A;  1TZY D;  3B6G C;  3V9R B;  4H9R A;  5AVC C;  3MGR A;  3EPK A;  1F66 D;  1HQ3 B;  3X1T B;  4Z66 C;  3UTB D;  3AZG D;  3AV1 B;  4R8P C;  2HIO C;  3WKJ A;  5AY8 A;  3W96 B;  4QLC A;  3W97 C;  1BFM A;  3KXB D;  3AN2 C;  4XUJ B;  2ZY5 A;  3X1S B;  3AFA A;  1KX4 A;  1P3O A;  4G91 C;  5GT3 A;  3B6G B;  3LJA A;  3B0C T;  3FDD A;  2J8P A;  2JE5 A;  5AVC B;  2CV5 C;  3F6T A;  4Z66 B;  2PYO C;  4R8P B;  1ZLA A;  2HIO B;  4ZUX A;  2F2A C;  3W97 B;  3LZ0 A;  5CPI A;  2FJ7 C;  3LZ1 C;  3MGR D;  3AN2 B;  5F99 C;  2BYM B;  5DNN C;  3C1C A;  2F8N B;  4G91 B;  1P3K C;  3VH5 A;  3WKJ D;  5AY8 D;  4QLC D;  2CV5 B;  5B32 A;  5B33 A;  2PYO B;  3AFA D;  1KX4 D;  1P3O D;  5CPJ C;  3VH6 A;  5GT3 D;  3LJA D;  4CSR A;  1KX3 C;  3LZ1 B;  2FJ7 B;  5F99 B;  5DNN B;  3MGS A;  3AZI C;  1P3K B;  2ZY2 A;  1ZLA D;  4ZUX D;  3LZ0 D;  5CPI D;  3V9R A;  5B32 G;  1HQ3 A;  5DNM C;  3C1C D;  1ULY A;  3AV1 A;  3X1T A;  2XD1 A;  5CPJ B;  3W96 A;  4H9O A;  1KX3 B;  2YFW B;  4WJ3 C;  5B33 D;  4XUJ A;  2NQB C;  3AZI B;  5AV9 C;  3EG5 B;  1S32 C;  1M19 C;  3B6G A;  5AVC A;  3MVD C;  3TU4 B;  2HUE C;  5DNM B;  2VQR A;  4Z66 A;  4R8P A;  2HIO A;  3AZL A;  3W97 A;  1HQ3 D;  3AV1 D;  2NQB B; 
#chains in the Genus database with same CATH homology
 5AV9 B;  2F8N A;  1M19 B;  3AZJ A;  3W96 D;  2CV5 A;  3MVD B;  4XUJ D;  2HUE B;  4WZS B;  3KFU G;  2PYO A;  3B6G D;  4H9N B;  3AYW C;  2FJ7 A;  5AVC D;  3LZ1 A;  3REL C;  5F99 A;  5DNN A;  4Z5T C;  4Z66 D;  5B2I C;  4R8P D;  2F8N G;  5C3I C;  1P3K A;  4KHA B;  2HIO D;  3AZL D;  3W97 D;  1H3O B;  1M1A D;  1P3F C;  3H0L C;  3X1T D;  4WNN B;  2F8N D;  1B6W A;  2L5A A;  3AZJ D;  3AYW B;  1KX3 A;  3REL B;  2YFW A;  2CV5 D;  3W99 C;  4Z5T B;  5B40 A;  5B2I B;  3REH D;  2PYO D;  4H9P B;  5B1M C;  3AZI A;  2F8N H;  5C3I B;  1P3P C;  1Q9C A;  3LZ1 D;  1P3F B;  5F99 D;  5DNN D;  5DNM A;  3VH6 T;  4EO5 C;  1P3K D;  3EPJ A;  1KU5 A;  3W99 B;  5CP6 C;  5AV5 C;  3AZK C;  5B1M B;  5AV9 A;  3AV2 C;  1S32 A;  1P3P B;  4XZQ C;  1M19 A;  1KX3 D;  4DRA A;  3MVD A;  5B40 D;  1WWI A;  3AZI D;  4EO5 B;  3AZF C;  1AOI C;  2F8N K;  5B0Y C;  4H9N A;  1P3G D;  5CP6 B;  5DNM D;  5AV5 B;  4M6B A;  3AZK B;  4YM6 B;  3AV2 B;  1M18 C;  4KHA A;  4XZQ B;  4YS3 C;  1H3O A;  3REK A;  3P5J B;  4WNN A;  5AV9 D;  3AZF B;  1AOI B;  1S32 D;  2Y2G A;  4KUD C;  5B0Y B;  3O62 A;  1M19 D;  3AYW A;  2LY8 A;  3REL A;  3MVD D;  4Z5T A;  3B0B A;  5B2I A;  1M18 B;  4J8U B;  5FUG B;  4YS3 B;  1P3F A;  5B1L C;  4E44 A;  3B6F C;  4KUD B;  2DF4 C;  3W99 A;  3REK D;  1P34 C;  5E5A C;  4WU8 C;  5B1M A;  3UT9 C;  3O62 D;  1P3P A;  3AYW D;  3REL D;  5B1L B;  4Z5T D;  5B2I D;  3B6F B;  5AVB C;  4NE5 A;  3H0M C;  2CWE A;  1P3B C;  4H9S C;  4WU9 C;  2BYK B;  4NE6 A;  1P3F D;  5CP6 A;  5G49 B;  5AV5 A;  3AZK A;  5E5A B;  4WU8 B;  2FFF B;  3UT9 B;  1P34 B;  5AV6 C;  3AV2 A;  4XZQ A;  3W99 D;  5BT1 D;  5GSU A;  5AVB B;  5B1M D;  1P3L C;  3WTP C;  3AZF A;  1AOI A;  3VH5 W;  1P3P D;  1P3B B;  5B0Y A;  4WU9 B;  5CHL B;  3MNN C;  4G92 C;  5AV6 B;  3VH6 W;  5GT0 C;  3MGQ C;  1M18 A;  5CPK C;  4YS3 A;  4KGC C;  5CP6 D;  5AV5 D;  5B2J C;  3AZK D;  5GXQ C;  3NQU B;  5BS7 C;  3WTP B;  1P3L B;  3WTP E;  3AV2 D;  4KUD A;  4XZQ D;  1P3A C;  3C1B C;  3MNN B;  4G92 B;  3TU4 C;  4JJN C;  3EPH A;  2UWX A;  5BNV B;  5GSU D;  3AZF D;  1AOI D;  1P3M C;  5GT0 B;  3MGQ B;  5B0Y D;  4J8V C;  2Y2M A;  5CPK B;  4KGC B;  5B32 D;  1A7W A;  5B1L A;  5B2J B;  5GXQ B;  3X1S A;  3B6F A;  1M18 D;  2ARO C;  1P3A B;  1EQZ C;  5JA4 B;  4YS3 D;  3C1B B;  3WAA C;  4JJN B;  5G49 A;  3MGS D;  1P34 A;  5E5A A;  4WU8 A;  3UT9 A;  1P3M B;  4KUD D;  4J8V B;  3AN2 A;  2BYM A;  2DQN C;  1BH9 B;  5AVB A;  1U35 C;  2ARO B;  1EQZ B;  1P3B A;  4H9S A;  3W98 C;  4WU9 A;  3WAA B;  5B1L D;  3X1S D;  3B6F D;  3KWQ C;  5AV6 A;  3MGP C;  2W8S A;  2Y2L A;  1P34 D;  4LD9 C;  5E5A D;  4WU8 D;  3NQU A;  3UT9 D;  3WTP A;  1P3L A;  1U35 B;  4WV4 B;  3W98 B;  3MNN A;  3AN2 D;  5BNV A;  5AVB D;  3KWQ B;  3AZN C;  3MGP B;  5CPJ A;  5GT0 A;  3MGQ A;  1P3B D;  4WU9 D;  5CPK A;  3B0C W;  4LD9 B;  5B2J A;  5GXQ A;  5BS7 A;  5AV6 D;  3UTB C;  1P3A A;  5KDM B;  5JA4 A;  2ZM5 A;  2FJ7 D;  3C1B A;  3TU4 A;  4JJN A;  2Y2N A;  1P3L D;  3AZN B;  3WTP D;  1P3M A;  3REI C;  1B67 A;  4J8V A;  2RVQ C;  2XD5 A;  3MNN D;  2NQB A;  1BH9 A;  5B24 C;  4YM6 C;  5CPJ D;  5GT0 D;  3MGQ D;  2ARO A;  3UTB B;  1EQZ A;  5CPK D;  3WAA A;  2G5I C;  3A6N C;  5B2J D;  5GXQ D;  3REI B;  1P3A D;  3C1B D;  3TU4 D;  4JJN D;  3R45 B;  4Z2M G;  5B24 B;  1P3M D;  1U35 A;  4J8U C;  4J8V D;  3W98 A;  3NQJ B;  3A6N B;  2NQB D;  4UPK A;  1BH8 B;  1W2E A;  3KWQ A;  3UTA C;  2ARO D;  1EQZ D;  3WAA D;  4Z2M H;  4H9P A;  3AZE C;  3C1C C;  5B31 C;  5KDM A;  3REJ C;  3LJA B;  3AZN A;  2Y2H A;  3UTA B;  1U35 D;  2ZY4 A;  4J8X C;  2Y2I A;  3W98 D;  3X1U C;  1JFI B;  3KWQ D;  3AZE B;  3WA9 C;  3C1C B;  5B31 B;  4DQY B;  2RIQ A;  3REJ B;  2ZY3 A;  2Y2P A;  3KUY C;  3LEL C;  3REI A;  4J8X B;  4H9Q B;  1KX5 C;  3X1U B;  1F1E A;  2NZD C;  1P3I C;  3R45 A;  3AZN D;  5B24 A;  4YM6 A;  3AZM C;  3WA9 B;  3IP4 C;  1ID3 C;  4NFT A;  3NQJ A;  3A6N A;  2JCH A;  3KUY B;  1BH8 A;  3LEL B;  1KX5 B;  2NZD B;  1P3I B;  3AZL C;  4H9O B;  1M1A C;  3REI D;  3AZM B;  4J8U A;  4ZBJ C;  4J8W C;  2RVQ D;  5FUG A;  1ID3 B;  4CAY B;  3AZJ C;  5B24 D;  4YM6 D;  3UTA A;  3REH C;  2G5H C;  5AV8 C;  3A6N D;  1JFI A;  3AZL B;  4X23 C;  1M1A B;  3AZE A;  4ZBJ B;  4J8W B;  5B31 A;  4DRB A;  3REJ A;  5JRG C;  3AZJ B;  5B0Z C;  4J8U D;  3REH B;  4J8X A;  2JSS A;  1PZR A;  4H9Q A;  2BYK A;  3X1U A;  5AV8 B;  4X23 B;  3UTA D;  5B40 C;  3WA9 A;  5B31 G;  5JRG B;  5B0Z B;  3KUY A;  1P3G C;  3LEL A;  3AZE D;  4NE3 A;  5B31 D;  3REJ D;  1KX5 A;  2NZD A;  1P3I A;  2YFV B;  3AZM A;  5B40 B;  4J8X D;  1ID3 A;  3KSY A;  4HGA C;  3X1U D;  4CAY A;  1P3G B;  5BO0 B;  3WA9 D;  3B0D C;  3AZH C;  5BNX B;  3KUY D;  3LEL D;  1M1A A;  3X1V C;  4J8W A;  4HGA B;  1KX5 D;  4KGC A;  2NZD D;  1S32 B;  1N1J B;  3H0R C;  1P3I D;  1TZY C;  3AZM D;  1F66 C;  3REH A;  3REK C;  3AZG C;  3B0D B;  1ID3 D;  3AZH B;  5AV8 A;  3O62 C;  4X23 A;  2IO5 C;  3KXB C;  3X1V B;  5JRG A;  1TZY B;  2Y2J A;  5B0Z A;  1F66 B;  4J8W D;  3REK B;  3AZG B;  4KGC D;  3O62 B;  2YFV A;  2IO5 B;  3KXB B;  1WWS A;  3MGR C;  5BT1 C;  1HTA A;  3VH5 T;  2Y2O A;  5AV8 D;  2BG1 A;  3WKJ C;  5AY8 C;  4QLC C;  4X23 D;  4UUZ B;  1P3G A;  5BO0 A;  3EPL A;  2Y2K A;  3AFA C;  1KX4 C;  1P3O C;  1TAF B;  5JRG D;  5GT3 C;  2Y2Q A;  3LJA C;  5BNX A;  5B0Z D;  3AL0 C;  4H9R B;  3MGR B;  3MGP A;  4AWL C;  1Z2C B;  1ZLA C;  1N1J A;  4ZUX C;  5AY8 B;  3WKJ B;  4QLC B;  3LZ0 C;  5CPI C;  4LD9 A;  5GSU C;  3AFA B;  1KX4 B;  1P3O B;  3AZH A;  5GT3 B;  5B32 C;  5B33 C;  3X1V A;  4AWL B;  1ZLA B;  4ZUX B;  1TZY A;  3LZ0 B;  5CPI B;  1T3U A;  3MGP D;  1F66 A;  5GSU B;  3MGS C;  3UTB A;  3AZG A;  4E45 A;  4LD9 D;  3A1K A;  5B32 B;  3KXB A;  5B33 B;  1HQ3 C;  3X1T C;  3AV1 C;  1R4V A;  3A1I A;  3AZH D;  3W96 C;  4CSR B;  4UUZ A;  4XUJ C;  3X1V D;  3MGS B;  3X1S C;  1TAF A;  1TZY D;  3B6G C;  3V9R B;  4H9R A;  5AVC C;  3MGR A;  3EPK A;  1F66 D;  1HQ3 B;  3X1T B;  4Z66 C;  3UTB D;  3AZG D;  3AV1 B;  4R8P C;  2HIO C;  3WKJ A;  5AY8 A;  3W96 B;  4QLC A;  3W97 C;  1BFM A;  3KXB D;  3AN2 C;  4XUJ B;  2ZY5 A;  3X1S B;  3AFA A;  1KX4 A;  1P3O A;  4G91 C;  5GT3 A;  3B6G B;  3LJA A;  3B0C T;  3FDD A;  2J8P A;  2JE5 A;  5AVC B;  2CV5 C;  3F6T A;  4Z66 B;  2PYO C;  4R8P B;  1ZLA A;  2HIO B;  4ZUX A;  2F2A C;  3W97 B;  3LZ0 A;  5CPI A;  2FJ7 C;  3LZ1 C;  3MGR D;  3AN2 B;  5F99 C;  2BYM B;  5DNN C;  3C1C A;  2F8N B;  4G91 B;  1P3K C;  3VH5 A;  3WKJ D;  5AY8 D;  4QLC D;  2CV5 B;  5B32 A;  5B33 A;  2PYO B;  3AFA D;  1KX4 D;  1P3O D;  5CPJ C;  3VH6 A;  5GT3 D;  3LJA D;  4CSR A;  1KX3 C;  3LZ1 B;  2FJ7 B;  5F99 B;  5DNN B;  3MGS A;  3AZI C;  1P3K B;  2ZY2 A;  1ZLA D;  4ZUX D;  3LZ0 D;  5CPI D;  3V9R A;  5B32 G;  1HQ3 A;  5DNM C;  3C1C D;  1ULY A;  3AV1 A;  3X1T A;  2XD1 A;  5CPJ B;  3W96 A;  4H9O A;  1KX3 B;  2YFW B;  4WJ3 C;  5B33 D;  4XUJ A;  2NQB C;  3AZI B;  5AV9 C;  3EG5 B;  1S32 C;  1M19 C;  3B6G A;  5AVC A;  3MVD C;  3TU4 B;  2HUE C;  5DNM B;  2VQR A;  4Z66 A;  4R8P A;  2HIO A;  3AZL A;  3W97 A;  1HQ3 D;  3AV1 D;  2NQB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...