3AZJA

Crystal structure of human nucleosome core particle containing h4k44q mutation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azjA00
4JJND 2NQBA 2HUEB 5B24C 1P3KD 3WA9A 3W99A 5AY8D 5B1LD 3UTBA 3KXBC 5JRGA 4J8WC 5B1MB 1S32D 3WTPA 5B31A 3WAAA 4WU9D 4M6BA 5AV8A 3AZHB 3MGRC 3UT9D 5BT1C 3AZLB 5AV9D 4XZQC 5B40A 4H9NA 5DNMD 4AWLC 1AOIA 1P3FD 5FUGB 5B0ZB 3X1UD 3AZJC 1F66A 3WKJB 3AFAD 3AZFC 4E45A 3O62A 5B33C 2AROD 2L5AA 2F8ND 3NQUA 3B0BA 4XZQB 1HQ3A 5DNNA 1P3LC 5B24B 3AZEC 5AVCD 3LJAC 1H3OA 5BO0B 1KX5D 2BYKB 3R45B 3C1BD 4H9PB 4XUJA 3WAAC 3MVDB 5B1LB 3X1VC 4ZUXC 3MNNC 1HQ3B 5DNNB 3AZMB 4QLCC 3AZMD 3REJC 4ZBJB 3B0DB 1P3IC 1P3KC 4Z5TC 1KX4C 4Z5TB 3REKA 5GXQD 3MGPC 3AZJA 4KUDC 5B40B 5B0YC 3VH6T 4E44A 5B2JA 3A6ND 3AZNA 2JSSA 1KX5B 4KHAA 3VH6A 3AZIA 1M19A 1EQZC 1U35A 3WTPB 1P3LA 2YFWB 4LD9A 3X1SD 5BS7C 5JRGB 2NQBB 5E5AA 2LY8A 4HGAB 1P3MC 5B33D 4EO5C 3AFAB 3AZGC 4X23B 1P3FB 3UTAA 4YS3C 5GT0B 4NE3A 3MNNA 4H9RA 5AV8C 2PYOC 3REJA 1P34B 4J8VB 5GT0D 3REIA 1P3OA 3NQJB 2CWEA 3MGPA 2NZDB 4H9SC 4YM6C 4CSRB 3LELC 3V9RB 4CAYB 3W98A 4CSRA 5JRGD 5AVBD 1S32A 1P3PB 3X1SB 3A6NB 5B31D 4KGCB 3KUYA 5CPKA 1P3ID 4Z5TD 1KX4D 3AZKA 3TU4A 4EO5B 5B0YD 4J8XA 5BNXB 3X1UA 1HTAA 5AV5C 3AZGA 3AFAA 1R4VA 3O62D 1ID3C 4Z2MH 4ZUXA 3X1VA 1HQ3D 5DNND 4WZSB 4YM6B 4G91C 1M1AC 2YFWA 1M18B 1M18A 3MGQC 5B2IC 1U35B 3AZFB 5B24D 4YM6A 1KX5A 3AV2A 1JFIB 4JJNC 1WWIA 4YS3D 4Z66B 4G92C 2FJ7D 4ZUXB 3WTPE 3X1VB 5AY8C 5B1LC 5CPIC 4J8UB 3UT9C 5BT1D 2AROB 5AV9C 4J8XB 3WA9C 5AV9B 4XUJB 4J8XC 1P3MA 3AZJD 4H9PA 3TU4B 3AFAC 3AZFD 5B31G 5B2JD 3AZND 3LJAB 3MGRA 5DNMB 5F99B 3AZID 1P3LD 3AN2A 3MGPB 4LD9D 5GT3C 3REIC 3MGQA 3REIB 4Z2MG 5KDMB 1KX5C 3MGSD 4AWLB 4H9SA 5AY8B 3W97C 5B33A 5F99C 1S32C 5AV6C 1P3GB 5FUGA 4H9RB 5GT3B 3B0DC 1P3IB 1KX4B 5B2ID 3REJD 3AZKC 2RVQC 4G91B 1P3OD 3WAAB 3VH5W 5B32D 3AYWD 3AV1A 3X1TA 2FJ7C 5CP6C 3W96B 2AROC 3AV1B 2HIOA 3KSYA 5AVBA 5AV5B 3X1TB 3WA9B 1P34D 4H9OA 3A6NC 5CPID 1M19B 3AZIB 3LZ0B 3AZEB 3KUYD 5GT3A 5CPKD 4Z5TA 1P3IA 1KX4A 3TU4D 4KUDA 4R8PC 3AV2C 5B33B 3C1CB 1P3PC 1P3GA 5AV6A 3AZIC 1P3AD 4J8UD 3MVDA 5AV8D 1M1AB 2NZDC 4ZUXD 3X1VD 5BS7A 3B6FB 5CPJD 3W97D 1AOID 1A7WA 2IO5B 3AV1C 3X1TC 3NQUB 2AROA 5AVBC 5JA4B 3B6GD 3KWQC 3B6FC 2PYOA 1F66B 4WU8D 5AVCA 3X1SC 5B0ZA 3LELA 1AOIB 5CP6D 3LZ0A 3C1BA 1N1JA 2CV5C 5CPJB 1EQZB 5BNVB 3AZLA 4X23C 3AZHA 1F66C 3W96A 3UTBB 5B31B 3W99B 2YFVB 1ID3D 5B1MA 2NQBC 3TU4C 4R8PD 3REHD 1ZLAD 3C1CD 5GSUC 3MGQD 1HQ3C 5DNNC 1M1AD 3AZGB 3WKJD 3MGSA 3WTPC 1ULYA 1F1EA 2HIOC 1KX3B 4WNNA 1M19D 5BNXA 3UT9B 4Z66C 1B6WA 4G92B 5CHLB 1AOIC 3X1SA 5KDMA 1S32B 5E5AD 3MGQB 4KGCA 4CAYA 4JJNA 4DRAA 3VH5A 4R8PB 3V9RA 5B32A 1P3PA 1P3BC 1P3KA 4NE6A 3B0CW 3VH5T 3WA9D 3AZLC 4JJNB 3AZHC 3LJAA 3AYWB 2NZDA 3VH6W 4WNNB 3MNNB 3RELA 4J8VA 3UT9A 5AV9A 1Q9CA 5CP6B 3UTAB 5B40D 2BYMB 2CV5D 3MGSB 1BH9B 3MGSC 5GXQB 4LD9C 1P3FA 4XUJC 3W98D 1F66D 1P3GD 5AV6D 1P3AA 3KWQA 5F99D 2F8NA 3AN2C 4Z66A 3LZ1D 1B67A 5GSUD 3UTAC 1P3BB 1WWSA 3AZKD 5CPJA 5B0YA 3W97A 5BNVA 4J8XD 3AYWC 3LZ0C 4NFTA 4KHAB 1KX3D 1N1JB 1EQZA 1P3OC 1M19C 3REKB 5B2JB 3AZNB 3KXBD 3LELB 5AVCB 4J8WD 4J8WB 4WU9C 4WU8A 3REHB 1ZLAB 1TZYA 1P34C 2PYOB 1TAFA 1ID3B 3AZMA 5B0ZD 1P3BD 3KUYC 5CPKC 3AV2D 5GSUB 1P3FC 4YS3A 4UUZB 3LZ1B 3A6NA 4J8UC 3R45A 5CPIB 2F8NG 3W99C 2BYKA 3UTBC 4WU9B 3W96D 3W98B 1U35D 1TAFB 1ID3A 5B1MD 5CPJC 1H3OB 2RVQD 4WU8B 3REHA 3C1CA 1ZLAA 1P3OB 4XZQA 5AV6B 1P3GC 5B32C 3WKJA 5B2IB 1M18C 3O62B 4KUDB 5B32G 3MGRD 3UTAD 4WU8C 5AVBB 3MNND 4H9NB 3B6FD 4QLCD 5E5AB 4H9OB 3B0CT 4WV4B 3AZMC 3X1UC 5DNMC 2HIOB 5AV5A 4KGCD 5GXQC 3MGPD 4LD9B 1P3PD 1P3LB 1P3AC 5C3IB 5AVCC 3LJAD 2BYMA 2NZDD 4X23D 5B2IA 3RELD 1KU5A 5B0ZC 4J8VD 3AZED 3REHC 3AZJB 1ZLAC 3C1CC 3C1BC 2CV5A 2NQBD 3AYWA 3X1TD 3AV1D 3W99D 3REKC 5AY8A 5B1LA 3UTBD 2HIOD 3AZGD 3AN2B 3B6GC 3KWQD 3WTPD 5CPIA 4QLCB 5F99A 5B1MC 4Z66D 3LZ1A 3WAAD 4WU9A 4YS3B 5G49A 5GSUA 4H9QA 5DNMA 3MGRB 2HUEC 4UUZA 4KUDD 1P3MB 5BO0A 1M18D 5B24A 4YM6D 1KX3A 5C3IC 1EQZD 5E5AC 4J8UA 3KXBA 1TZYB 4J8WA 3MVDD 2FJ7A 5B31C 1BH8B 1TZYD 4KGCC 3W97B 5B0YB 5B40C 2YFVA 1JFIA 3B6GB 1P3BA 3WKJC 1P3MD 5AV8B 3AV2B 3B6GA 3AZFA 3C1BB 3O62C 1P3AB 4XUJD 2PYOD 3W98C 3RELC 4J8VC 2F8NB 3KWQB 4HGAC 3AN2D 1BH9A 3X1UB 1BH8A 5GT0C 3KXBB 3LELD 5CP6A 4XZQD 3REKD 5GXQA 3LZ0D 2FJ7B 1KX3C 5JA4A 3AZLD 3AZHD 3RELB 5JRGC 3AZKB 3KUYB 5CPKB 5B32B 4R8PA 3B6FA 4QLCA 4H9QB 4ZBJC 1P3KB 1M1AA 5G49B 5AV5D 2F8NH 4DRBA 2F8NK 1BFMA 3MVDC 2CV5B 5B2JC 3AZNC 3NQJA 3LZ1C 1TZYC 3REJB 1U35C 1P34A 4X23A 3W96C 3AZEA 5GT0A 5GT3D 2IO5C 3REID 4NE5A
chains in the Genus database with same CATH superfamily
4JJND 2NQBA 2HUEB 5B24C 1P3KD 3WA9A 3W99A 5AY8D 5B1LD 3UTBA 3KXBC 5JRGA 4J8WC 5B1MB 1S32D 3WTPA 5B31A 3WAAA 2G5HC 4WU9D 4M6BA 5AV8A 3AZHB 3MGRC 3UT9D 5BT1C 3AZLB 5AV9D 4XZQC 5B40A 4H9NA 5DNMD 4AWLC 1AOIA 1P3FD 5FUGB 5B0ZB 3X1UD 3AZJC 1F66A 3WKJB 3AFAD 3AZFC 4E45A 3O62A 5B33C 2AROD 2L5AA 2F8ND 3NQUA 3EG5B 3B0BA 4XZQB 1HQ3A 5DNNA 1P3LC 5B24B 4UPKA 3AZEC 5AVCD 3LJAC 1H3OA 5BO0B 1KX5D 2BYKB 3R45B 3C1BD 4H9PB 4XUJA 3WAAC 3MVDB 5B1LB 3X1VC 4ZUXC 3MNNC 1HQ3B 5DNNB 3AZMB 4QLCC 3AZMD 3REJC 4ZBJB 3B0DB 1P3IC 1P3KC 4Z5TC 1KX4C 4Z5TB 3REKA 5GXQD 3MGPC 3AZJA 4KUDC 5B40B 5B0YC 3VH6T 4E44A 5B2JA 3A6ND 1PZRA 3AZNA 2JSSA 2Y2LA 4KHAA 3VH6A 3AZIA 1M19A 1KX5B 1EQZC 1U35A 3WTPB 1P3LA 2YFWB 4LD9A 2Y2NA 3X1SD 5BS7C 5JRGB 2NQBB 5E5AA 2LY8A 4HGAB 1P3MC 4WJ3C 5B33D 4EO5C 3AFAB 2JE5A 2Y2KA 3AZGC 4X23B 1P3FB 3UTAA 2DF4C 4YS3C 3EPHA 5GT0B 3IP4C 4NE3A 3MNNA 4H9RA 5AV8C 2PYOC 2ZY5A 3REJA 1P34B 4J8VB 5GT0D 3EPJA 3REIA 1P3OA 3NQJB 3EPLA 2CWEA 3MGPA 2NZDB 4H9SC 4YM6C 3FDDA 4CSRB 3LELC 3V9RB 4CAYB 3W98A 4CSRA 5JRGD 3H0RC 5AVBD 1S32A 1P3PB 3X1SB 3A6NB 5B31D 4KGCB 3KUYA 5CPKA 1P3ID 4Z5TD 1KX4D 2Y2IA 3AZKA 3TU4A 4EO5B 5B0YD 2Y2HA 4J8XA 5BNXB 3X1UA 1HTAA 2ZY4A 5AV5C 3AZGA 3AFAA 1R4VA 3O62D 3H0LC 1ID3C 4Z2MH 1W2EA 4ZUXA 3X1VA 1HQ3D 5DNND 4WZSB 4YM6B 4G91C 1M1AC 2YFWA 1M18B 1M18A 3MGQC 5B2IC 1U35B 3AZFB 5B24D 4YM6A 1KX5A 3AV2A 1JFIB 4JJNC 1WWIA 4YS3D 4Z66B 4G92C 2FJ7D 4ZUXB 3WTPE 3X1VB 5AY8C 5B1LC 2ZM5A 5CPIC 4J8UB 3UT9C 5BT1D 2AROB 5AV9C 4J8XB 3WA9C 5AV9B 4XUJB 4J8XC 1P3MA 3AZJD 4H9PA 3TU4B 1T3UA 3AFAC 3AZFD 5B31G 5B2JD 3AZND 3LJAB 2Y2JA 3MGRA 5DNMB 5F99B 3AZID 1P3LD 3AN2A 3MGPB 4LD9D 5GT3C 3REIC 3MGQA 3REIB 4Z2MG 5KDMB 1KX5C 3MGSD 4AWLB 4H9SA 5AY8B 2F2AC 3W97C 5B33A 5F99C 1S32C 5AV6C 1P3GB 5FUGA 4H9RB 5GT3B 3B0DC 1P3IB 1KX4B 5B2ID 2XD1A 3REJD 3AZKC 2RVQC 4G91B 1P3OD 3WAAB 3VH5W 5B32D 3AYWD 3AV1A 3X1TA 2FJ7C 5CP6C 3W96B 2AROC 3AV1B 2HIOA 3KSYA 5AVBA 5AV5B 3X1TB 3WA9B 1P34D 4H9OA 3A6NC 5CPID 1M19B 3AZIB 3LZ0B 3AZEB 3KUYD 5GT3A 4DQYB 4Z5TA 5CPKD 1P3IA 1KX4A 3TU4D 4KUDA 4R8PC 3AV2C 5B33B 3C1CB 1P3PC 1P3GA 5AV6A 3AZIC 1P3AD 4J8UD 2VQRA 3MVDA 5AV8D 1M1AB 2RIQA 2NZDC 4ZUXD 3X1VD 5BS7A 3B6FB 2Y2OA 5CPJD 3W97D 1AOID 1A7WA 2IO5B 3AV1C 3X1TC 2XD5A 3NQUB 2AROA 5AVBC 5JA4B 3B6GD 3KWQC 3B6FC 2PYOA 1F66B 4WU8D 5AVCA 2G5IC 3X1SC 5B0ZA 3LELA 1AOIB 5CP6D 3LZ0A 3C1BA 1N1JA 2CV5C 5CPJB 1EQZB 5BNVB 3AZLA 4X23C 3AZHA 1F66C 3W96A 3UTBB 5B31B 3W99B 2YFVB 1ID3D 5B1MA 2NQBC 3TU4C 4R8PD 3REHD 1ZLAD 3C1CD 5GSUC 3MGQD 1HQ3C 5DNNC 1M1AD 3AZGB 3WKJD 3MGSA 3WTPC 1ULYA 1F1EA 2HIOC 1KX3B 4WNNA 1M19D 5BNXA 3UT9B 4Z66C 1B6WA 4G92B 5CHLB 1AOIC 3X1SA 5KDMA 1S32B 5E5AD 3MGQB 4KGCA 4CAYA 4JJNA 4DRAA 3VH5A 4R8PB 3V9RA 5B32A 1P3PA 1P3BC 1P3KA 4NE6A 3B0CW 3VH5T 3WA9D 3AZLC 4JJNB 3AZHC 3LJAA 3AYWB 2NZDA 3VH6W 4WNNB 3MNNB 3RELA 4J8VA 2JCHA 3UT9A 5AV9A 1Q9CA 3A1KA 5CP6B 3UTAB 5B40D 2BYMB 2CV5D 3MGSB 1BH9B 3MGSC 5GXQB 4LD9C 1P3FA 4XUJC 3W98D 1F66D 1P3GD 5AV6D 1P3AA 2Y2GA 3KWQA 5F99D 2F8NA 3AN2C 4Z66A 3LZ1D 1B67A 5GSUD 3UTAC 1P3BB 1WWSA 3AZKD 5CPJA 5B0YA 3W97A 5BNVA 4J8XD 3AYWC 3LZ0C 4NFTA 4KHAB 1KX3D 1N1JB 1EQZA 1P3OC 1M19C 3REKB 5B2JB 3AZNB 3KXBD 3LELB 5AVCB 4J8WD 4J8WB 4WU9C 4WU8A 3REHB 1ZLAB 1TZYA 1P34C 2PYOB 1TAFA 1ID3B 3F6TA 3AZMA 5B0ZD 1P3BD 3KUYC 5CPKC 3AV2D 5GSUB 1P3FC 4YS3A 4UUZB 3LZ1B 3A6NA 4J8UC 3R45A 5CPIB 2F8NG 3W99C 2BYKA 3UTBC 4WU9B 3W96D 3W98B 2Y2PA 1U35D 1TAFB 1ID3A 5B1MD 5CPJC 1H3OB 2RVQD 4WU8B 3REHA 3C1CA 1ZLAA 1P3OB 4XZQA 5AV6B 1P3GC 5B32C 3WKJA 5B2IB 1M18C 3O62B 4KUDB 5B32G 3MGRD 3UTAD 4WU8C 5AVBB 3MNND 4H9NB 3B6FD 4QLCD 3AL0C 5E5AB 3P5JB 4H9OB 3B0CT 4WV4B 3AZMC 3X1UC 5DNMC 2HIOB 5AV5A 4KGCD 5GXQC 3MGPD 4LD9B 2J8PA 1P3PD 1P3LB 1P3AC 5C3IB 5AVCC 3LJAD 2BYMA 2NZDD 4X23D 5B2IA 3A1IA 3RELD 1KU5A 5B0ZC 4J8VD 3AZED 3REHC 3AZJB 1ZLAC 3C1CC 3C1BC 3EPKA 2CV5A 2NQBD 3AYWA 3X1TD 3AV1D 3W99D 3REKC 3H0MC 5AY8A 5B1LA 3UTBD 2HIOD 3AZGD 3AN2B 3B6GC 2Y2QA 3KWQD 3WTPD 5CPIA 4QLCB 5F99A 5B1MC 4Z66D 3LZ1A 3WAAD 4WU9A 4YS3B 5G49A 5GSUA 4H9QA 5DNMA 3MGRB 2HUEC 4UUZA 4KUDD 1P3MB 5BO0A 1M18D 5B24A 4YM6D 1KX3A 5C3IC 1EQZD 5E5AC 2Y2MA 4J8UA 3KXBA 1TZYB 4J8WA 3MVDD 2FJ7A 2ZY2A 5B31C 2DQNC 1BH8B 1TZYD 4KGCC 3W97B 5B0YB 5B40C 2YFVA 1JFIA 3B6GB 1P3BA 3WKJC 1P3MD 5AV8B 3AV2B 3B6GA 3AZFA 2UWXA 3C1BB 3O62C 1P3AB 4XUJD 2PYOD 3W98C 3RELC 4J8VC 2F8NB 3KWQB 4HGAC 3AN2D 1BH9A 3X1UB 1BH8A 5GT0C 3KXBB 3LELD 2W8SA 5CP6A 4XZQD 3REKD 2BG1A 5GXQA 3LZ0D 2FJ7B 1KX3C 5JA4A 3AZLD 2FFFB 3AZHD 3RELB 5JRGC 3AZKB 2ZY3A 1Z2CB 3KUYB 5CPKB 5B32B 4R8PA 3B6FA 4QLCA 4H9QB 4ZBJC 1P3KB 1M1AA 5G49B 5AV5D 2F8NH 4DRBA 2F8NK 1BFMA 3MVDC 2CV5B 5B2JC 3AZNC 3NQJA 3LZ1C 1TZYC 3REJB 1U35C 1P34A 3KFUG 4X23A 3W96C 3AZEA 5GT0A 5GT3D 2IO5C 3REID 4NE5A
chains in the Genus database with same CATH topology
4JJND 2NQBA 2HUEB 5B24C 1P3KD 3WA9A 3W99A 5AY8D 5B1LD 3UTBA 3KXBC 5JRGA 4J8WC 5B1MB 1S32D 3WTPA 5B31A 3WAAA 2G5HC 4WU9D 4M6BA 5AV8A 3AZHB 3MGRC 3UT9D 5BT1C 3AZLB 5AV9D 4XZQC 5B40A 4H9NA 5DNMD 4AWLC 1AOIA 1P3FD 5FUGB 5B0ZB 3X1UD 3AZJC 1F66A 3WKJB 3AFAD 3AZFC 4E45A 3O62A 5B33C 2AROD 2L5AA 2F8ND 3NQUA 3EG5B 3B0BA 4XZQB 1HQ3A 5DNNA 1P3LC 5B24B 4UPKA 3AZEC 5AVCD 3LJAC 1H3OA 5BO0B 1KX5D 2BYKB 3R45B 3C1BD 4H9PB 4XUJA 3WAAC 3MVDB 5B1LB 3X1VC 4ZUXC 3MNNC 1HQ3B 5DNNB 3AZMB 4QLCC 3AZMD 3REJC 4ZBJB 3B0DB 1P3IC 1P3KC 4Z5TC 1KX4C 4Z5TB 3REKA 5GXQD 3MGPC 3AZJA 4KUDC 5B40B 5B0YC 3VH6T 4E44A 5B2JA 3A6ND 1PZRA 3AZNA 2JSSA 2Y2LA 4KHAA 3VH6A 3AZIA 1M19A 1KX5B 1EQZC 1U35A 3WTPB 1P3LA 2YFWB 4LD9A 2Y2NA 3X1SD 5BS7C 5JRGB 2NQBB 5E5AA 2LY8A 4HGAB 1P3MC 4WJ3C 5B33D 4EO5C 3AFAB 2JE5A 2Y2KA 3AZGC 4X23B 1P3FB 3UTAA 2DF4C 4YS3C 3EPHA 5GT0B 3IP4C 4NE3A 3MNNA 4H9RA 5AV8C 2PYOC 2ZY5A 3REJA 1P34B 4J8VB 5GT0D 3EPJA 3REIA 1P3OA 3NQJB 3EPLA 2CWEA 3MGPA 2NZDB 4H9SC 4YM6C 3FDDA 4CSRB 3LELC 3V9RB 4CAYB 3W98A 4CSRA 5JRGD 3H0RC 5AVBD 1S32A 1P3PB 3X1SB 3A6NB 5B31D 4KGCB 3KUYA 5CPKA 1P3ID 4Z5TD 1KX4D 2Y2IA 3AZKA 3TU4A 4EO5B 5B0YD 2Y2HA 4J8XA 5BNXB 3X1UA 1HTAA 2ZY4A 5AV5C 3AZGA 3AFAA 1R4VA 3O62D 3H0LC 1ID3C 4Z2MH 1W2EA 4ZUXA 3X1VA 1HQ3D 5DNND 4WZSB 4YM6B 4G91C 1M1AC 2YFWA 1M18B 1M18A 3MGQC 5B2IC 1U35B 3AZFB 5B24D 4YM6A 1KX5A 3AV2A 1JFIB 4JJNC 1WWIA 4YS3D 4Z66B 4G92C 2FJ7D 4ZUXB 3WTPE 3X1VB 5AY8C 5B1LC 2ZM5A 5CPIC 4J8UB 3UT9C 5BT1D 2AROB 5AV9C 4J8XB 3WA9C 5AV9B 4XUJB 4J8XC 1P3MA 3AZJD 4H9PA 3TU4B 1T3UA 3AFAC 3AZFD 5B31G 5B2JD 3AZND 3LJAB 2Y2JA 3MGRA 5DNMB 5F99B 3AZID 1P3LD 3AN2A 3MGPB 4LD9D 5GT3C 3REIC 3MGQA 3REIB 4Z2MG 5KDMB 1KX5C 3MGSD 4AWLB 4H9SA 5AY8B 2F2AC 3W97C 5B33A 5F99C 1S32C 5AV6C 1P3GB 5FUGA 4H9RB 5GT3B 3B0DC 1P3IB 1KX4B 5B2ID 2XD1A 3REJD 3AZKC 2RVQC 4G91B 1P3OD 3WAAB 3VH5W 5B32D 3AYWD 3AV1A 3X1TA 2FJ7C 5CP6C 3W96B 2AROC 3AV1B 2HIOA 3KSYA 5AVBA 5AV5B 3X1TB 3WA9B 1P34D 4H9OA 3A6NC 5CPID 1M19B 3AZIB 3LZ0B 3AZEB 3KUYD 5GT3A 4DQYB 4Z5TA 5CPKD 1P3IA 1KX4A 3TU4D 4KUDA 4R8PC 3AV2C 5B33B 3C1CB 1P3PC 1P3GA 5AV6A 3AZIC 1P3AD 4J8UD 2VQRA 3MVDA 5AV8D 1M1AB 2RIQA 2NZDC 4ZUXD 3X1VD 5BS7A 3B6FB 2Y2OA 5CPJD 3W97D 1AOID 1A7WA 2IO5B 3AV1C 3X1TC 2XD5A 3NQUB 2AROA 5AVBC 5JA4B 3B6GD 3KWQC 3B6FC 2PYOA 1F66B 4WU8D 5AVCA 2G5IC 3X1SC 5B0ZA 3LELA 1AOIB 5CP6D 3LZ0A 3C1BA 1N1JA 2CV5C 5CPJB 1EQZB 5BNVB 3AZLA 4X23C 3AZHA 1F66C 3W96A 3UTBB 5B31B 3W99B 2YFVB 1ID3D 5B1MA 2NQBC 3TU4C 4R8PD 3REHD 1ZLAD 3C1CD 5GSUC 3MGQD 1HQ3C 5DNNC 1M1AD 3AZGB 3WKJD 3MGSA 3WTPC 1ULYA 1F1EA 2HIOC 1KX3B 4WNNA 1M19D 5BNXA 3UT9B 4Z66C 1B6WA 4G92B 5CHLB 1AOIC 3X1SA 5KDMA 1S32B 5E5AD 3MGQB 4KGCA 4CAYA 4JJNA 4DRAA 3VH5A 4R8PB 3V9RA 5B32A 1P3PA 1P3BC 1P3KA 4NE6A 3B0CW 3VH5T 3WA9D 3AZLC 4JJNB 3AZHC 3LJAA 3AYWB 2NZDA 3VH6W 4WNNB 3MNNB 3RELA 4J8VA 2JCHA 3UT9A 5AV9A 1Q9CA 3A1KA 5CP6B 3UTAB 5B40D 2BYMB 2CV5D 3MGSB 1BH9B 3MGSC 5GXQB 4LD9C 1P3FA 4XUJC 3W98D 1F66D 1P3GD 5AV6D 1P3AA 2Y2GA 3KWQA 5F99D 2F8NA 3AN2C 4Z66A 3LZ1D 1B67A 5GSUD 3UTAC 1P3BB 1WWSA 3AZKD 5CPJA 5B0YA 3W97A 5BNVA 4J8XD 3AYWC 3LZ0C 4NFTA 4KHAB 1KX3D 1N1JB 1EQZA 1P3OC 1M19C 3REKB 5B2JB 3AZNB 3KXBD 3LELB 5AVCB 4J8WD 4J8WB 4WU9C 4WU8A 3REHB 1ZLAB 1TZYA 1P34C 2PYOB 1TAFA 1ID3B 3F6TA 3AZMA 5B0ZD 1P3BD 3KUYC 5CPKC 3AV2D 5GSUB 1P3FC 4YS3A 4UUZB 3LZ1B 3A6NA 4J8UC 3R45A 5CPIB 2F8NG 3W99C 2BYKA 3UTBC 4WU9B 3W96D 3W98B 2Y2PA 1U35D 1TAFB 1ID3A 5B1MD 5CPJC 1H3OB 2RVQD 4WU8B 3REHA 3C1CA 1ZLAA 1P3OB 4XZQA 5AV6B 1P3GC 5B32C 3WKJA 5B2IB 1M18C 3O62B 4KUDB 5B32G 3MGRD 3UTAD 4WU8C 5AVBB 3MNND 4H9NB 3B6FD 4QLCD 3AL0C 5E5AB 3P5JB 4H9OB 3B0CT 4WV4B 3AZMC 3X1UC 5DNMC 2HIOB 5AV5A 4KGCD 5GXQC 3MGPD 4LD9B 2J8PA 1P3PD 1P3LB 1P3AC 5C3IB 5AVCC 3LJAD 2BYMA 2NZDD 4X23D 5B2IA 3A1IA 3RELD 1KU5A 5B0ZC 4J8VD 3AZED 3REHC 3AZJB 1ZLAC 3C1CC 3C1BC 3EPKA 2CV5A 2NQBD 3AYWA 3X1TD 3AV1D 3W99D 3REKC 3H0MC 5AY8A 5B1LA 3UTBD 2HIOD 3AZGD 3AN2B 3B6GC 2Y2QA 3KWQD 3WTPD 5CPIA 4QLCB 5F99A 5B1MC 4Z66D 3LZ1A 3WAAD 4WU9A 4YS3B 5G49A 5GSUA 4H9QA 5DNMA 3MGRB 2HUEC 4UUZA 4KUDD 1P3MB 5BO0A 1M18D 5B24A 4YM6D 1KX3A 5C3IC 1EQZD 5E5AC 2Y2MA 4J8UA 3KXBA 1TZYB 4J8WA 3MVDD 2FJ7A 2ZY2A 5B31C 2DQNC 1BH8B 1TZYD 4KGCC 3W97B 5B0YB 5B40C 2YFVA 1JFIA 3B6GB 1P3BA 3WKJC 1P3MD 5AV8B 3AV2B 3B6GA 3AZFA 2UWXA 3C1BB 3O62C 1P3AB 4XUJD 2PYOD 3W98C 3RELC 4J8VC 2F8NB 3KWQB 4HGAC 3AN2D 1BH9A 3X1UB 1BH8A 5GT0C 3KXBB 3LELD 2W8SA 5CP6A 4XZQD 3REKD 2BG1A 5GXQA 3LZ0D 2FJ7B 1KX3C 5JA4A 3AZLD 2FFFB 3AZHD 3RELB 5JRGC 3AZKB 2ZY3A 1Z2CB 3KUYB 5CPKB 5B32B 4R8PA 3B6FA 4QLCA 4H9QB 4ZBJC 1P3KB 1M1AA 5G49B 5AV5D 2F8NH 4DRBA 2F8NK 1BFMA 3MVDC 2CV5B 5B2JC 3AZNC 3NQJA 3LZ1C 1TZYC 3REJB 1U35C 1P34A 3KFUG 4X23A 3W96C 3AZEA 5GT0A 5GT3D 2IO5C 3REID 4NE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJN D;  2NQB A;  2HUE B;  5B24 C;  1P3K D;  3WA9 A;  3W99 A;  5AY8 D;  5B1L D;  3UTB A;  3KXB C;  5JRG A;  4J8W C;  5B1M B;  1S32 D;  3WTP A;  5B31 A;  3WAA A;  4WU9 D;  4M6B A;  5AV8 A;  3AZH B;  3MGR C;  3UT9 D;  5BT1 C;  3AZL B;  5AV9 D;  4XZQ C;  5B40 A;  4H9N A;  5DNM D;  4AWL C;  1AOI A;  1P3F D;  5FUG B;  5B0Z B;  3X1U D;  3AZJ C;  1F66 A;  3WKJ B;  3AFA D;  3AZF C;  4E45 A;  3O62 A;  5B33 C;  2ARO D;  2L5A A;  2F8N D;  3NQU A;  3B0B A;  4XZQ B;  1HQ3 A;  5DNN A;  1P3L C;  5B24 B;  3AZE C;  5AVC D;  3LJA C;  1H3O A;  5BO0 B;  1KX5 D;  2BYK B;  3R45 B;  3C1B D;  4H9P B;  4XUJ A;  3WAA C;  3MVD B;  5B1L B;  3X1V C;  4ZUX C;  3MNN C;  1HQ3 B;  5DNN B;  3AZM B;  4QLC C;  3AZM D;  3REJ C;  4ZBJ B;  3B0D B;  1P3I C;  1P3K C;  4Z5T C;  1KX4 C;  4Z5T B;  3REK A;  5GXQ D;  3MGP C;  3AZJ A;  4KUD C;  5B40 B;  5B0Y C;  3VH6 T;  4E44 A;  5B2J A;  3A6N D;  3AZN A;  2JSS A;  1KX5 B;  4KHA A;  3VH6 A;  3AZI A;  1M19 A;  1EQZ C;  1U35 A;  3WTP B;  1P3L A;  2YFW B;  4LD9 A;  3X1S D;  5BS7 C;  5JRG B;  2NQB B;  5E5A A;  2LY8 A;  4HGA B;  1P3M C;  5B33 D;  4EO5 C;  3AFA B;  3AZG C;  4X23 B;  1P3F B;  3UTA A;  4YS3 C;  5GT0 B;  4NE3 A;  3MNN A;  4H9R A;  5AV8 C;  2PYO C;  3REJ A;  1P34 B;  4J8V B;  5GT0 D;  3REI A;  1P3O A;  3NQJ B;  2CWE A;  3MGP A;  2NZD B;  4H9S C;  4YM6 C;  4CSR B;  3LEL C;  3V9R B;  4CAY B;  3W98 A;  4CSR A;  5JRG D;  5AVB D;  1S32 A;  1P3P B;  3X1S B;  3A6N B;  5B31 D;  4KGC B;  3KUY A;  5CPK A;  1P3I D;  4Z5T D;  1KX4 D;  3AZK A;  3TU4 A;  4EO5 B;  5B0Y D;  4J8X A;  5BNX B;  3X1U A;  1HTA A;  5AV5 C;  3AZG A;  3AFA A;  1R4V A;  3O62 D;  1ID3 C;  4Z2M H;  4ZUX A;  3X1V A;  1HQ3 D;  5DNN D;  4WZS B;  4YM6 B;  4G91 C;  1M1A C;  2YFW A;  1M18 B;  1M18 A;  3MGQ C;  5B2I C;  1U35 B;  3AZF B;  5B24 D;  4YM6 A;  1KX5 A;  3AV2 A;  1JFI B;  4JJN C;  1WWI A;  4YS3 D;  4Z66 B;  4G92 C;  2FJ7 D;  4ZUX B;  3WTP E;  3X1V B;  5AY8 C;  5B1L C;  5CPI C;  4J8U B;  3UT9 C;  5BT1 D;  2ARO B;  5AV9 C;  4J8X B;  3WA9 C;  5AV9 B;  4XUJ B;  4J8X C;  1P3M A;  3AZJ D;  4H9P A;  3TU4 B;  3AFA C;  3AZF D;  5B31 G;  5B2J D;  3AZN D;  3LJA B;  3MGR A;  5DNM B;  5F99 B;  3AZI D;  1P3L D;  3AN2 A;  3MGP B;  4LD9 D;  5GT3 C;  3REI C;  3MGQ A;  3REI B;  4Z2M G;  5KDM B;  1KX5 C;  3MGS D;  4AWL B;  4H9S A;  5AY8 B;  3W97 C;  5B33 A;  5F99 C;  1S32 C;  5AV6 C;  1P3G B;  5FUG A;  4H9R B;  5GT3 B;  3B0D C;  1P3I B;  1KX4 B;  5B2I D;  3REJ D;  3AZK C;  2RVQ C;  4G91 B;  1P3O D;  3WAA B;  3VH5 W;  5B32 D;  3AYW D;  3AV1 A;  3X1T A;  2FJ7 C;  5CP6 C;  3W96 B;  2ARO C;  3AV1 B;  2HIO A;  3KSY A;  5AVB A;  5AV5 B;  3X1T B;  3WA9 B;  1P34 D;  4H9O A;  3A6N C;  5CPI D;  1M19 B;  3AZI B;  3LZ0 B;  3AZE B;  3KUY D;  5GT3 A;  5CPK D;  4Z5T A;  1P3I A;  1KX4 A;  3TU4 D;  4KUD A;  4R8P C;  3AV2 C;  5B33 B;  3C1C B;  1P3P C;  1P3G A;  5AV6 A;  3AZI C;  1P3A D;  4J8U D;  3MVD A;  5AV8 D;  1M1A B;  2NZD C;  4ZUX D;  3X1V D;  5BS7 A;  3B6F B;  5CPJ D;  3W97 D;  1AOI D;  1A7W A;  2IO5 B;  3AV1 C;  3X1T C;  3NQU B;  2ARO A;  5AVB C;  5JA4 B;  3B6G D;  3KWQ C;  3B6F C;  2PYO A;  1F66 B;  4WU8 D;  5AVC A;  3X1S C;  5B0Z A;  3LEL A;  1AOI B;  5CP6 D;  3LZ0 A;  3C1B A;  1N1J A;  2CV5 C;  5CPJ B;  1EQZ B;  5BNV B;  3AZL A;  4X23 C;  3AZH A;  1F66 C;  3W96 A;  3UTB B;  5B31 B;  3W99 B;  2YFV B;  1ID3 D;  5B1M A;  2NQB C;  3TU4 C;  4R8P D;  3REH D;  1ZLA D;  3C1C D;  5GSU C;  3MGQ D;  1HQ3 C;  5DNN C;  1M1A D;  3AZG B;  3WKJ D;  3MGS A;  3WTP C;  1ULY A;  1F1E A;  2HIO C;  1KX3 B;  4WNN A;  1M19 D;  5BNX A;  3UT9 B;  4Z66 C;  1B6W A;  4G92 B;  5CHL B;  1AOI C;  3X1S A;  5KDM A;  1S32 B;  5E5A D;  3MGQ B;  4KGC A;  4CAY A;  4JJN A;  4DRA A;  3VH5 A;  4R8P B;  3V9R A;  5B32 A;  1P3P A;  1P3B C;  1P3K A;  4NE6 A;  3B0C W;  3VH5 T;  3WA9 D;  3AZL C;  4JJN B;  3AZH C;  3LJA A;  3AYW B;  2NZD A;  3VH6 W;  4WNN B;  3MNN B;  3REL A;  4J8V A;  3UT9 A;  5AV9 A;  1Q9C A;  5CP6 B;  3UTA B;  5B40 D;  2BYM B;  2CV5 D;  3MGS B;  1BH9 B;  3MGS C;  5GXQ B;  4LD9 C;  1P3F A;  4XUJ C;  3W98 D;  1F66 D;  1P3G D;  5AV6 D;  1P3A A;  3KWQ A;  5F99 D;  2F8N A;  3AN2 C;  4Z66 A;  3LZ1 D;  1B67 A;  5GSU D;  3UTA C;  1P3B B;  1WWS A;  3AZK D;  5CPJ A;  5B0Y A;  3W97 A;  5BNV A;  4J8X D;  3AYW C;  3LZ0 C;  4NFT A;  4KHA B;  1KX3 D;  1N1J B;  1EQZ A;  1P3O C;  1M19 C;  3REK B;  5B2J B;  3AZN B;  3KXB D;  3LEL B;  5AVC B;  4J8W D;  4J8W B;  4WU9 C;  4WU8 A;  3REH B;  1ZLA B;  1TZY A;  1P34 C;  2PYO B;  1TAF A;  1ID3 B;  3AZM A;  5B0Z D;  1P3B D;  3KUY C;  5CPK C;  3AV2 D;  5GSU B;  1P3F C;  4YS3 A;  4UUZ B;  3LZ1 B;  3A6N A;  4J8U C;  3R45 A;  5CPI B;  2F8N G;  3W99 C;  2BYK A;  3UTB C;  4WU9 B;  3W96 D;  3W98 B;  1U35 D;  1TAF B;  1ID3 A;  5B1M D;  5CPJ C;  1H3O B;  2RVQ D;  4WU8 B;  3REH A;  3C1C A;  1ZLA A;  1P3O B;  4XZQ A;  5AV6 B;  1P3G C;  5B32 C;  3WKJ A;  5B2I B;  1M18 C;  3O62 B;  4KUD B;  5B32 G;  3MGR D;  3UTA D;  4WU8 C;  5AVB B;  3MNN D;  4H9N B;  3B6F D;  4QLC D;  5E5A B;  4H9O B;  3B0C T;  4WV4 B;  3AZM C;  3X1U C;  5DNM C;  2HIO B;  5AV5 A;  4KGC D;  5GXQ C;  3MGP D;  4LD9 B;  1P3P D;  1P3L B;  1P3A C;  5C3I B;  5AVC C;  3LJA D;  2BYM A;  2NZD D;  4X23 D;  5B2I A;  3REL D;  1KU5 A;  5B0Z C;  4J8V D;  3AZE D;  3REH C;  3AZJ B;  1ZLA C;  3C1C C;  3C1B C;  2CV5 A;  2NQB D;  3AYW A;  3X1T D;  3AV1 D;  3W99 D;  3REK C;  5AY8 A;  5B1L A;  3UTB D;  2HIO D;  3AZG D;  3AN2 B;  3B6G C;  3KWQ D;  3WTP D;  5CPI A;  4QLC B;  5F99 A;  5B1M C;  4Z66 D;  3LZ1 A;  3WAA D;  4WU9 A;  4YS3 B;  5G49 A;  5GSU A;  4H9Q A;  5DNM A;  3MGR B;  2HUE C;  4UUZ A;  4KUD D;  1P3M B;  5BO0 A;  1M18 D;  5B24 A;  4YM6 D;  1KX3 A;  5C3I C;  1EQZ D;  5E5A C;  4J8U A;  3KXB A;  1TZY B;  4J8W A;  3MVD D;  2FJ7 A;  5B31 C;  1BH8 B;  1TZY D;  4KGC C;  3W97 B;  5B0Y B;  5B40 C;  2YFV A;  1JFI A;  3B6G B;  1P3B A;  3WKJ C;  1P3M D;  5AV8 B;  3AV2 B;  3B6G A;  3AZF A;  3C1B B;  3O62 C;  1P3A B;  4XUJ D;  2PYO D;  3W98 C;  3REL C;  4J8V C;  2F8N B;  3KWQ B;  4HGA C;  3AN2 D;  1BH9 A;  3X1U B;  1BH8 A;  5GT0 C;  3KXB B;  3LEL D;  5CP6 A;  4XZQ D;  3REK D;  5GXQ A;  3LZ0 D;  2FJ7 B;  1KX3 C;  5JA4 A;  3AZL D;  3AZH D;  3REL B;  5JRG C;  3AZK B;  3KUY B;  5CPK B;  5B32 B;  4R8P A;  3B6F A;  4QLC A;  4H9Q B;  4ZBJ C;  1P3K B;  1M1A A;  5G49 B;  5AV5 D;  2F8N H;  4DRB A;  2F8N K;  1BFM A;  3MVD C;  2CV5 B;  5B2J C;  3AZN C;  3NQJ A;  3LZ1 C;  1TZY C;  3REJ B;  1U35 C;  1P34 A;  4X23 A;  3W96 C;  3AZE A;  5GT0 A;  5GT3 D;  2IO5 C;  3REI D;  4NE5 A; 
#chains in the Genus database with same CATH topology
 4JJN D;  2NQB A;  2HUE B;  5B24 C;  1P3K D;  3WA9 A;  3W99 A;  5AY8 D;  5B1L D;  3UTB A;  3KXB C;  5JRG A;  4J8W C;  5B1M B;  1S32 D;  3WTP A;  5B31 A;  3WAA A;  2G5H C;  4WU9 D;  4M6B A;  5AV8 A;  3AZH B;  3MGR C;  3UT9 D;  5BT1 C;  3AZL B;  5AV9 D;  4XZQ C;  5B40 A;  4H9N A;  5DNM D;  4AWL C;  1AOI A;  1P3F D;  5FUG B;  5B0Z B;  3X1U D;  3AZJ C;  1F66 A;  3WKJ B;  3AFA D;  3AZF C;  4E45 A;  3O62 A;  5B33 C;  2ARO D;  2L5A A;  2F8N D;  3NQU A;  3EG5 B;  3B0B A;  4XZQ B;  1HQ3 A;  5DNN A;  1P3L C;  5B24 B;  4UPK A;  3AZE C;  5AVC D;  3LJA C;  1H3O A;  5BO0 B;  1KX5 D;  2BYK B;  3R45 B;  3C1B D;  4H9P B;  4XUJ A;  3WAA C;  3MVD B;  5B1L B;  3X1V C;  4ZUX C;  3MNN C;  1HQ3 B;  5DNN B;  3AZM B;  4QLC C;  3AZM D;  3REJ C;  4ZBJ B;  3B0D B;  1P3I C;  1P3K C;  4Z5T C;  1KX4 C;  4Z5T B;  3REK A;  5GXQ D;  3MGP C;  3AZJ A;  4KUD C;  5B40 B;  5B0Y C;  3VH6 T;  4E44 A;  5B2J A;  3A6N D;  1PZR A;  3AZN A;  2JSS A;  2Y2L A;  4KHA A;  3VH6 A;  3AZI A;  1M19 A;  1KX5 B;  1EQZ C;  1U35 A;  3WTP B;  1P3L A;  2YFW B;  4LD9 A;  2Y2N A;  3X1S D;  5BS7 C;  5JRG B;  2NQB B;  5E5A A;  2LY8 A;  4HGA B;  1P3M C;  4WJ3 C;  5B33 D;  4EO5 C;  3AFA B;  2JE5 A;  2Y2K A;  3AZG C;  4X23 B;  1P3F B;  3UTA A;  2DF4 C;  4YS3 C;  3EPH A;  5GT0 B;  3IP4 C;  4NE3 A;  3MNN A;  4H9R A;  5AV8 C;  2PYO C;  2ZY5 A;  3REJ A;  1P34 B;  4J8V B;  5GT0 D;  3EPJ A;  3REI A;  1P3O A;  3NQJ B;  3EPL A;  2CWE A;  3MGP A;  2NZD B;  4H9S C;  4YM6 C;  3FDD A;  4CSR B;  3LEL C;  3V9R B;  4CAY B;  3W98 A;  4CSR A;  5JRG D;  3H0R C;  5AVB D;  1S32 A;  1P3P B;  3X1S B;  3A6N B;  5B31 D;  4KGC B;  3KUY A;  5CPK A;  1P3I D;  4Z5T D;  1KX4 D;  2Y2I A;  3AZK A;  3TU4 A;  4EO5 B;  5B0Y D;  2Y2H A;  4J8X A;  5BNX B;  3X1U A;  1HTA A;  2ZY4 A;  5AV5 C;  3AZG A;  3AFA A;  1R4V A;  3O62 D;  3H0L C;  1ID3 C;  4Z2M H;  1W2E A;  4ZUX A;  3X1V A;  1HQ3 D;  5DNN D;  4WZS B;  4YM6 B;  4G91 C;  1M1A C;  2YFW A;  1M18 B;  1M18 A;  3MGQ C;  5B2I C;  1U35 B;  3AZF B;  5B24 D;  4YM6 A;  1KX5 A;  3AV2 A;  1JFI B;  4JJN C;  1WWI A;  4YS3 D;  4Z66 B;  4G92 C;  2FJ7 D;  4ZUX B;  3WTP E;  3X1V B;  5AY8 C;  5B1L C;  2ZM5 A;  5CPI C;  4J8U B;  3UT9 C;  5BT1 D;  2ARO B;  5AV9 C;  4J8X B;  3WA9 C;  5AV9 B;  4XUJ B;  4J8X C;  1P3M A;  3AZJ D;  4H9P A;  3TU4 B;  1T3U A;  3AFA C;  3AZF D;  5B31 G;  5B2J D;  3AZN D;  3LJA B;  2Y2J A;  3MGR A;  5DNM B;  5F99 B;  3AZI D;  1P3L D;  3AN2 A;  3MGP B;  4LD9 D;  5GT3 C;  3REI C;  3MGQ A;  3REI B;  4Z2M G;  5KDM B;  1KX5 C;  3MGS D;  4AWL B;  4H9S A;  5AY8 B;  2F2A C;  3W97 C;  5B33 A;  5F99 C;  1S32 C;  5AV6 C;  1P3G B;  5FUG A;  4H9R B;  5GT3 B;  3B0D C;  1P3I B;  1KX4 B;  5B2I D;  2XD1 A;  3REJ D;  3AZK C;  2RVQ C;  4G91 B;  1P3O D;  3WAA B;  3VH5 W;  5B32 D;  3AYW D;  3AV1 A;  3X1T A;  2FJ7 C;  5CP6 C;  3W96 B;  2ARO C;  3AV1 B;  2HIO A;  3KSY A;  5AVB A;  5AV5 B;  3X1T B;  3WA9 B;  1P34 D;  4H9O A;  3A6N C;  5CPI D;  1M19 B;  3AZI B;  3LZ0 B;  3AZE B;  3KUY D;  5GT3 A;  4DQY B;  4Z5T A;  5CPK D;  1P3I A;  1KX4 A;  3TU4 D;  4KUD A;  4R8P C;  3AV2 C;  5B33 B;  3C1C B;  1P3P C;  1P3G A;  5AV6 A;  3AZI C;  1P3A D;  4J8U D;  2VQR A;  3MVD A;  5AV8 D;  1M1A B;  2RIQ A;  2NZD C;  4ZUX D;  3X1V D;  5BS7 A;  3B6F B;  2Y2O A;  5CPJ D;  3W97 D;  1AOI D;  1A7W A;  2IO5 B;  3AV1 C;  3X1T C;  2XD5 A;  3NQU B;  2ARO A;  5AVB C;  5JA4 B;  3B6G D;  3KWQ C;  3B6F C;  2PYO A;  1F66 B;  4WU8 D;  5AVC A;  2G5I C;  3X1S C;  5B0Z A;  3LEL A;  1AOI B;  5CP6 D;  3LZ0 A;  3C1B A;  1N1J A;  2CV5 C;  5CPJ B;  1EQZ B;  5BNV B;  3AZL A;  4X23 C;  3AZH A;  1F66 C;  3W96 A;  3UTB B;  5B31 B;  3W99 B;  2YFV B;  1ID3 D;  5B1M A;  2NQB C;  3TU4 C;  4R8P D;  3REH D;  1ZLA D;  3C1C D;  5GSU C;  3MGQ D;  1HQ3 C;  5DNN C;  1M1A D;  3AZG B;  3WKJ D;  3MGS A;  3WTP C;  1ULY A;  1F1E A;  2HIO C;  1KX3 B;  4WNN A;  1M19 D;  5BNX A;  3UT9 B;  4Z66 C;  1B6W A;  4G92 B;  5CHL B;  1AOI C;  3X1S A;  5KDM A;  1S32 B;  5E5A D;  3MGQ B;  4KGC A;  4CAY A;  4JJN A;  4DRA A;  3VH5 A;  4R8P B;  3V9R A;  5B32 A;  1P3P A;  1P3B C;  1P3K A;  4NE6 A;  3B0C W;  3VH5 T;  3WA9 D;  3AZL C;  4JJN B;  3AZH C;  3LJA A;  3AYW B;  2NZD A;  3VH6 W;  4WNN B;  3MNN B;  3REL A;  4J8V A;  2JCH A;  3UT9 A;  5AV9 A;  1Q9C A;  3A1K A;  5CP6 B;  3UTA B;  5B40 D;  2BYM B;  2CV5 D;  3MGS B;  1BH9 B;  3MGS C;  5GXQ B;  4LD9 C;  1P3F A;  4XUJ C;  3W98 D;  1F66 D;  1P3G D;  5AV6 D;  1P3A A;  2Y2G A;  3KWQ A;  5F99 D;  2F8N A;  3AN2 C;  4Z66 A;  3LZ1 D;  1B67 A;  5GSU D;  3UTA C;  1P3B B;  1WWS A;  3AZK D;  5CPJ A;  5B0Y A;  3W97 A;  5BNV A;  4J8X D;  3AYW C;  3LZ0 C;  4NFT A;  4KHA B;  1KX3 D;  1N1J B;  1EQZ A;  1P3O C;  1M19 C;  3REK B;  5B2J B;  3AZN B;  3KXB D;  3LEL B;  5AVC B;  4J8W D;  4J8W B;  4WU9 C;  4WU8 A;  3REH B;  1ZLA B;  1TZY A;  1P34 C;  2PYO B;  1TAF A;  1ID3 B;  3F6T A;  3AZM A;  5B0Z D;  1P3B D;  3KUY C;  5CPK C;  3AV2 D;  5GSU B;  1P3F C;  4YS3 A;  4UUZ B;  3LZ1 B;  3A6N A;  4J8U C;  3R45 A;  5CPI B;  2F8N G;  3W99 C;  2BYK A;  3UTB C;  4WU9 B;  3W96 D;  3W98 B;  2Y2P A;  1U35 D;  1TAF B;  1ID3 A;  5B1M D;  5CPJ C;  1H3O B;  2RVQ D;  4WU8 B;  3REH A;  3C1C A;  1ZLA A;  1P3O B;  4XZQ A;  5AV6 B;  1P3G C;  5B32 C;  3WKJ A;  5B2I B;  1M18 C;  3O62 B;  4KUD B;  5B32 G;  3MGR D;  3UTA D;  4WU8 C;  5AVB B;  3MNN D;  4H9N B;  3B6F D;  4QLC D;  3AL0 C;  5E5A B;  3P5J B;  4H9O B;  3B0C T;  4WV4 B;  3AZM C;  3X1U C;  5DNM C;  2HIO B;  5AV5 A;  4KGC D;  5GXQ C;  3MGP D;  4LD9 B;  2J8P A;  1P3P D;  1P3L B;  1P3A C;  5C3I B;  5AVC C;  3LJA D;  2BYM A;  2NZD D;  4X23 D;  5B2I A;  3A1I A;  3REL D;  1KU5 A;  5B0Z C;  4J8V D;  3AZE D;  3REH C;  3AZJ B;  1ZLA C;  3C1C C;  3C1B C;  3EPK A;  2CV5 A;  2NQB D;  3AYW A;  3X1T D;  3AV1 D;  3W99 D;  3REK C;  3H0M C;  5AY8 A;  5B1L A;  3UTB D;  2HIO D;  3AZG D;  3AN2 B;  3B6G C;  2Y2Q A;  3KWQ D;  3WTP D;  5CPI A;  4QLC B;  5F99 A;  5B1M C;  4Z66 D;  3LZ1 A;  3WAA D;  4WU9 A;  4YS3 B;  5G49 A;  5GSU A;  4H9Q A;  5DNM A;  3MGR B;  2HUE C;  4UUZ A;  4KUD D;  1P3M B;  5BO0 A;  1M18 D;  5B24 A;  4YM6 D;  1KX3 A;  5C3I C;  1EQZ D;  5E5A C;  2Y2M A;  4J8U A;  3KXB A;  1TZY B;  4J8W A;  3MVD D;  2FJ7 A;  2ZY2 A;  5B31 C;  2DQN C;  1BH8 B;  1TZY D;  4KGC C;  3W97 B;  5B0Y B;  5B40 C;  2YFV A;  1JFI A;  3B6G B;  1P3B A;  3WKJ C;  1P3M D;  5AV8 B;  3AV2 B;  3B6G A;  3AZF A;  2UWX A;  3C1B B;  3O62 C;  1P3A B;  4XUJ D;  2PYO D;  3W98 C;  3REL C;  4J8V C;  2F8N B;  3KWQ B;  4HGA C;  3AN2 D;  1BH9 A;  3X1U B;  1BH8 A;  5GT0 C;  3KXB B;  3LEL D;  2W8S A;  5CP6 A;  4XZQ D;  3REK D;  2BG1 A;  5GXQ A;  3LZ0 D;  2FJ7 B;  1KX3 C;  5JA4 A;  3AZL D;  2FFF B;  3AZH D;  3REL B;  5JRG C;  3AZK B;  2ZY3 A;  1Z2C B;  3KUY B;  5CPK B;  5B32 B;  4R8P A;  3B6F A;  4QLC A;  4H9Q B;  4ZBJ C;  1P3K B;  1M1A A;  5G49 B;  5AV5 D;  2F8N H;  4DRB A;  2F8N K;  1BFM A;  3MVD C;  2CV5 B;  5B2J C;  3AZN C;  3NQJ A;  3LZ1 C;  1TZY C;  3REJ B;  1U35 C;  1P34 A;  3KFU G;  4X23 A;  3W96 C;  3AZE A;  5GT0 A;  5GT3 D;  2IO5 C;  3REI D;  4NE5 A; 
#chains in the Genus database with same CATH homology
 4JJN D;  2NQB A;  2HUE B;  5B24 C;  1P3K D;  3WA9 A;  3W99 A;  5AY8 D;  5B1L D;  3UTB A;  3KXB C;  5JRG A;  4J8W C;  5B1M B;  1S32 D;  3WTP A;  5B31 A;  3WAA A;  2G5H C;  4WU9 D;  4M6B A;  5AV8 A;  3AZH B;  3MGR C;  3UT9 D;  5BT1 C;  3AZL B;  5AV9 D;  4XZQ C;  5B40 A;  4H9N A;  5DNM D;  4AWL C;  1AOI A;  1P3F D;  5FUG B;  5B0Z B;  3X1U D;  3AZJ C;  1F66 A;  3WKJ B;  3AFA D;  3AZF C;  4E45 A;  3O62 A;  5B33 C;  2ARO D;  2L5A A;  2F8N D;  3NQU A;  3EG5 B;  3B0B A;  4XZQ B;  1HQ3 A;  5DNN A;  1P3L C;  5B24 B;  4UPK A;  3AZE C;  5AVC D;  3LJA C;  1H3O A;  5BO0 B;  1KX5 D;  2BYK B;  3R45 B;  3C1B D;  4H9P B;  4XUJ A;  3WAA C;  3MVD B;  5B1L B;  3X1V C;  4ZUX C;  3MNN C;  1HQ3 B;  5DNN B;  3AZM B;  4QLC C;  3AZM D;  3REJ C;  4ZBJ B;  3B0D B;  1P3I C;  1P3K C;  4Z5T C;  1KX4 C;  4Z5T B;  3REK A;  5GXQ D;  3MGP C;  3AZJ A;  4KUD C;  5B40 B;  5B0Y C;  3VH6 T;  4E44 A;  5B2J A;  3A6N D;  1PZR A;  3AZN A;  2JSS A;  2Y2L A;  4KHA A;  3VH6 A;  3AZI A;  1M19 A;  1KX5 B;  1EQZ C;  1U35 A;  3WTP B;  1P3L A;  2YFW B;  4LD9 A;  2Y2N A;  3X1S D;  5BS7 C;  5JRG B;  2NQB B;  5E5A A;  2LY8 A;  4HGA B;  1P3M C;  4WJ3 C;  5B33 D;  4EO5 C;  3AFA B;  2JE5 A;  2Y2K A;  3AZG C;  4X23 B;  1P3F B;  3UTA A;  2DF4 C;  4YS3 C;  3EPH A;  5GT0 B;  3IP4 C;  4NE3 A;  3MNN A;  4H9R A;  5AV8 C;  2PYO C;  2ZY5 A;  3REJ A;  1P34 B;  4J8V B;  5GT0 D;  3EPJ A;  3REI A;  1P3O A;  3NQJ B;  3EPL A;  2CWE A;  3MGP A;  2NZD B;  4H9S C;  4YM6 C;  3FDD A;  4CSR B;  3LEL C;  3V9R B;  4CAY B;  3W98 A;  4CSR A;  5JRG D;  3H0R C;  5AVB D;  1S32 A;  1P3P B;  3X1S B;  3A6N B;  5B31 D;  4KGC B;  3KUY A;  5CPK A;  1P3I D;  4Z5T D;  1KX4 D;  2Y2I A;  3AZK A;  3TU4 A;  4EO5 B;  5B0Y D;  2Y2H A;  4J8X A;  5BNX B;  3X1U A;  1HTA A;  2ZY4 A;  5AV5 C;  3AZG A;  3AFA A;  1R4V A;  3O62 D;  3H0L C;  1ID3 C;  4Z2M H;  1W2E A;  4ZUX A;  3X1V A;  1HQ3 D;  5DNN D;  4WZS B;  4YM6 B;  4G91 C;  1M1A C;  2YFW A;  1M18 B;  1M18 A;  3MGQ C;  5B2I C;  1U35 B;  3AZF B;  5B24 D;  4YM6 A;  1KX5 A;  3AV2 A;  1JFI B;  4JJN C;  1WWI A;  4YS3 D;  4Z66 B;  4G92 C;  2FJ7 D;  4ZUX B;  3WTP E;  3X1V B;  5AY8 C;  5B1L C;  2ZM5 A;  5CPI C;  4J8U B;  3UT9 C;  5BT1 D;  2ARO B;  5AV9 C;  4J8X B;  3WA9 C;  5AV9 B;  4XUJ B;  4J8X C;  1P3M A;  3AZJ D;  4H9P A;  3TU4 B;  1T3U A;  3AFA C;  3AZF D;  5B31 G;  5B2J D;  3AZN D;  3LJA B;  2Y2J A;  3MGR A;  5DNM B;  5F99 B;  3AZI D;  1P3L D;  3AN2 A;  3MGP B;  4LD9 D;  5GT3 C;  3REI C;  3MGQ A;  3REI B;  4Z2M G;  5KDM B;  1KX5 C;  3MGS D;  4AWL B;  4H9S A;  5AY8 B;  2F2A C;  3W97 C;  5B33 A;  5F99 C;  1S32 C;  5AV6 C;  1P3G B;  5FUG A;  4H9R B;  5GT3 B;  3B0D C;  1P3I B;  1KX4 B;  5B2I D;  2XD1 A;  3REJ D;  3AZK C;  2RVQ C;  4G91 B;  1P3O D;  3WAA B;  3VH5 W;  5B32 D;  3AYW D;  3AV1 A;  3X1T A;  2FJ7 C;  5CP6 C;  3W96 B;  2ARO C;  3AV1 B;  2HIO A;  3KSY A;  5AVB A;  5AV5 B;  3X1T B;  3WA9 B;  1P34 D;  4H9O A;  3A6N C;  5CPI D;  1M19 B;  3AZI B;  3LZ0 B;  3AZE B;  3KUY D;  5GT3 A;  4DQY B;  4Z5T A;  5CPK D;  1P3I A;  1KX4 A;  3TU4 D;  4KUD A;  4R8P C;  3AV2 C;  5B33 B;  3C1C B;  1P3P C;  1P3G A;  5AV6 A;  3AZI C;  1P3A D;  4J8U D;  2VQR A;  3MVD A;  5AV8 D;  1M1A B;  2RIQ A;  2NZD C;  4ZUX D;  3X1V D;  5BS7 A;  3B6F B;  2Y2O A;  5CPJ D;  3W97 D;  1AOI D;  1A7W A;  2IO5 B;  3AV1 C;  3X1T C;  2XD5 A;  3NQU B;  2ARO A;  5AVB C;  5JA4 B;  3B6G D;  3KWQ C;  3B6F C;  2PYO A;  1F66 B;  4WU8 D;  5AVC A;  2G5I C;  3X1S C;  5B0Z A;  3LEL A;  1AOI B;  5CP6 D;  3LZ0 A;  3C1B A;  1N1J A;  2CV5 C;  5CPJ B;  1EQZ B;  5BNV B;  3AZL A;  4X23 C;  3AZH A;  1F66 C;  3W96 A;  3UTB B;  5B31 B;  3W99 B;  2YFV B;  1ID3 D;  5B1M A;  2NQB C;  3TU4 C;  4R8P D;  3REH D;  1ZLA D;  3C1C D;  5GSU C;  3MGQ D;  1HQ3 C;  5DNN C;  1M1A D;  3AZG B;  3WKJ D;  3MGS A;  3WTP C;  1ULY A;  1F1E A;  2HIO C;  1KX3 B;  4WNN A;  1M19 D;  5BNX A;  3UT9 B;  4Z66 C;  1B6W A;  4G92 B;  5CHL B;  1AOI C;  3X1S A;  5KDM A;  1S32 B;  5E5A D;  3MGQ B;  4KGC A;  4CAY A;  4JJN A;  4DRA A;  3VH5 A;  4R8P B;  3V9R A;  5B32 A;  1P3P A;  1P3B C;  1P3K A;  4NE6 A;  3B0C W;  3VH5 T;  3WA9 D;  3AZL C;  4JJN B;  3AZH C;  3LJA A;  3AYW B;  2NZD A;  3VH6 W;  4WNN B;  3MNN B;  3REL A;  4J8V A;  2JCH A;  3UT9 A;  5AV9 A;  1Q9C A;  3A1K A;  5CP6 B;  3UTA B;  5B40 D;  2BYM B;  2CV5 D;  3MGS B;  1BH9 B;  3MGS C;  5GXQ B;  4LD9 C;  1P3F A;  4XUJ C;  3W98 D;  1F66 D;  1P3G D;  5AV6 D;  1P3A A;  2Y2G A;  3KWQ A;  5F99 D;  2F8N A;  3AN2 C;  4Z66 A;  3LZ1 D;  1B67 A;  5GSU D;  3UTA C;  1P3B B;  1WWS A;  3AZK D;  5CPJ A;  5B0Y A;  3W97 A;  5BNV A;  4J8X D;  3AYW C;  3LZ0 C;  4NFT A;  4KHA B;  1KX3 D;  1N1J B;  1EQZ A;  1P3O C;  1M19 C;  3REK B;  5B2J B;  3AZN B;  3KXB D;  3LEL B;  5AVC B;  4J8W D;  4J8W B;  4WU9 C;  4WU8 A;  3REH B;  1ZLA B;  1TZY A;  1P34 C;  2PYO B;  1TAF A;  1ID3 B;  3F6T A;  3AZM A;  5B0Z D;  1P3B D;  3KUY C;  5CPK C;  3AV2 D;  5GSU B;  1P3F C;  4YS3 A;  4UUZ B;  3LZ1 B;  3A6N A;  4J8U C;  3R45 A;  5CPI B;  2F8N G;  3W99 C;  2BYK A;  3UTB C;  4WU9 B;  3W96 D;  3W98 B;  2Y2P A;  1U35 D;  1TAF B;  1ID3 A;  5B1M D;  5CPJ C;  1H3O B;  2RVQ D;  4WU8 B;  3REH A;  3C1C A;  1ZLA A;  1P3O B;  4XZQ A;  5AV6 B;  1P3G C;  5B32 C;  3WKJ A;  5B2I B;  1M18 C;  3O62 B;  4KUD B;  5B32 G;  3MGR D;  3UTA D;  4WU8 C;  5AVB B;  3MNN D;  4H9N B;  3B6F D;  4QLC D;  3AL0 C;  5E5A B;  3P5J B;  4H9O B;  3B0C T;  4WV4 B;  3AZM C;  3X1U C;  5DNM C;  2HIO B;  5AV5 A;  4KGC D;  5GXQ C;  3MGP D;  4LD9 B;  2J8P A;  1P3P D;  1P3L B;  1P3A C;  5C3I B;  5AVC C;  3LJA D;  2BYM A;  2NZD D;  4X23 D;  5B2I A;  3A1I A;  3REL D;  1KU5 A;  5B0Z C;  4J8V D;  3AZE D;  3REH C;  3AZJ B;  1ZLA C;  3C1C C;  3C1B C;  3EPK A;  2CV5 A;  2NQB D;  3AYW A;  3X1T D;  3AV1 D;  3W99 D;  3REK C;  3H0M C;  5AY8 A;  5B1L A;  3UTB D;  2HIO D;  3AZG D;  3AN2 B;  3B6G C;  2Y2Q A;  3KWQ D;  3WTP D;  5CPI A;  4QLC B;  5F99 A;  5B1M C;  4Z66 D;  3LZ1 A;  3WAA D;  4WU9 A;  4YS3 B;  5G49 A;  5GSU A;  4H9Q A;  5DNM A;  3MGR B;  2HUE C;  4UUZ A;  4KUD D;  1P3M B;  5BO0 A;  1M18 D;  5B24 A;  4YM6 D;  1KX3 A;  5C3I C;  1EQZ D;  5E5A C;  2Y2M A;  4J8U A;  3KXB A;  1TZY B;  4J8W A;  3MVD D;  2FJ7 A;  2ZY2 A;  5B31 C;  2DQN C;  1BH8 B;  1TZY D;  4KGC C;  3W97 B;  5B0Y B;  5B40 C;  2YFV A;  1JFI A;  3B6G B;  1P3B A;  3WKJ C;  1P3M D;  5AV8 B;  3AV2 B;  3B6G A;  3AZF A;  2UWX A;  3C1B B;  3O62 C;  1P3A B;  4XUJ D;  2PYO D;  3W98 C;  3REL C;  4J8V C;  2F8N B;  3KWQ B;  4HGA C;  3AN2 D;  1BH9 A;  3X1U B;  1BH8 A;  5GT0 C;  3KXB B;  3LEL D;  2W8S A;  5CP6 A;  4XZQ D;  3REK D;  2BG1 A;  5GXQ A;  3LZ0 D;  2FJ7 B;  1KX3 C;  5JA4 A;  3AZL D;  2FFF B;  3AZH D;  3REL B;  5JRG C;  3AZK B;  2ZY3 A;  1Z2C B;  3KUY B;  5CPK B;  5B32 B;  4R8P A;  3B6F A;  4QLC A;  4H9Q B;  4ZBJ C;  1P3K B;  1M1A A;  5G49 B;  5AV5 D;  2F8N H;  4DRB A;  2F8N K;  1BFM A;  3MVD C;  2CV5 B;  5B2J C;  3AZN C;  3NQJ A;  3LZ1 C;  1TZY C;  3REJ B;  1U35 C;  1P34 A;  3KFU G;  4X23 A;  3W96 C;  3AZE A;  5GT0 A;  5GT3 D;  2IO5 C;  3REI D;  4NE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...