3AZIB

Crystal structure of human nucleosome core particle containing h4k31q mutation
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
NIQGITQPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 26
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3aziB00
5B40C 2YFVB 5B1MC 5B33A 3MNNB 5B24C 4Z66C 3AZKC 5AVCD 5CP6C 3X1VB 5GXQD 3W96B 3MVDA 5B32D 4QLCA 3AFAA 1TAFA 3RELA 5B31A 3UT9C 3UTAC 3AZEC 1HQ3A 3NQJB 3X1UD 5AV6A 4WU8A 3VH6T 4HGAB 3TU4D 2AROB 3MNNC 3MGQA 4JJNB 3X1VC 1P3BA 4Z5TD 3AV1A 3W96C 4YS3C 3REKA 2FJ7A 5AV5B 3AZLD 4KUDA 1TZYA 1P3AA 4H9QB 5JRGC 3REHD 1P3FA 3WKJA 1ZLAB 5B1LB 4H9PA 4R8PD 3KXBC 5B0YC 1H3OB 3B0DB 5E5AB 1P34D 3AZHD 2AROC 1KX5D 4DRBA 3B6GB 3AZGA 4J8WB 5B2IB 5B0ZA 4H9RB 3A6ND 1S32B 3MGPB 3AZID 3REJA 5B1LC 1P3PB 3O62A 3KUYB 3WAAB 4X23A 5GT3A 3AZFB 3X1SB 4XUJA 2CV5D 5AVCB 3X1TB 2NZDC 3UTBA 5B1MD 3AV2C 5E5AC 5B24D 4Z66D 3AZKD 1KX3C 3B6GC 4J8WC 4ZUXA 5CP6D 3AZJA 5B2JA 3W98C 1EQZB 3WA9B 3WTPD 1S32C 2BYKB 1Q9CA 4KGCC 1BH8B 5CPKB 4UUZB 3UT9D 5BO0A 3UTAD 3AZED 1P3LB 1P3PC 2F8NA 3WAAC 3KUYC 2F8NK 4DRAA 5GXQA 3AZFC 3KWQB 3X1SC 3LZ0B 3X1TC 1B67A 4Z5TB 5B32A 3MNND 2L5AA 3C1CA 3X1VD 3V9RB 5GT0B 1EQZC 3WA9C 3W96D 4YS3D 2CWEA 1P3OA 5AV8B 5KDMA 3X1UA 5JRGD 5CPKC 5BNXB 3TU4A 2PYOA 1P3LC 1P34B 3AZHB 3KWQC 3KXBD 1KX5B 3LZ0C 5BNVA 3AZLA 3A6NB 2AROD 3REHA 1F1EA 5AV9C 4JJND 1JFIA 5GT0C 4R8PA 5DNMB 5AY8C 2YFWA 3AZIB 3AN2C 4LD9C 3C1BB 4J8VA 5AV8C 4H9NA 5BS7A 1ZLAD 5B1LD 2CV5B 5B40B 4H9SC 2NZDD 4XZQC 3AV2D 5E5AD 4CAYB 1KX3D 4E45A 3REIC 1P3GC 3B6GD 4J8WD 3W98D 3AZMC 5DNMC 4AWLB 1S32D 5B1MA 5FUGA 3W97A 1P3PD 3W99B 3KUYD 5B24A 3AZKA 3WAAD 5CP6A 3AZFD 3WTPA 3X1SD 3X1TD 1AOIC 4YS3B 3NQUB 3AYWB 3UT9A 3UTAA 3AZEA 5F99B 1EQZD 4Z2MG 5JRGB 4AWLC 3AZNB 3WA9D 2NQBB 1N1JB 1P3MA 5CPKD 1M18B 2YFVA 4YM6C 3W99C 3MGRC 3KXBB 5B0YB 4KHAB 3MNNA 1P3LD 3X1VA 5JA4B 2RVQC 5BT1C 3W96A 3KWQD 3LZ0D 1F66B 5CPIB 2LY8A 5AV9D 4G92B 3AYWC 5B33C 5CPJB 5DNNB 5GT0D 5F99C 5AY8D 3NQJA 3AZNC 4LD9D 2NQBC 5AV8D 1M1AB 3MVDC 5B31G 5G49B 3B0CT 1M18C 3AFAC 2AROA 5B31C 2NZDB 4JJNA 3AV2B 1HQ3C 1KX3B 3W98B 4XZQD 1F66C 5AV5A 5CPIC 4H9QA 3REID 4G92C 1P3KB 1ZLAA 3B0BA 5CPJC 5B1LA 5DNNC 3AZMD 4KGCB 5DNMD 1P3BC 3AV1C 5C3IB 3C1BD 1M1AC 3REKC 2FJ7C 1H3OA 2BYMB 4NFTA 5E5AA 3B6GA 3WTPE 5B40D 4J8WA 5B2IA 4H9RA 4G91C 3LZ1B 1S32A 1AOID 4WU9B 1U35A 3MGPA 4WNNB 1M19B 1P3KC 1P3PA 1ID3B 3KUYA 3WAAA 5B0ZC 5C3IC 3AZFA 3X1SA 1P3MB 4CSRB 5AVCA 3X1TA 5AVBB 4YM6D 3W99D 3REJC 4J8UB 3R45B 3B6FB 4J8XB 2RVQD 5BT1D 1EQZA 3WA9A 3LZ1C 5AV9B 2BYKA 4WU9C 5AY8B 1BH8A 3AN2B 5CPKA 4UUZA 4LD9B 3AYWD 1M19C 5B33D 5F99D 1P3LA 1ID3C 3AZJC 3AZND 5B2JC 2HIOB 2NQBD 3MVDD 3KWQA 3LZ0A 1M18D 2F8NG 5AVBC 4Z5TA 5B0YD 4J8UC 4XZQB 3B6FC 1HQ3D 3V9RA 5GT0A 4J8XC 3REIB 1P3GB 1F66D 5AV8A 5CPID 4NE3A 3AZMB 3MGSB 3LJAB 2IO5B 5BNXA 5CPJD 1BH9B 5DNND 3C1CC 1KX4B 1P3BD 3AV1D 2HIOC 1P34A 3REKD 3AZHA 1M1AD 4H9SA 1KX5A 2FJ7D 1P3OC 3X1UC 3A6NA 3LELB 2PYOC 1AOIB 5DNMA 3AZIA 4WZSB 3C1BA 4H9OB 3MGSC 3LJAC 2IO5C 1P3KD 4KGCD 5CHLB 5GSUB 2CV5A 1P3IB 5B0ZD 5B40A 1KX4C 4YM6B 4M6BA 3MGRB 4Z66A 4J8VC 3LELC 4CAYA 2HUEB 1ULYA 3LZ1D 5B33B 4WU9D 1M19D 3MVDB 3W99A 1ID3D 5GSUC 3AZJD 5B2JD 1P3IC 4QLCB 3AFAB 1TAFB 3RELB 5B31B 1HQ3B 5AVBD 4J8UD 4YS3A 2HUEC 1HTAA 3NQUA 3AYWA 3W97C 2F8ND 5AV6B 4WU8B 3B6FD 4J8XD 5F99A 5JRGA 3AZNA 2NQBA 3WTPC 3MGQB 1R4VA 1N1JA 1P3BB 3AN2D 3AV1B 1M18A 3REKB 2FJ7B 3C1CD 3KXBA 5B0YA 4KHAA 4KUDB 4ZBJB 1TZYB 1P3AB 2HIOD 4QLCC 5JA4A 1P3FB 3WKJB 3RELC 1P3OD 4H9PB 1F66A 5CPIA 4G91B 1P3MC 2PYOD 5AV6C 4WU8C 5CPJA 5DNNA 1P3GD 1M1AA 3AZGB 4NE6A 3MGQC 5G49A 5B0ZB 3MGSD 3LJAD 1KX4D 4KUDC 4ZBJC 1TZYC 1P3AC 2NZDA 3AV2A 1P3FC 3REJB 3WKJC 1KX3A 4J8VD 3O62B 3W98A 3LELD 4X23B 4HGAC 5GT3B 1P3KA 4XUJB 4KGCA 3UTBB 4Z2MH 4JJNC 1B6WA 3AZGC 4ZUXB 3AZJB 1U35B 2BYMA 5B2JB 5AV5C 5GSUD 1P3ID 1ZLAC 2JSSA 4E44A 3MGRD 3LZ1A 5BO0B 3O62C 2F8NB 4WU9A 4X23C 3B0DC 4WNNA 5GXQB 3W97D 3VH5W 5GT3C 1M19A 4XUJC 1ID3A 3UTBC 5B2IC 5B32B 3C1CB 4ZUXC 1U35C 4CSRA 3MGPC 5AVBA 4J8UA 1P3OB 3KSYA 5KDMB 3X1UB 3R45A 3B6FA 4QLCD 4J8XA 3AFAD 3RELD 5B31D 3TU4B 2PYOB 5AV9A 1P3MD 5AVCC 5AY8A 3AN2A 5GXQC 5B32G 4LD9A 5AV6D 4WU8D 5BNVB 3AZLB 5B32C 2HIOA 3REHB 3MGQD 3VH5A 1JFIB 4R8PB 2YFWB 4J8VB 4KUDD 1TZYD 4XZQA 1P3AD 3VH6W 1P3FD 4H9NB 3WKJD 3TU4C 3REIA 1P3GA 3AZMA 1KU5A 4Z5TC 4EO5B 3LJAA 3MGSA 1BH9A 3AZLC 1KX4A 3REHC 3AZGD 5AV5D 3B0CW 4R8PC 3LELA 1AOIA 4NE5A 3REJD 5B1MB 5BS7C 5FUGB 3W97B 1P34C 1WWSA 3O62D 3AZHC 1KX5C 4Z66B 5B24B 3AZKB 4H9OA 4X23D 1A7WA 5CP6B 3VH6A 3A6NC 4EO5C 5GT3D 3WTPB 1BFMA 4XUJD 3VH5T 3UTBD 5B2ID 5GSUA 1P3IA 4YM6A 3AZIC 3MGRA 3UT9B 4ZUXD 3C1BC 1U35D 3UTAB 3MGPD 3AZEB 2F8NH 4WV4B 1WWIA 2CV5C
chains in the Genus database with same CATH superfamily
5B40C 2YFVB 3F6TA 5B1MC 5B33A 3MNNB 5B24C 4Z66C 3AZKC 5AVCD 5CP6C 3X1VB 5GXQD 3W96B 3MVDA 2G5IC 5B32D 4QLCA 3AFAA 1TAFA 3RELA 5B31A 3UT9C 3UTAC 3AZEC 1HQ3A 3NQJB 3X1UD 5AV6A 4WU8A 3VH6T 4HGAB 3TU4D 2AROB 3MNNC 3MGQA 4JJNB 3X1VC 1P3BA 4Z5TD 3AV1A 3W96C 4YS3C 3REKA 2FJ7A 3AL0C 5AV5B 3AZLD 4KUDA 1TZYA 1P3AA 4H9QB 5JRGC 3REHD 1P3FA 3WKJA 1ZLAB 5B1LB 4H9PA 4R8PD 3KXBC 5B0YC 1H3OB 3B0DB 5E5AB 1P34D 3AZHD 2AROC 1KX5D 4DRBA 3B6GB 3AZGA 4J8WB 5B2IB 5B0ZA 4H9RB 3A6ND 1S32B 3MGPB 3AZID 2Y2PA 3REJA 5B1LC 1P3PB 3O62A 3KUYB 3WAAB 4X23A 2Y2MA 5GT3A 3AZFB 3X1SB 4XUJA 2CV5D 5AVCB 3X1TB 2Y2IA 2NZDC 3UTBA 5B1MD 3IP4C 5E5AC 3AV2C 5B24D 4Z66D 3AZKD 1KX3C 3B6GC 4J8WC 4ZUXA 5CP6D 3AZJA 5B2JA 3W98C 1EQZB 3WA9B 3WTPD 4DQYB 1S32C 2BYKB 1Q9CA 4KGCC 1BH8B 5CPKB 4UUZB 3UT9D 5BO0A 3UTAD 3AZED 1P3LB 1P3PC 2F8NA 3WAAC 3KUYC 2F8NK 4DRAA 5GXQA 3AZFC 3KWQB 3X1SC 3LZ0B 3X1TC 1B67A 4Z5TB 5B32A 3MNND 2L5AA 2Y2NA 3C1CA 3X1VD 3V9RB 5GT0B 1EQZC 3WA9C 3EPJA 3W96D 4YS3D 2CWEA 1P3OA 5AV8B 5KDMA 3X1UA 5JRGD 5CPKC 5BNXB 3TU4A 2PYOA 1P3LC 1P34B 3AZHB 3KWQC 3KXBD 1KX5B 3LZ0C 5BNVA 3AZLA 3A6NB 2AROD 3REHA 1F1EA 5AV9C 4JJND 1JFIA 5GT0C 4R8PA 5DNMB 5AY8C 2YFWA 3AZIB 3AN2C 4LD9C 3C1BB 4J8VA 5AV8C 3KFUG 4H9NA 5BS7A 1ZLAD 5B1LD 2CV5B 5B40B 4H9SC 2NZDD 4XZQC 3AV2D 5E5AD 4CAYB 1KX3D 4E45A 3REIC 2ZY5A 1P3GC 4J8WD 3B6GD 3W98D 3AZMC 5DNMC 4AWLB 1S32D 5B1MA 5FUGA 3W97A 1P3PD 3W99B 3KUYD 5B24A 3AZKA 3WAAD 3EPHA 5CP6A 3AZFD 3WTPA 3X1SD 3X1TD 1AOIC 4YS3B 3NQUB 3AYWB 3UT9A 3UTAA 3AZEA 5F99B 1PZRA 4Z2MG 5JRGB 4AWLC 3AZNB 1EQZD 3WA9D 3A1KA 2NQBB 2ZM5A 1N1JB 1P3MA 5CPKD 1M18B 2YFVA 4YM6C 3W99C 3MGRC 3KXBB 5B0YB 4KHAB 3MNNA 1P3LD 2J8PA 3X1VA 5JA4B 2RVQC 5BT1C 3W96A 3KWQD 3LZ0D 1F66B 5CPIB 2LY8A 2XD5A 5AV9D 4G92B 3AYWC 5B33C 5CPJB 5DNNB 5GT0D 5F99C 5AY8D 3NQJA 3AZNC 4LD9D 2NQBC 5AV8D 1M1AB 3MVDC 5B31G 5G49B 2Y2HA 3B0CT 1M18C 3AFAC 2AROA 3H0LC 5B31C 2NZDB 4JJNA 3AV2B 1HQ3C 3EPKA 1KX3B 3W98B 2JE5A 4XZQD 5AV5A 5CPIC 1F66C 2DF4C 4H9QA 3REID 4G92C 1P3KB 1ZLAA 3B0BA 5CPJC 5B1LA 5DNNC 3AZMD 4KGCB 5DNMD 1P3BC 3AV1C 5C3IB 3C1BD 1M1AC 3REKC 2FJ7C 1H3OA 2BYMB 4NFTA 5E5AA 1W2EA 3B6GA 3WTPE 5B40D 4J8WA 5B2IA 4H9RA 4G91C 3LZ1B 3EPLA 1S32A 1AOID 4WU9B 1U35A 3MGPA 4WNNB 1M19B 2ZY4A 1P3KC 1P3PA 1ID3B 3KUYA 3WAAA 5B0ZC 5C3IC 3AZFA 3X1SA 1P3MB 4CSRB 5AVCA 3X1TA 5AVBB 4YM6D 3W99D 3REJC 4J8UB 3R45B 3B6FB 4J8XB 2RVQD 5BT1D 1EQZA 3WA9A 3LZ1C 5AV9B 2BYKA 4WU9C 3A1IA 5AY8B 1BH8A 3AN2B 5CPKA 4UUZA 4LD9B 3AYWD 1M19C 5B33D 5F99D 1P3LA 1ID3C 3AZJC 3AZND 5B2JC 2HIOB 2NQBD 3MVDD 3KWQA 3LZ0A 1M18D 2F8NG 5AVBC 4Z5TA 5B0YD 4J8UC 4XZQB 3B6FC 1HQ3D 3V9RA 5GT0A 2Y2JA 4J8XC 2VQRA 3REIB 1P3GB 1F66D 5AV8A 5CPID 4NE3A 3AZMB 3MGSB 3LJAB 2IO5B 5BNXA 5CPJD 1BH9B 5DNND 3C1CC 1KX4B 1P3BD 3AV1D 3FDDA 2HIOC 1P34A 3REKD 3AZHA 1M1AD 4H9SA 1KX5A 2FJ7D 2FFFB 1P3OC 3X1UC 3A6NA 3LELB 2UWXA 2PYOC 1AOIB 5DNMA 3AZIA 4WZSB 3C1BA 4H9OB 3MGSC 3LJAC 2IO5C 1P3KD 4KGCD 5CHLB 5GSUB 2CV5A 1P3IB 5B0ZD 5B40A 1KX4C 4YM6B 4M6BA 3MGRB 4Z66A 4J8VC 2W8SA 3LELC 4CAYA 2HUEB 2ZY2A 1ULYA 3LZ1D 5B33B 4WU9D 1M19D 3MVDB 3W99A 1ID3D 5GSUC 3AZJD 5B2JD 1P3IC 4QLCB 3AFAB 1TAFB 3RELB 5B31B 1HQ3B 5AVBD 4J8UD 4YS3A 2HUEC 1HTAA 3NQUA 3AYWA 3W97C 2F8ND 5AV6B 4WU8B 3B6FD 4J8XD 5F99A 5JRGA 3AZNA 1Z2CB 2NQBA 3WTPC 3MGQB 1R4VA 1N1JA 1P3BB 3AN2D 3AV1B 1M18A 3REKB 2FJ7B 3C1CD 3KXBA 5B0YA 4KHAA 4KUDB 4ZBJB 1TZYB 1P3AB 2HIOD 4QLCC 5JA4A 1P3FB 3WKJB 3RELC 2Y2QA 1P3OD 4H9PB 1F66A 2BG1A 5CPIA 4G91B 1P3MC 4WJ3C 2PYOD 5AV6C 4WU8C 5CPJA 5DNNA 1P3GD 1M1AA 3AZGB 4NE6A 3MGQC 5G49A 5B0ZB 3H0RC 3MGSD 3LJAD 2JCHA 1KX4D 4KUDC 4ZBJC 1TZYC 1P3AC 2NZDA 3AV2A 1P3FC 3REJB 3WKJC 1KX3A 4J8VD 3O62B 3W98A 3LELD 4X23B 4HGAC 5GT3B 2ZY3A 1P3KA 4XUJB 4KGCA 3UTBB 4Z2MH 4JJNC 1B6WA 3AZGC 2Y2GA 4ZUXB 3AZJB 2BYMA 5B2JB 5AV5C 1U35B 5GSUD 1P3ID 1ZLAC 2Y2OA 2JSSA 4E44A 3MGRD 3LZ1A 5BO0B 3O62C 2F8NB 4WU9A 4X23C 3B0DC 4WNNA 5GXQB 3W97D 3VH5W 5GT3C 1M19A 4XUJC 4UPKA 1ID3A 3UTBC 5B2IC 3EG5B 5B32B 3C1CB 3P5JB 4ZUXC 1U35C 4CSRA 3MGPC 5AVBA 4J8UA 1P3OB 3KSYA 5KDMB 3X1UB 3R45A 3B6FA 4QLCD 4J8XA 3AFAD 3RELD 5B31D 3TU4B 2PYOB 5AV9A 1P3MD 5AVCC 5AY8A 2G5HC 3AN2A 5GXQC 5B32G 4LD9A 5AV6D 4WU8D 5BNVB 3AZLB 5B32C 2HIOA 3REHB 3MGQD 3VH5A 1JFIB 2Y2KA 4R8PB 2YFWB 4J8VB 4KUDD 1TZYD 4XZQA 1P3AD 3VH6W 1P3FD 4H9NB 3WKJD 3TU4C 3REIA 1P3GA 3AZMA 2XD1A 1KU5A 4Z5TC 4EO5B 3LJAA 3MGSA 1BH9A 3AZLC 1KX4A 2F2AC 3REHC 3AZGD 5AV5D 3B0CW 4R8PC 3LELA 2RIQA 1AOIA 4NE5A 3REJD 5B1MB 5BS7C 5FUGB 3W97B 1P34C 1WWSA 3O62D 3AZHC 1KX5C 4Z66B 5B24B 3AZKB 4H9OA 4X23D 1A7WA 5CP6B 1T3UA 3VH6A 4EO5C 5GT3D 3WTPB 3A6NC 1BFMA 4XUJD 3VH5T 2Y2LA 3UTBD 5B2ID 5GSUA 1P3IA 4YM6A 3AZIC 2DQNC 3MGRA 3UT9B 4ZUXD 3C1BC 1U35D 3UTAB 3MGPD 3AZEB 2F8NH 4WV4B 3H0MC 1WWIA 2CV5C
chains in the Genus database with same CATH topology
5B40C 2YFVB 3F6TA 5B1MC 5B33A 3MNNB 5B24C 4Z66C 3AZKC 5AVCD 5CP6C 3X1VB 5GXQD 3W96B 3MVDA 2G5IC 5B32D 4QLCA 3AFAA 1TAFA 3RELA 5B31A 3UT9C 3UTAC 3AZEC 1HQ3A 3NQJB 3X1UD 5AV6A 4WU8A 3VH6T 4HGAB 3TU4D 2AROB 3MNNC 3MGQA 4JJNB 3X1VC 1P3BA 4Z5TD 3AV1A 3W96C 4YS3C 3REKA 2FJ7A 3AL0C 5AV5B 3AZLD 4KUDA 1TZYA 1P3AA 4H9QB 5JRGC 3REHD 1P3FA 3WKJA 1ZLAB 5B1LB 4H9PA 4R8PD 3KXBC 5B0YC 1H3OB 3B0DB 5E5AB 1P34D 3AZHD 2AROC 1KX5D 4DRBA 3B6GB 3AZGA 4J8WB 5B2IB 5B0ZA 4H9RB 3A6ND 1S32B 3MGPB 3AZID 2Y2PA 3REJA 5B1LC 1P3PB 3O62A 3KUYB 3WAAB 4X23A 2Y2MA 5GT3A 3AZFB 3X1SB 4XUJA 2CV5D 5AVCB 3X1TB 2Y2IA 2NZDC 3UTBA 5B1MD 3IP4C 5E5AC 3AV2C 5B24D 4Z66D 3AZKD 1KX3C 3B6GC 4J8WC 4ZUXA 5CP6D 3AZJA 5B2JA 3W98C 1EQZB 3WA9B 3WTPD 4DQYB 1S32C 2BYKB 1Q9CA 4KGCC 1BH8B 5CPKB 4UUZB 3UT9D 5BO0A 3UTAD 3AZED 1P3LB 1P3PC 2F8NA 3WAAC 3KUYC 2F8NK 4DRAA 5GXQA 3AZFC 3KWQB 3X1SC 3LZ0B 3X1TC 1B67A 4Z5TB 5B32A 3MNND 2L5AA 2Y2NA 3C1CA 3X1VD 3V9RB 5GT0B 1EQZC 3WA9C 3EPJA 3W96D 4YS3D 2CWEA 1P3OA 5AV8B 5KDMA 3X1UA 5JRGD 5CPKC 5BNXB 3TU4A 2PYOA 1P3LC 1P34B 3AZHB 3KWQC 3KXBD 1KX5B 3LZ0C 5BNVA 3AZLA 3A6NB 2AROD 3REHA 1F1EA 5AV9C 4JJND 1JFIA 5GT0C 4R8PA 5DNMB 5AY8C 2YFWA 3AZIB 3AN2C 4LD9C 3C1BB 4J8VA 5AV8C 3KFUG 4H9NA 5BS7A 1ZLAD 5B1LD 2CV5B 5B40B 4H9SC 2NZDD 4XZQC 3AV2D 5E5AD 4CAYB 1KX3D 4E45A 3REIC 2ZY5A 1P3GC 4J8WD 3B6GD 3W98D 3AZMC 5DNMC 4AWLB 1S32D 5B1MA 5FUGA 3W97A 1P3PD 3W99B 3KUYD 5B24A 3AZKA 3WAAD 3EPHA 5CP6A 3AZFD 3WTPA 3X1SD 3X1TD 1AOIC 4YS3B 3NQUB 3AYWB 3UT9A 3UTAA 3AZEA 5F99B 1PZRA 4Z2MG 5JRGB 4AWLC 3AZNB 1EQZD 3WA9D 3A1KA 2NQBB 2ZM5A 1N1JB 1P3MA 5CPKD 1M18B 2YFVA 4YM6C 3W99C 3MGRC 3KXBB 5B0YB 4KHAB 3MNNA 1P3LD 2J8PA 3X1VA 5JA4B 2RVQC 5BT1C 3W96A 3KWQD 3LZ0D 1F66B 5CPIB 2LY8A 2XD5A 5AV9D 4G92B 3AYWC 5B33C 5CPJB 5DNNB 5GT0D 5F99C 5AY8D 3NQJA 3AZNC 4LD9D 2NQBC 5AV8D 1M1AB 3MVDC 5B31G 5G49B 2Y2HA 3B0CT 1M18C 3AFAC 2AROA 3H0LC 5B31C 2NZDB 4JJNA 3AV2B 1HQ3C 3EPKA 1KX3B 3W98B 2JE5A 4XZQD 5AV5A 5CPIC 1F66C 2DF4C 4H9QA 3REID 4G92C 1P3KB 1ZLAA 3B0BA 5CPJC 5B1LA 5DNNC 3AZMD 4KGCB 5DNMD 1P3BC 3AV1C 5C3IB 3C1BD 1M1AC 3REKC 2FJ7C 1H3OA 2BYMB 4NFTA 5E5AA 1W2EA 3B6GA 3WTPE 5B40D 4J8WA 5B2IA 4H9RA 4G91C 3LZ1B 3EPLA 1S32A 1AOID 4WU9B 1U35A 3MGPA 4WNNB 1M19B 2ZY4A 1P3KC 1P3PA 1ID3B 3KUYA 3WAAA 5B0ZC 5C3IC 3AZFA 3X1SA 1P3MB 4CSRB 5AVCA 3X1TA 5AVBB 4YM6D 3W99D 3REJC 4J8UB 3R45B 3B6FB 4J8XB 2RVQD 5BT1D 1EQZA 3WA9A 3LZ1C 5AV9B 2BYKA 4WU9C 3A1IA 5AY8B 1BH8A 3AN2B 5CPKA 4UUZA 4LD9B 3AYWD 1M19C 5B33D 5F99D 1P3LA 1ID3C 3AZJC 3AZND 5B2JC 2HIOB 2NQBD 3MVDD 3KWQA 3LZ0A 1M18D 2F8NG 5AVBC 4Z5TA 5B0YD 4J8UC 4XZQB 3B6FC 1HQ3D 3V9RA 5GT0A 2Y2JA 4J8XC 2VQRA 3REIB 1P3GB 1F66D 5AV8A 5CPID 4NE3A 3AZMB 3MGSB 3LJAB 2IO5B 5BNXA 5CPJD 1BH9B 5DNND 3C1CC 1KX4B 1P3BD 3AV1D 3FDDA 2HIOC 1P34A 3REKD 3AZHA 1M1AD 4H9SA 1KX5A 2FJ7D 2FFFB 1P3OC 3X1UC 3A6NA 3LELB 2UWXA 2PYOC 1AOIB 5DNMA 3AZIA 4WZSB 3C1BA 4H9OB 3MGSC 3LJAC 2IO5C 1P3KD 4KGCD 5CHLB 5GSUB 2CV5A 1P3IB 5B0ZD 5B40A 1KX4C 4YM6B 4M6BA 3MGRB 4Z66A 4J8VC 2W8SA 3LELC 4CAYA 2HUEB 2ZY2A 1ULYA 3LZ1D 5B33B 4WU9D 1M19D 3MVDB 3W99A 1ID3D 5GSUC 3AZJD 5B2JD 1P3IC 4QLCB 3AFAB 1TAFB 3RELB 5B31B 1HQ3B 5AVBD 4J8UD 4YS3A 2HUEC 1HTAA 3NQUA 3AYWA 3W97C 2F8ND 5AV6B 4WU8B 3B6FD 4J8XD 5F99A 5JRGA 3AZNA 1Z2CB 2NQBA 3WTPC 3MGQB 1R4VA 1N1JA 1P3BB 3AN2D 3AV1B 1M18A 3REKB 2FJ7B 3C1CD 3KXBA 5B0YA 4KHAA 4KUDB 4ZBJB 1TZYB 1P3AB 2HIOD 4QLCC 5JA4A 1P3FB 3WKJB 3RELC 2Y2QA 1P3OD 4H9PB 1F66A 2BG1A 5CPIA 4G91B 1P3MC 4WJ3C 2PYOD 5AV6C 4WU8C 5CPJA 5DNNA 1P3GD 1M1AA 3AZGB 4NE6A 3MGQC 5G49A 5B0ZB 3H0RC 3MGSD 3LJAD 2JCHA 1KX4D 4KUDC 4ZBJC 1TZYC 1P3AC 2NZDA 3AV2A 1P3FC 3REJB 3WKJC 1KX3A 4J8VD 3O62B 3W98A 3LELD 4X23B 4HGAC 5GT3B 2ZY3A 1P3KA 4XUJB 4KGCA 3UTBB 4Z2MH 4JJNC 1B6WA 3AZGC 2Y2GA 4ZUXB 3AZJB 2BYMA 5B2JB 5AV5C 1U35B 5GSUD 1P3ID 1ZLAC 2Y2OA 2JSSA 4E44A 3MGRD 3LZ1A 5BO0B 3O62C 2F8NB 4WU9A 4X23C 3B0DC 4WNNA 5GXQB 3W97D 3VH5W 5GT3C 1M19A 4XUJC 4UPKA 1ID3A 3UTBC 5B2IC 3EG5B 5B32B 3C1CB 3P5JB 4ZUXC 1U35C 4CSRA 3MGPC 5AVBA 4J8UA 1P3OB 3KSYA 5KDMB 3X1UB 3R45A 3B6FA 4QLCD 4J8XA 3AFAD 3RELD 5B31D 3TU4B 2PYOB 5AV9A 1P3MD 5AVCC 5AY8A 2G5HC 3AN2A 5GXQC 5B32G 4LD9A 5AV6D 4WU8D 5BNVB 3AZLB 5B32C 2HIOA 3REHB 3MGQD 3VH5A 1JFIB 2Y2KA 4R8PB 2YFWB 4J8VB 4KUDD 1TZYD 4XZQA 1P3AD 3VH6W 1P3FD 4H9NB 3WKJD 3TU4C 3REIA 1P3GA 3AZMA 2XD1A 1KU5A 4Z5TC 4EO5B 3LJAA 3MGSA 1BH9A 3AZLC 1KX4A 2F2AC 3REHC 3AZGD 5AV5D 3B0CW 4R8PC 3LELA 2RIQA 1AOIA 4NE5A 3REJD 5B1MB 5BS7C 5FUGB 3W97B 1P34C 1WWSA 3O62D 3AZHC 1KX5C 4Z66B 5B24B 3AZKB 4H9OA 4X23D 1A7WA 5CP6B 1T3UA 3VH6A 4EO5C 5GT3D 3WTPB 3A6NC 1BFMA 4XUJD 3VH5T 2Y2LA 3UTBD 5B2ID 5GSUA 1P3IA 4YM6A 3AZIC 2DQNC 3MGRA 3UT9B 4ZUXD 3C1BC 1U35D 3UTAB 3MGPD 3AZEB 2F8NH 4WV4B 3H0MC 1WWIA 2CV5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B40 C;  2YFV B;  5B1M C;  5B33 A;  3MNN B;  5B24 C;  4Z66 C;  3AZK C;  5AVC D;  5CP6 C;  3X1V B;  5GXQ D;  3W96 B;  3MVD A;  5B32 D;  4QLC A;  3AFA A;  1TAF A;  3REL A;  5B31 A;  3UT9 C;  3UTA C;  3AZE C;  1HQ3 A;  3NQJ B;  3X1U D;  5AV6 A;  4WU8 A;  3VH6 T;  4HGA B;  3TU4 D;  2ARO B;  3MNN C;  3MGQ A;  4JJN B;  3X1V C;  1P3B A;  4Z5T D;  3AV1 A;  3W96 C;  4YS3 C;  3REK A;  2FJ7 A;  5AV5 B;  3AZL D;  4KUD A;  1TZY A;  1P3A A;  4H9Q B;  5JRG C;  3REH D;  1P3F A;  3WKJ A;  1ZLA B;  5B1L B;  4H9P A;  4R8P D;  3KXB C;  5B0Y C;  1H3O B;  3B0D B;  5E5A B;  1P34 D;  3AZH D;  2ARO C;  1KX5 D;  4DRB A;  3B6G B;  3AZG A;  4J8W B;  5B2I B;  5B0Z A;  4H9R B;  3A6N D;  1S32 B;  3MGP B;  3AZI D;  3REJ A;  5B1L C;  1P3P B;  3O62 A;  3KUY B;  3WAA B;  4X23 A;  5GT3 A;  3AZF B;  3X1S B;  4XUJ A;  2CV5 D;  5AVC B;  3X1T B;  2NZD C;  3UTB A;  5B1M D;  3AV2 C;  5E5A C;  5B24 D;  4Z66 D;  3AZK D;  1KX3 C;  3B6G C;  4J8W C;  4ZUX A;  5CP6 D;  3AZJ A;  5B2J A;  3W98 C;  1EQZ B;  3WA9 B;  3WTP D;  1S32 C;  2BYK B;  1Q9C A;  4KGC C;  1BH8 B;  5CPK B;  4UUZ B;  3UT9 D;  5BO0 A;  3UTA D;  3AZE D;  1P3L B;  1P3P C;  2F8N A;  3WAA C;  3KUY C;  2F8N K;  4DRA A;  5GXQ A;  3AZF C;  3KWQ B;  3X1S C;  3LZ0 B;  3X1T C;  1B67 A;  4Z5T B;  5B32 A;  3MNN D;  2L5A A;  3C1C A;  3X1V D;  3V9R B;  5GT0 B;  1EQZ C;  3WA9 C;  3W96 D;  4YS3 D;  2CWE A;  1P3O A;  5AV8 B;  5KDM A;  3X1U A;  5JRG D;  5CPK C;  5BNX B;  3TU4 A;  2PYO A;  1P3L C;  1P34 B;  3AZH B;  3KWQ C;  3KXB D;  1KX5 B;  3LZ0 C;  5BNV A;  3AZL A;  3A6N B;  2ARO D;  3REH A;  1F1E A;  5AV9 C;  4JJN D;  1JFI A;  5GT0 C;  4R8P A;  5DNM B;  5AY8 C;  2YFW A;  3AZI B;  3AN2 C;  4LD9 C;  3C1B B;  4J8V A;  5AV8 C;  4H9N A;  5BS7 A;  1ZLA D;  5B1L D;  2CV5 B;  5B40 B;  4H9S C;  2NZD D;  4XZQ C;  3AV2 D;  5E5A D;  4CAY B;  1KX3 D;  4E45 A;  3REI C;  1P3G C;  3B6G D;  4J8W D;  3W98 D;  3AZM C;  5DNM C;  4AWL B;  1S32 D;  5B1M A;  5FUG A;  3W97 A;  1P3P D;  3W99 B;  3KUY D;  5B24 A;  3AZK A;  3WAA D;  5CP6 A;  3AZF D;  3WTP A;  3X1S D;  3X1T D;  1AOI C;  4YS3 B;  3NQU B;  3AYW B;  3UT9 A;  3UTA A;  3AZE A;  5F99 B;  1EQZ D;  4Z2M G;  5JRG B;  4AWL C;  3AZN B;  3WA9 D;  2NQB B;  1N1J B;  1P3M A;  5CPK D;  1M18 B;  2YFV A;  4YM6 C;  3W99 C;  3MGR C;  3KXB B;  5B0Y B;  4KHA B;  3MNN A;  1P3L D;  3X1V A;  5JA4 B;  2RVQ C;  5BT1 C;  3W96 A;  3KWQ D;  3LZ0 D;  1F66 B;  5CPI B;  2LY8 A;  5AV9 D;  4G92 B;  3AYW C;  5B33 C;  5CPJ B;  5DNN B;  5GT0 D;  5F99 C;  5AY8 D;  3NQJ A;  3AZN C;  4LD9 D;  2NQB C;  5AV8 D;  1M1A B;  3MVD C;  5B31 G;  5G49 B;  3B0C T;  1M18 C;  3AFA C;  2ARO A;  5B31 C;  2NZD B;  4JJN A;  3AV2 B;  1HQ3 C;  1KX3 B;  3W98 B;  4XZQ D;  1F66 C;  5AV5 A;  5CPI C;  4H9Q A;  3REI D;  4G92 C;  1P3K B;  1ZLA A;  3B0B A;  5CPJ C;  5B1L A;  5DNN C;  3AZM D;  4KGC B;  5DNM D;  1P3B C;  3AV1 C;  5C3I B;  3C1B D;  1M1A C;  3REK C;  2FJ7 C;  1H3O A;  2BYM B;  4NFT A;  5E5A A;  3B6G A;  3WTP E;  5B40 D;  4J8W A;  5B2I A;  4H9R A;  4G91 C;  3LZ1 B;  1S32 A;  1AOI D;  4WU9 B;  1U35 A;  3MGP A;  4WNN B;  1M19 B;  1P3K C;  1P3P A;  1ID3 B;  3KUY A;  3WAA A;  5B0Z C;  5C3I C;  3AZF A;  3X1S A;  1P3M B;  4CSR B;  5AVC A;  3X1T A;  5AVB B;  4YM6 D;  3W99 D;  3REJ C;  4J8U B;  3R45 B;  3B6F B;  4J8X B;  2RVQ D;  5BT1 D;  1EQZ A;  3WA9 A;  3LZ1 C;  5AV9 B;  2BYK A;  4WU9 C;  5AY8 B;  1BH8 A;  3AN2 B;  5CPK A;  4UUZ A;  4LD9 B;  3AYW D;  1M19 C;  5B33 D;  5F99 D;  1P3L A;  1ID3 C;  3AZJ C;  3AZN D;  5B2J C;  2HIO B;  2NQB D;  3MVD D;  3KWQ A;  3LZ0 A;  1M18 D;  2F8N G;  5AVB C;  4Z5T A;  5B0Y D;  4J8U C;  4XZQ B;  3B6F C;  1HQ3 D;  3V9R A;  5GT0 A;  4J8X C;  3REI B;  1P3G B;  1F66 D;  5AV8 A;  5CPI D;  4NE3 A;  3AZM B;  3MGS B;  3LJA B;  2IO5 B;  5BNX A;  5CPJ D;  1BH9 B;  5DNN D;  3C1C C;  1KX4 B;  1P3B D;  3AV1 D;  2HIO C;  1P34 A;  3REK D;  3AZH A;  1M1A D;  4H9S A;  1KX5 A;  2FJ7 D;  1P3O C;  3X1U C;  3A6N A;  3LEL B;  2PYO C;  1AOI B;  5DNM A;  3AZI A;  4WZS B;  3C1B A;  4H9O B;  3MGS C;  3LJA C;  2IO5 C;  1P3K D;  4KGC D;  5CHL B;  5GSU B;  2CV5 A;  1P3I B;  5B0Z D;  5B40 A;  1KX4 C;  4YM6 B;  4M6B A;  3MGR B;  4Z66 A;  4J8V C;  3LEL C;  4CAY A;  2HUE B;  1ULY A;  3LZ1 D;  5B33 B;  4WU9 D;  1M19 D;  3MVD B;  3W99 A;  1ID3 D;  5GSU C;  3AZJ D;  5B2J D;  1P3I C;  4QLC B;  3AFA B;  1TAF B;  3REL B;  5B31 B;  1HQ3 B;  5AVB D;  4J8U D;  4YS3 A;  2HUE C;  1HTA A;  3NQU A;  3AYW A;  3W97 C;  2F8N D;  5AV6 B;  4WU8 B;  3B6F D;  4J8X D;  5F99 A;  5JRG A;  3AZN A;  2NQB A;  3WTP C;  3MGQ B;  1R4V A;  1N1J A;  1P3B B;  3AN2 D;  3AV1 B;  1M18 A;  3REK B;  2FJ7 B;  3C1C D;  3KXB A;  5B0Y A;  4KHA A;  4KUD B;  4ZBJ B;  1TZY B;  1P3A B;  2HIO D;  4QLC C;  5JA4 A;  1P3F B;  3WKJ B;  3REL C;  1P3O D;  4H9P B;  1F66 A;  5CPI A;  4G91 B;  1P3M C;  2PYO D;  5AV6 C;  4WU8 C;  5CPJ A;  5DNN A;  1P3G D;  1M1A A;  3AZG B;  4NE6 A;  3MGQ C;  5G49 A;  5B0Z B;  3MGS D;  3LJA D;  1KX4 D;  4KUD C;  4ZBJ C;  1TZY C;  1P3A C;  2NZD A;  3AV2 A;  1P3F C;  3REJ B;  3WKJ C;  1KX3 A;  4J8V D;  3O62 B;  3W98 A;  3LEL D;  4X23 B;  4HGA C;  5GT3 B;  1P3K A;  4XUJ B;  4KGC A;  3UTB B;  4Z2M H;  4JJN C;  1B6W A;  3AZG C;  4ZUX B;  3AZJ B;  1U35 B;  2BYM A;  5B2J B;  5AV5 C;  5GSU D;  1P3I D;  1ZLA C;  2JSS A;  4E44 A;  3MGR D;  3LZ1 A;  5BO0 B;  3O62 C;  2F8N B;  4WU9 A;  4X23 C;  3B0D C;  4WNN A;  5GXQ B;  3W97 D;  3VH5 W;  5GT3 C;  1M19 A;  4XUJ C;  1ID3 A;  3UTB C;  5B2I C;  5B32 B;  3C1C B;  4ZUX C;  1U35 C;  4CSR A;  3MGP C;  5AVB A;  4J8U A;  1P3O B;  3KSY A;  5KDM B;  3X1U B;  3R45 A;  3B6F A;  4QLC D;  4J8X A;  3AFA D;  3REL D;  5B31 D;  3TU4 B;  2PYO B;  5AV9 A;  1P3M D;  5AVC C;  5AY8 A;  3AN2 A;  5GXQ C;  5B32 G;  4LD9 A;  5AV6 D;  4WU8 D;  5BNV B;  3AZL B;  5B32 C;  2HIO A;  3REH B;  3MGQ D;  3VH5 A;  1JFI B;  4R8P B;  2YFW B;  4J8V B;  4KUD D;  1TZY D;  4XZQ A;  1P3A D;  3VH6 W;  1P3F D;  4H9N B;  3WKJ D;  3TU4 C;  3REI A;  1P3G A;  3AZM A;  1KU5 A;  4Z5T C;  4EO5 B;  3LJA A;  3MGS A;  1BH9 A;  3AZL C;  1KX4 A;  3REH C;  3AZG D;  5AV5 D;  3B0C W;  4R8P C;  3LEL A;  1AOI A;  4NE5 A;  3REJ D;  5B1M B;  5BS7 C;  5FUG B;  3W97 B;  1P34 C;  1WWS A;  3O62 D;  3AZH C;  1KX5 C;  4Z66 B;  5B24 B;  3AZK B;  4H9O A;  4X23 D;  1A7W A;  5CP6 B;  3VH6 A;  3A6N C;  4EO5 C;  5GT3 D;  3WTP B;  1BFM A;  4XUJ D;  3VH5 T;  3UTB D;  5B2I D;  5GSU A;  1P3I A;  4YM6 A;  3AZI C;  3MGR A;  3UT9 B;  4ZUX D;  3C1B C;  1U35 D;  3UTA B;  3MGP D;  3AZE B;  2F8N H;  4WV4 B;  1WWI A;  2CV5 C; 
#chains in the Genus database with same CATH topology
 5B40 C;  2YFV B;  3F6T A;  5B1M C;  5B33 A;  3MNN B;  5B24 C;  4Z66 C;  3AZK C;  5AVC D;  5CP6 C;  3X1V B;  5GXQ D;  3W96 B;  3MVD A;  2G5I C;  5B32 D;  4QLC A;  3AFA A;  1TAF A;  3REL A;  5B31 A;  3UT9 C;  3UTA C;  3AZE C;  1HQ3 A;  3NQJ B;  3X1U D;  5AV6 A;  4WU8 A;  3VH6 T;  4HGA B;  3TU4 D;  2ARO B;  3MNN C;  3MGQ A;  4JJN B;  3X1V C;  1P3B A;  4Z5T D;  3AV1 A;  3W96 C;  4YS3 C;  3REK A;  2FJ7 A;  3AL0 C;  5AV5 B;  3AZL D;  4KUD A;  1TZY A;  1P3A A;  4H9Q B;  5JRG C;  3REH D;  1P3F A;  3WKJ A;  1ZLA B;  5B1L B;  4H9P A;  4R8P D;  3KXB C;  5B0Y C;  1H3O B;  3B0D B;  5E5A B;  1P34 D;  3AZH D;  2ARO C;  1KX5 D;  4DRB A;  3B6G B;  3AZG A;  4J8W B;  5B2I B;  5B0Z A;  4H9R B;  3A6N D;  1S32 B;  3MGP B;  3AZI D;  2Y2P A;  3REJ A;  5B1L C;  1P3P B;  3O62 A;  3KUY B;  3WAA B;  4X23 A;  2Y2M A;  5GT3 A;  3AZF B;  3X1S B;  4XUJ A;  2CV5 D;  5AVC B;  3X1T B;  2Y2I A;  2NZD C;  3UTB A;  5B1M D;  3IP4 C;  5E5A C;  3AV2 C;  5B24 D;  4Z66 D;  3AZK D;  1KX3 C;  3B6G C;  4J8W C;  4ZUX A;  5CP6 D;  3AZJ A;  5B2J A;  3W98 C;  1EQZ B;  3WA9 B;  3WTP D;  4DQY B;  1S32 C;  2BYK B;  1Q9C A;  4KGC C;  1BH8 B;  5CPK B;  4UUZ B;  3UT9 D;  5BO0 A;  3UTA D;  3AZE D;  1P3L B;  1P3P C;  2F8N A;  3WAA C;  3KUY C;  2F8N K;  4DRA A;  5GXQ A;  3AZF C;  3KWQ B;  3X1S C;  3LZ0 B;  3X1T C;  1B67 A;  4Z5T B;  5B32 A;  3MNN D;  2L5A A;  2Y2N A;  3C1C A;  3X1V D;  3V9R B;  5GT0 B;  1EQZ C;  3WA9 C;  3EPJ A;  3W96 D;  4YS3 D;  2CWE A;  1P3O A;  5AV8 B;  5KDM A;  3X1U A;  5JRG D;  5CPK C;  5BNX B;  3TU4 A;  2PYO A;  1P3L C;  1P34 B;  3AZH B;  3KWQ C;  3KXB D;  1KX5 B;  3LZ0 C;  5BNV A;  3AZL A;  3A6N B;  2ARO D;  3REH A;  1F1E A;  5AV9 C;  4JJN D;  1JFI A;  5GT0 C;  4R8P A;  5DNM B;  5AY8 C;  2YFW A;  3AZI B;  3AN2 C;  4LD9 C;  3C1B B;  4J8V A;  5AV8 C;  3KFU G;  4H9N A;  5BS7 A;  1ZLA D;  5B1L D;  2CV5 B;  5B40 B;  4H9S C;  2NZD D;  4XZQ C;  3AV2 D;  5E5A D;  4CAY B;  1KX3 D;  4E45 A;  3REI C;  2ZY5 A;  1P3G C;  4J8W D;  3B6G D;  3W98 D;  3AZM C;  5DNM C;  4AWL B;  1S32 D;  5B1M A;  5FUG A;  3W97 A;  1P3P D;  3W99 B;  3KUY D;  5B24 A;  3AZK A;  3WAA D;  3EPH A;  5CP6 A;  3AZF D;  3WTP A;  3X1S D;  3X1T D;  1AOI C;  4YS3 B;  3NQU B;  3AYW B;  3UT9 A;  3UTA A;  3AZE A;  5F99 B;  1PZR A;  4Z2M G;  5JRG B;  4AWL C;  3AZN B;  1EQZ D;  3WA9 D;  3A1K A;  2NQB B;  2ZM5 A;  1N1J B;  1P3M A;  5CPK D;  1M18 B;  2YFV A;  4YM6 C;  3W99 C;  3MGR C;  3KXB B;  5B0Y B;  4KHA B;  3MNN A;  1P3L D;  2J8P A;  3X1V A;  5JA4 B;  2RVQ C;  5BT1 C;  3W96 A;  3KWQ D;  3LZ0 D;  1F66 B;  5CPI B;  2LY8 A;  2XD5 A;  5AV9 D;  4G92 B;  3AYW C;  5B33 C;  5CPJ B;  5DNN B;  5GT0 D;  5F99 C;  5AY8 D;  3NQJ A;  3AZN C;  4LD9 D;  2NQB C;  5AV8 D;  1M1A B;  3MVD C;  5B31 G;  5G49 B;  2Y2H A;  3B0C T;  1M18 C;  3AFA C;  2ARO A;  3H0L C;  5B31 C;  2NZD B;  4JJN A;  3AV2 B;  1HQ3 C;  3EPK A;  1KX3 B;  3W98 B;  2JE5 A;  4XZQ D;  5AV5 A;  5CPI C;  1F66 C;  2DF4 C;  4H9Q A;  3REI D;  4G92 C;  1P3K B;  1ZLA A;  3B0B A;  5CPJ C;  5B1L A;  5DNN C;  3AZM D;  4KGC B;  5DNM D;  1P3B C;  3AV1 C;  5C3I B;  3C1B D;  1M1A C;  3REK C;  2FJ7 C;  1H3O A;  2BYM B;  4NFT A;  5E5A A;  1W2E A;  3B6G A;  3WTP E;  5B40 D;  4J8W A;  5B2I A;  4H9R A;  4G91 C;  3LZ1 B;  3EPL A;  1S32 A;  1AOI D;  4WU9 B;  1U35 A;  3MGP A;  4WNN B;  1M19 B;  2ZY4 A;  1P3K C;  1P3P A;  1ID3 B;  3KUY A;  3WAA A;  5B0Z C;  5C3I C;  3AZF A;  3X1S A;  1P3M B;  4CSR B;  5AVC A;  3X1T A;  5AVB B;  4YM6 D;  3W99 D;  3REJ C;  4J8U B;  3R45 B;  3B6F B;  4J8X B;  2RVQ D;  5BT1 D;  1EQZ A;  3WA9 A;  3LZ1 C;  5AV9 B;  2BYK A;  4WU9 C;  3A1I A;  5AY8 B;  1BH8 A;  3AN2 B;  5CPK A;  4UUZ A;  4LD9 B;  3AYW D;  1M19 C;  5B33 D;  5F99 D;  1P3L A;  1ID3 C;  3AZJ C;  3AZN D;  5B2J C;  2HIO B;  2NQB D;  3MVD D;  3KWQ A;  3LZ0 A;  1M18 D;  2F8N G;  5AVB C;  4Z5T A;  5B0Y D;  4J8U C;  4XZQ B;  3B6F C;  1HQ3 D;  3V9R A;  5GT0 A;  2Y2J A;  4J8X C;  2VQR A;  3REI B;  1P3G B;  1F66 D;  5AV8 A;  5CPI D;  4NE3 A;  3AZM B;  3MGS B;  3LJA B;  2IO5 B;  5BNX A;  5CPJ D;  1BH9 B;  5DNN D;  3C1C C;  1KX4 B;  1P3B D;  3AV1 D;  3FDD A;  2HIO C;  1P34 A;  3REK D;  3AZH A;  1M1A D;  4H9S A;  1KX5 A;  2FJ7 D;  2FFF B;  1P3O C;  3X1U C;  3A6N A;  3LEL B;  2UWX A;  2PYO C;  1AOI B;  5DNM A;  3AZI A;  4WZS B;  3C1B A;  4H9O B;  3MGS C;  3LJA C;  2IO5 C;  1P3K D;  4KGC D;  5CHL B;  5GSU B;  2CV5 A;  1P3I B;  5B0Z D;  5B40 A;  1KX4 C;  4YM6 B;  4M6B A;  3MGR B;  4Z66 A;  4J8V C;  2W8S A;  3LEL C;  4CAY A;  2HUE B;  2ZY2 A;  1ULY A;  3LZ1 D;  5B33 B;  4WU9 D;  1M19 D;  3MVD B;  3W99 A;  1ID3 D;  5GSU C;  3AZJ D;  5B2J D;  1P3I C;  4QLC B;  3AFA B;  1TAF B;  3REL B;  5B31 B;  1HQ3 B;  5AVB D;  4J8U D;  4YS3 A;  2HUE C;  1HTA A;  3NQU A;  3AYW A;  3W97 C;  2F8N D;  5AV6 B;  4WU8 B;  3B6F D;  4J8X D;  5F99 A;  5JRG A;  3AZN A;  1Z2C B;  2NQB A;  3WTP C;  3MGQ B;  1R4V A;  1N1J A;  1P3B B;  3AN2 D;  3AV1 B;  1M18 A;  3REK B;  2FJ7 B;  3C1C D;  3KXB A;  5B0Y A;  4KHA A;  4KUD B;  4ZBJ B;  1TZY B;  1P3A B;  2HIO D;  4QLC C;  5JA4 A;  1P3F B;  3WKJ B;  3REL C;  2Y2Q A;  1P3O D;  4H9P B;  1F66 A;  2BG1 A;  5CPI A;  4G91 B;  1P3M C;  4WJ3 C;  2PYO D;  5AV6 C;  4WU8 C;  5CPJ A;  5DNN A;  1P3G D;  1M1A A;  3AZG B;  4NE6 A;  3MGQ C;  5G49 A;  5B0Z B;  3H0R C;  3MGS D;  3LJA D;  2JCH A;  1KX4 D;  4KUD C;  4ZBJ C;  1TZY C;  1P3A C;  2NZD A;  3AV2 A;  1P3F C;  3REJ B;  3WKJ C;  1KX3 A;  4J8V D;  3O62 B;  3W98 A;  3LEL D;  4X23 B;  4HGA C;  5GT3 B;  2ZY3 A;  1P3K A;  4XUJ B;  4KGC A;  3UTB B;  4Z2M H;  4JJN C;  1B6W A;  3AZG C;  2Y2G A;  4ZUX B;  3AZJ B;  2BYM A;  5B2J B;  5AV5 C;  1U35 B;  5GSU D;  1P3I D;  1ZLA C;  2Y2O A;  2JSS A;  4E44 A;  3MGR D;  3LZ1 A;  5BO0 B;  3O62 C;  2F8N B;  4WU9 A;  4X23 C;  3B0D C;  4WNN A;  5GXQ B;  3W97 D;  3VH5 W;  5GT3 C;  1M19 A;  4XUJ C;  4UPK A;  1ID3 A;  3UTB C;  5B2I C;  3EG5 B;  5B32 B;  3C1C B;  3P5J B;  4ZUX C;  1U35 C;  4CSR A;  3MGP C;  5AVB A;  4J8U A;  1P3O B;  3KSY A;  5KDM B;  3X1U B;  3R45 A;  3B6F A;  4QLC D;  4J8X A;  3AFA D;  3REL D;  5B31 D;  3TU4 B;  2PYO B;  5AV9 A;  1P3M D;  5AVC C;  5AY8 A;  2G5H C;  3AN2 A;  5GXQ C;  5B32 G;  4LD9 A;  5AV6 D;  4WU8 D;  5BNV B;  3AZL B;  5B32 C;  2HIO A;  3REH B;  3MGQ D;  3VH5 A;  1JFI B;  2Y2K A;  4R8P B;  2YFW B;  4J8V B;  4KUD D;  1TZY D;  4XZQ A;  1P3A D;  3VH6 W;  1P3F D;  4H9N B;  3WKJ D;  3TU4 C;  3REI A;  1P3G A;  3AZM A;  2XD1 A;  1KU5 A;  4Z5T C;  4EO5 B;  3LJA A;  3MGS A;  1BH9 A;  3AZL C;  1KX4 A;  2F2A C;  3REH C;  3AZG D;  5AV5 D;  3B0C W;  4R8P C;  3LEL A;  2RIQ A;  1AOI A;  4NE5 A;  3REJ D;  5B1M B;  5BS7 C;  5FUG B;  3W97 B;  1P34 C;  1WWS A;  3O62 D;  3AZH C;  1KX5 C;  4Z66 B;  5B24 B;  3AZK B;  4H9O A;  4X23 D;  1A7W A;  5CP6 B;  1T3U A;  3VH6 A;  4EO5 C;  5GT3 D;  3WTP B;  3A6N C;  1BFM A;  4XUJ D;  3VH5 T;  2Y2L A;  3UTB D;  5B2I D;  5GSU A;  1P3I A;  4YM6 A;  3AZI C;  2DQN C;  3MGR A;  3UT9 B;  4ZUX D;  3C1B C;  1U35 D;  3UTA B;  3MGP D;  3AZE B;  2F8N H;  4WV4 B;  3H0M C;  1WWI A;  2CV5 C; 
#chains in the Genus database with same CATH homology
 5B40 C;  2YFV B;  3F6T A;  5B1M C;  5B33 A;  3MNN B;  5B24 C;  4Z66 C;  3AZK C;  5AVC D;  5CP6 C;  3X1V B;  5GXQ D;  3W96 B;  3MVD A;  2G5I C;  5B32 D;  4QLC A;  3AFA A;  1TAF A;  3REL A;  5B31 A;  3UT9 C;  3UTA C;  3AZE C;  1HQ3 A;  3NQJ B;  3X1U D;  5AV6 A;  4WU8 A;  3VH6 T;  4HGA B;  3TU4 D;  2ARO B;  3MNN C;  3MGQ A;  4JJN B;  3X1V C;  1P3B A;  4Z5T D;  3AV1 A;  3W96 C;  4YS3 C;  3REK A;  2FJ7 A;  3AL0 C;  5AV5 B;  3AZL D;  4KUD A;  1TZY A;  1P3A A;  4H9Q B;  5JRG C;  3REH D;  1P3F A;  3WKJ A;  1ZLA B;  5B1L B;  4H9P A;  4R8P D;  3KXB C;  5B0Y C;  1H3O B;  3B0D B;  5E5A B;  1P34 D;  3AZH D;  2ARO C;  1KX5 D;  4DRB A;  3B6G B;  3AZG A;  4J8W B;  5B2I B;  5B0Z A;  4H9R B;  3A6N D;  1S32 B;  3MGP B;  3AZI D;  2Y2P A;  3REJ A;  5B1L C;  1P3P B;  3O62 A;  3KUY B;  3WAA B;  4X23 A;  2Y2M A;  5GT3 A;  3AZF B;  3X1S B;  4XUJ A;  2CV5 D;  5AVC B;  3X1T B;  2Y2I A;  2NZD C;  3UTB A;  5B1M D;  3IP4 C;  5E5A C;  3AV2 C;  5B24 D;  4Z66 D;  3AZK D;  1KX3 C;  3B6G C;  4J8W C;  4ZUX A;  5CP6 D;  3AZJ A;  5B2J A;  3W98 C;  1EQZ B;  3WA9 B;  3WTP D;  4DQY B;  1S32 C;  2BYK B;  1Q9C A;  4KGC C;  1BH8 B;  5CPK B;  4UUZ B;  3UT9 D;  5BO0 A;  3UTA D;  3AZE D;  1P3L B;  1P3P C;  2F8N A;  3WAA C;  3KUY C;  2F8N K;  4DRA A;  5GXQ A;  3AZF C;  3KWQ B;  3X1S C;  3LZ0 B;  3X1T C;  1B67 A;  4Z5T B;  5B32 A;  3MNN D;  2L5A A;  2Y2N A;  3C1C A;  3X1V D;  3V9R B;  5GT0 B;  1EQZ C;  3WA9 C;  3EPJ A;  3W96 D;  4YS3 D;  2CWE A;  1P3O A;  5AV8 B;  5KDM A;  3X1U A;  5JRG D;  5CPK C;  5BNX B;  3TU4 A;  2PYO A;  1P3L C;  1P34 B;  3AZH B;  3KWQ C;  3KXB D;  1KX5 B;  3LZ0 C;  5BNV A;  3AZL A;  3A6N B;  2ARO D;  3REH A;  1F1E A;  5AV9 C;  4JJN D;  1JFI A;  5GT0 C;  4R8P A;  5DNM B;  5AY8 C;  2YFW A;  3AZI B;  3AN2 C;  4LD9 C;  3C1B B;  4J8V A;  5AV8 C;  3KFU G;  4H9N A;  5BS7 A;  1ZLA D;  5B1L D;  2CV5 B;  5B40 B;  4H9S C;  2NZD D;  4XZQ C;  3AV2 D;  5E5A D;  4CAY B;  1KX3 D;  4E45 A;  3REI C;  2ZY5 A;  1P3G C;  4J8W D;  3B6G D;  3W98 D;  3AZM C;  5DNM C;  4AWL B;  1S32 D;  5B1M A;  5FUG A;  3W97 A;  1P3P D;  3W99 B;  3KUY D;  5B24 A;  3AZK A;  3WAA D;  3EPH A;  5CP6 A;  3AZF D;  3WTP A;  3X1S D;  3X1T D;  1AOI C;  4YS3 B;  3NQU B;  3AYW B;  3UT9 A;  3UTA A;  3AZE A;  5F99 B;  1PZR A;  4Z2M G;  5JRG B;  4AWL C;  3AZN B;  1EQZ D;  3WA9 D;  3A1K A;  2NQB B;  2ZM5 A;  1N1J B;  1P3M A;  5CPK D;  1M18 B;  2YFV A;  4YM6 C;  3W99 C;  3MGR C;  3KXB B;  5B0Y B;  4KHA B;  3MNN A;  1P3L D;  2J8P A;  3X1V A;  5JA4 B;  2RVQ C;  5BT1 C;  3W96 A;  3KWQ D;  3LZ0 D;  1F66 B;  5CPI B;  2LY8 A;  2XD5 A;  5AV9 D;  4G92 B;  3AYW C;  5B33 C;  5CPJ B;  5DNN B;  5GT0 D;  5F99 C;  5AY8 D;  3NQJ A;  3AZN C;  4LD9 D;  2NQB C;  5AV8 D;  1M1A B;  3MVD C;  5B31 G;  5G49 B;  2Y2H A;  3B0C T;  1M18 C;  3AFA C;  2ARO A;  3H0L C;  5B31 C;  2NZD B;  4JJN A;  3AV2 B;  1HQ3 C;  3EPK A;  1KX3 B;  3W98 B;  2JE5 A;  4XZQ D;  5AV5 A;  5CPI C;  1F66 C;  2DF4 C;  4H9Q A;  3REI D;  4G92 C;  1P3K B;  1ZLA A;  3B0B A;  5CPJ C;  5B1L A;  5DNN C;  3AZM D;  4KGC B;  5DNM D;  1P3B C;  3AV1 C;  5C3I B;  3C1B D;  1M1A C;  3REK C;  2FJ7 C;  1H3O A;  2BYM B;  4NFT A;  5E5A A;  1W2E A;  3B6G A;  3WTP E;  5B40 D;  4J8W A;  5B2I A;  4H9R A;  4G91 C;  3LZ1 B;  3EPL A;  1S32 A;  1AOI D;  4WU9 B;  1U35 A;  3MGP A;  4WNN B;  1M19 B;  2ZY4 A;  1P3K C;  1P3P A;  1ID3 B;  3KUY A;  3WAA A;  5B0Z C;  5C3I C;  3AZF A;  3X1S A;  1P3M B;  4CSR B;  5AVC A;  3X1T A;  5AVB B;  4YM6 D;  3W99 D;  3REJ C;  4J8U B;  3R45 B;  3B6F B;  4J8X B;  2RVQ D;  5BT1 D;  1EQZ A;  3WA9 A;  3LZ1 C;  5AV9 B;  2BYK A;  4WU9 C;  3A1I A;  5AY8 B;  1BH8 A;  3AN2 B;  5CPK A;  4UUZ A;  4LD9 B;  3AYW D;  1M19 C;  5B33 D;  5F99 D;  1P3L A;  1ID3 C;  3AZJ C;  3AZN D;  5B2J C;  2HIO B;  2NQB D;  3MVD D;  3KWQ A;  3LZ0 A;  1M18 D;  2F8N G;  5AVB C;  4Z5T A;  5B0Y D;  4J8U C;  4XZQ B;  3B6F C;  1HQ3 D;  3V9R A;  5GT0 A;  2Y2J A;  4J8X C;  2VQR A;  3REI B;  1P3G B;  1F66 D;  5AV8 A;  5CPI D;  4NE3 A;  3AZM B;  3MGS B;  3LJA B;  2IO5 B;  5BNX A;  5CPJ D;  1BH9 B;  5DNN D;  3C1C C;  1KX4 B;  1P3B D;  3AV1 D;  3FDD A;  2HIO C;  1P34 A;  3REK D;  3AZH A;  1M1A D;  4H9S A;  1KX5 A;  2FJ7 D;  2FFF B;  1P3O C;  3X1U C;  3A6N A;  3LEL B;  2UWX A;  2PYO C;  1AOI B;  5DNM A;  3AZI A;  4WZS B;  3C1B A;  4H9O B;  3MGS C;  3LJA C;  2IO5 C;  1P3K D;  4KGC D;  5CHL B;  5GSU B;  2CV5 A;  1P3I B;  5B0Z D;  5B40 A;  1KX4 C;  4YM6 B;  4M6B A;  3MGR B;  4Z66 A;  4J8V C;  2W8S A;  3LEL C;  4CAY A;  2HUE B;  2ZY2 A;  1ULY A;  3LZ1 D;  5B33 B;  4WU9 D;  1M19 D;  3MVD B;  3W99 A;  1ID3 D;  5GSU C;  3AZJ D;  5B2J D;  1P3I C;  4QLC B;  3AFA B;  1TAF B;  3REL B;  5B31 B;  1HQ3 B;  5AVB D;  4J8U D;  4YS3 A;  2HUE C;  1HTA A;  3NQU A;  3AYW A;  3W97 C;  2F8N D;  5AV6 B;  4WU8 B;  3B6F D;  4J8X D;  5F99 A;  5JRG A;  3AZN A;  1Z2C B;  2NQB A;  3WTP C;  3MGQ B;  1R4V A;  1N1J A;  1P3B B;  3AN2 D;  3AV1 B;  1M18 A;  3REK B;  2FJ7 B;  3C1C D;  3KXB A;  5B0Y A;  4KHA A;  4KUD B;  4ZBJ B;  1TZY B;  1P3A B;  2HIO D;  4QLC C;  5JA4 A;  1P3F B;  3WKJ B;  3REL C;  2Y2Q A;  1P3O D;  4H9P B;  1F66 A;  2BG1 A;  5CPI A;  4G91 B;  1P3M C;  4WJ3 C;  2PYO D;  5AV6 C;  4WU8 C;  5CPJ A;  5DNN A;  1P3G D;  1M1A A;  3AZG B;  4NE6 A;  3MGQ C;  5G49 A;  5B0Z B;  3H0R C;  3MGS D;  3LJA D;  2JCH A;  1KX4 D;  4KUD C;  4ZBJ C;  1TZY C;  1P3A C;  2NZD A;  3AV2 A;  1P3F C;  3REJ B;  3WKJ C;  1KX3 A;  4J8V D;  3O62 B;  3W98 A;  3LEL D;  4X23 B;  4HGA C;  5GT3 B;  2ZY3 A;  1P3K A;  4XUJ B;  4KGC A;  3UTB B;  4Z2M H;  4JJN C;  1B6W A;  3AZG C;  2Y2G A;  4ZUX B;  3AZJ B;  2BYM A;  5B2J B;  5AV5 C;  1U35 B;  5GSU D;  1P3I D;  1ZLA C;  2Y2O A;  2JSS A;  4E44 A;  3MGR D;  3LZ1 A;  5BO0 B;  3O62 C;  2F8N B;  4WU9 A;  4X23 C;  3B0D C;  4WNN A;  5GXQ B;  3W97 D;  3VH5 W;  5GT3 C;  1M19 A;  4XUJ C;  4UPK A;  1ID3 A;  3UTB C;  5B2I C;  3EG5 B;  5B32 B;  3C1C B;  3P5J B;  4ZUX C;  1U35 C;  4CSR A;  3MGP C;  5AVB A;  4J8U A;  1P3O B;  3KSY A;  5KDM B;  3X1U B;  3R45 A;  3B6F A;  4QLC D;  4J8X A;  3AFA D;  3REL D;  5B31 D;  3TU4 B;  2PYO B;  5AV9 A;  1P3M D;  5AVC C;  5AY8 A;  2G5H C;  3AN2 A;  5GXQ C;  5B32 G;  4LD9 A;  5AV6 D;  4WU8 D;  5BNV B;  3AZL B;  5B32 C;  2HIO A;  3REH B;  3MGQ D;  3VH5 A;  1JFI B;  2Y2K A;  4R8P B;  2YFW B;  4J8V B;  4KUD D;  1TZY D;  4XZQ A;  1P3A D;  3VH6 W;  1P3F D;  4H9N B;  3WKJ D;  3TU4 C;  3REI A;  1P3G A;  3AZM A;  2XD1 A;  1KU5 A;  4Z5T C;  4EO5 B;  3LJA A;  3MGS A;  1BH9 A;  3AZL C;  1KX4 A;  2F2A C;  3REH C;  3AZG D;  5AV5 D;  3B0C W;  4R8P C;  3LEL A;  2RIQ A;  1AOI A;  4NE5 A;  3REJ D;  5B1M B;  5BS7 C;  5FUG B;  3W97 B;  1P34 C;  1WWS A;  3O62 D;  3AZH C;  1KX5 C;  4Z66 B;  5B24 B;  3AZK B;  4H9O A;  4X23 D;  1A7W A;  5CP6 B;  1T3U A;  3VH6 A;  4EO5 C;  5GT3 D;  3WTP B;  3A6N C;  1BFM A;  4XUJ D;  3VH5 T;  2Y2L A;  3UTB D;  5B2I D;  5GSU A;  1P3I A;  4YM6 A;  3AZI C;  2DQN C;  3MGR A;  3UT9 B;  4ZUX D;  3C1B C;  1U35 D;  3UTA B;  3MGP D;  3AZE B;  2F8N H;  4WV4 B;  3H0M C;  1WWI A;  2CV5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...