3AZJA

Crystal structure of human nucleosome core particle containing h4k44q mutation
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azjA00
5B0ZD 3AZLA 3MGSA 1M18D 3VH6T 4NE3A 4WNNA 5GT0B 5B1MB 3AZIC 1KX4C 4H9OA 3V9RB 4Z5TD 5CP6B 5B2IB 1F66D 2AROC 5B40B 5GT0C 4R8PA 1P3LC 4JJNB 1P3GC 5C3IC 3X1SA 5B2IC 3MGQD 5B40C 5CPKC 1P3PA 1TAFA 1P3OB 5B2JA 4JJNC 5AV8A 5AVBB 3UTAD 1N1JB 5CPIA 1S32D 2NQBB 4LD9C 2F8ND 3AZGB 1A7WA 1P3OC 3LELD 1M1AA 1P3FD 3X1VB 3AZNA 5B1LC 5JRGB 2PYOC 3AZGC 5GSUD 3MNND 4DRAA 4XUJD 3TU4A 5DNMA 4YM6A 3UTBA 3X1VC 4H9SC 3KUYC 3C1CB 3AN2C 4WU9D 3AZID 2HIOA 3AFAD 5BS7A 3C1CC 2F8NG 4H9QA 3W96D 2AROD 4LD9B 5GT0D 1P3LD 1P3GD 3WKJD 5CPKD 3W97B 4M6BA 4KGCA 4YS3A 3LZ0B 1P3MD 4E45A 2LY8A 5B1LD 2PYOD 3W99A 1P34B 1ID3D 3REJC 3KUYD 3AN2D 3WTPB 5F99C 3AYWD 2JSSA 5AY8A 4KHAB 4J8XA 3AV2B 3MGPB 4X23B 3WTPC 4J8WC 2YFVA 1BH9A 3AV2C 1HQ3B 3MGPC 4X23C 3C1BB 3WA9B 5B32A 3AZEB 4J8UD 5B1MA 3V9RA 4Z66C 5CP6A 1HQ3C 5KDMB 1B67A 3C1BC 3WA9C 3A6ND 5B31D 4WV4B 4DRBA 3MVDC 3REKC 4H9RB 3AZFD 5AV5D 2NZDA 1F1EA 5AVBA 1N1JA 2NQBA 2CV5D 3REJD 1M19B 5F99D 2HUEB 5DNNB 5AV6B 3X1VA 1AOIB 5JRGA 2F8NK 1P3IB 4CAYB 4NFTA 5DNNC 5BNXB 4J8WD 3B6FB 4KUDC 1AOIC 3AZMA 5AV9B 3AV2D 5BT1C 1M18B 3MGRA 5B0YA 5AV9C 3REHD 4Z66D 1HQ3D 3KWQC 4Z5TB 5CPJD 1M18C 1F66B 3REKD 3MVDD 3W97A 4Z5TC 1F66C 3LZ0A 3MGQB 3KXBC 3B0CW 4G91B 4ZUXD 1S32B 3UTAB 3VH5W 3RELD 3MGQC 3AZJD 2BYMB 3LELB 4G91C 3R45B 1S32C 3AZLD 3MGSD 1P3FB 5GSUB 5DNND 5GXQA 3MNNB 4KUDD 1P34A 4XUJB 3MNNC 3WTPA 5B33B 4R8PD 5AVCC 3B0CT 2YFWB 4XUJC 4WU9B 5GT3A 3AZIB 3W98D 3KWQD 4X23A 3LZ1C 3AFAB 3W96B 5B2JD 5FUGB 2AROB 5B33C 4WU9C 1KX3B 1P3LB 4XZQC 3AFAC 1P3GB 3WA9A 3W96C 3AZEA 5C3IB 5CPKB 4E44A 3KXBD 4G92B 2L5AA 1KX3C 3AZHC 1P3MB 3WKJC 4QLCC 3WAAA 1B6WA 1Q9CA 4G92C 3NQJA 1BH8B 1P3MC 5B1LB 2PYOB 2F8NH 5G49B 2HIOD 1P3BC 3B6GD 1ID3B 4H9PB 1M19A 5AV6A 3KUYB 3AN2B 5AVCD 3AYWB 3UT9B 1P3IA 1ID3C 3LZ1D 4KGCD 3B6FA 5B33D 3AYWC 4Z2MG 5AV9A 3UT9C 4H9NB 4XZQD 5B0ZA 4WU8D 3X1TC 1WWSA 5B24A 1KX3D 4J8UB 3AZHD 4QLCD 1F66A 3W99D 1H3OB 5JA4B 3A6NB 4J8UC 1EQZD 1KX5B 5B31B 3AZFB 3A6NC 3AV1A 4UUZB 5AV5B 1KX5C 5B31C 3UTAA 1P3BD 4J8XD 2CV5B 1P3KC 2F8NA 2BYMA 3REJB 3LELA 3AZFC 5AV5C 3R45A 5E5AD 5F99B 2FJ7B 1P3FA 2CV5C 1U35D 3REID 5GSUA 5B32D 4J8WB 4J8VA 3UT9D 2FJ7C 3KSYA 3X1TD 3AZIA 1KX4A 3REHB 4Z66B 3AZKC 5FUGA 2AROA 2NZDD 5CPJB 1P3AC 5GT0A 1P3LA 4AWLB 3REHC 1P3GA 5B2IA 5CPKA 3REKB 5B40A 5B32G 3MVDB 5CPJC 2RVQD 4JJNA 4AWLC 1KX5D 1P3MA 3B0BA 4ZUXB 4LD9A 4CSRB 1P3KD 1P3OA 3RELB 3AZJB 1BH8A 4HGAC 3X1UD 1ZLAD 3VH5A 3AZMD 4ZUXC 5B1LA 2PYOA 5BNVB 5G49A 3AZGA 3AZLB 3MGSB 3RELC 3AZJC 5B0YD 4KUDB 2FJ7D 1ID3A 4H9OB 3LJAD 4H9SA 3AZLC 3MGSC 3KUYA 3AN2A 5B31G 4R8PB 1TZYD 4EO5B 3C1CA 3AZKD 3W98B 3KWQB 1P3AD 5B2JB 3O62D 4R8PC 4H9NA 4EO5C 1ULYA 3W98C 5B2JC 4J8UA 3KXBB 5AV8C 3AZNB 1H3OA 5GXQD 3A6NA 3AZNC 4UUZA 5AV5A 3TU4C 5DNMC 4YM6C 2HIOB 3REJA 3B6GB 5F99A 4ZBJC 5AVCB 2HIOC 2CWEA 5BS7C 3B6GC 3LZ1B 4KGCB 4J8WA 4KHAA 3VH5T 3AV2A 3X1SD 3MGPA 3WAAD 4XZQB 1P3PD 4WU8B 4KGCC 5AV8D 5CPID 4NE5A 4Z66A 1HQ3A 3AZHB 3C1BA 4WU8C 4QLCB 5CPJA 1M1AD 3W99B 1EQZB 5KDMA 3AZND 3REKA 3MVDA 3W99C 3TU4D 1EQZC 5DNMD 2IO5C 4YM6D 3UTBD 4CSRA 1P3BB 4H9RA 4J8XB 3RELA 5E5AB 5AY8C 1BH9B 5BNVA 4J8XC 1U35B 3REIB 5DNNA 5B32B 5B24D 4KUDA 5E5AC 1AOIA 4CAYA 1U35C 3REIC 5BNXA 5B32C 4YS3D 3X1TB 5B1MC 5CP6C 3W98A 3KWQA 5BO0B 1M18A 3AV1D 3NQUB 2NZDB 4Z5TA 3KXBA 2NZDC 5AVBC 2NQBC 4NE6A 3MGQA 1P3KB 4J8VD 2RVQC 1S32A 5AY8D 5JRGC 3X1UB 3AZMB 1ZLAB 3MGRB 5B0YB 1KX4D 3X1UC 1ZLAC 3AZMC 3B6GA 3LJAB 3MNNA 3MGRC 5CHLB 5B1MD 5B0YC 4XUJA 5AVCA 5CP6D 5B2ID 3LJAC 5B40D 3LZ1A 1TZYB 3AZKB 5B33A 4JJND 2YFWA 1KU5A 4WU9A 1P3AB 3O62B 1JFIB 4LD9D 4XZQA 3AFAA 1TZYC 4WU8A 3W96A 1P3OD 3W97C 3LZ0C 4WZSB 5AVBD 3B0DB 1KX3A 3O62C 2NQBD 2BYKB 3AZHA 1R4VA 3AZGD 3WKJA 4QLCA 3B0DC 5GXQB 1EQZA 3X1VD 4HGAB 5JRGD 5GXQC 1P34C 1BFMA 1P3BA 5GT3B 3C1CD 3WTPE 3MGRD 5E5AA 4WNNB 5GT3C 4H9PA 1U35A 3REIA 3WKJB 3AYWA 3UT9A 3W97D 3X1TA 3AZEC 3X1SB 3LZ0D 3WAAB 1P3PB 1TAFB 5AV8B 3NQJB 5CPIB 5BO0A 3WAAC 3X1SC 1P3PC 3NQUA 1M1AB 5CPIC 3VH6A 5JA4A 1P34D 1M1AC 1KX5A 5B31A 3TU4B 5DNMB 4YM6B 3UTBB 1M19C 1P3KA 1HTAA 3WTPD 3AZFA 2HUEC 5AV6C 4ZBJB 3X1UA 3UTBC 5GT3D 1P3IC 1ZLAA 2CV5A 3MGPD 4X23D 5B0ZB 3B6FC 4H9QB 5B24B 2FJ7A 3LJAA 3WA9D 5B0ZC 3C1BD 3AZED 5B24C 4YS3B 1TZYA 3AZKA 4YS3C 1P3AA 3AV1B 3O62A 1JFIA 3REHA 2F8NB 3VH6W 3AV1C 2BYKA 3UTAC 2IO5B 1M19D 3LELC 5AV6D 1AOID 4J8VB 4Z2MH 1P3ID 4ZUXA 1P3FC 5AY8B 5BT1D 5GSUC 3B6FD 3AZJA 1WWIA 4J8VC 2YFVB 5AV9D 1KX4B
chains in the Genus database with same CATH superfamily
3P5JB 5B0ZD 3AZLA 3MGSA 1M18D 3VH6T 4NE3A 4WNNA 5GT0B 5B1MB 3AZIC 1KX4C 4H9OA 3V9RB 4Z5TD 5CP6B 2Y2HA 5B2IB 1F66D 2AROC 5B40B 5GT0C 4R8PA 2FFFB 2W8SA 4JJNB 1P3LC 1P3GC 5C3IC 3X1SA 5B2IC 3MGQD 3EPLA 5B40C 5CPKC 1TAFA 1P3PA 5B2JA 1P3OB 4JJNC 5AV8A 5AVBB 3UTAD 1N1JB 5CPIA 1S32D 2ZY5A 2NQBB 4LD9C 2F8ND 3AZGB 1A7WA 1P3OC 3LELD 1M1AA 1P3FD 3X1VB 3AZNA 5B1LC 5JRGB 2PYOC 3AZGC 5GSUD 3MNND 4DRAA 4XUJD 3TU4A 5DNMA 4YM6A 3UTBA 3X1VC 4H9SC 3KUYC 3C1CB 3AN2C 4WU9D 3AZID 2HIOA 3AFAD 5BS7A 3C1CC 2F8NG 4H9QA 3W96D 2AROD 4LD9B 5GT0D 1P3LD 1P3GD 3WKJD 5CPKD 3W97B 4M6BA 4KGCA 4YS3A 3LZ0B 1P3MD 4E45A 2LY8A 2G5IC 2Y2MA 5B1LD 2PYOD 3W99A 2BG1A 1P34B 1ID3D 3REJC 3KUYD 3AN2D 3WTPB 5F99C 3AYWD 2JSSA 5AY8A 4KHAB 4J8XA 3AV2B 3MGPB 4X23B 3WTPC 4J8WC 2YFVA 2G5HC 1BH9A 3AV2C 1HQ3B 3MGPC 4X23C 3C1BB 3WA9B 5B32A 3AZEB 4J8UD 5B1MA 3V9RA 4Z66C 5CP6A 1HQ3C 5KDMB 1B67A 3C1BC 3WA9C 3A6ND 2Y2JA 5B31D 4WV4B 4DRBA 3MVDC 3REKC 4H9RB 3AZFD 5AV5D 2NZDA 1F1EA 5AVBA 1N1JA 2NQBA 2CV5D 3REJD 1M19B 3EG5B 2HUEB 5F99D 5DNNB 5AV6B 3X1VA 1AOIB 5JRGA 2F8NK 1P3IB 4CAYB 4NFTA 5DNNC 5BNXB 4J8WD 3B6FB 4KUDC 1AOIC 3AZMA 5AV9B 3AV2D 5BT1C 4DQYB 3MGRA 1M18B 5B0YA 2VQRA 5AV9C 3REHD 4Z66D 1HQ3D 3KWQC 4Z5TB 5CPJD 1M18C 1F66B 3REKD 3MVDD 3W97A 4Z5TC 1F66C 3LZ0A 3MGQB 3KXBC 3B0CW 4G91B 4ZUXD 1S32B 3UTAB 3VH5W 3RELD 3MGQC 3AZJD 2BYMB 3LELB 4G91C 3R45B 1S32C 3AZLD 3MGSD 1P3FB 5GSUB 5DNND 5GXQA 3MNNB 4KUDD 1P34A 4XUJB 3MNNC 3WTPA 5B33B 4R8PD 3B0CT 2YFWB 4XUJC 5AVCC 4WU9B 5GT3A 3AZIB 3W98D 3KWQD 4X23A 3LZ1C 3AFAB 3W96B 2F2AC 5B2JD 5FUGB 2AROB 5B33C 4WU9C 1KX3B 1P3LB 4XZQC 3AFAC 1P3GB 3WA9A 3W96C 3AZEA 5C3IB 5CPKB 4E44A 3KXBD 4G92B 2L5AA 1KX3C 3AZHC 1P3MB 3WKJC 4QLCC 3WAAA 1B6WA 1Q9CA 4G92C 3NQJA 1BH8B 1P3MC 5B1LB 2PYOB 2F8NH 5G49B 2HIOD 1P3BC 3B6GD 1ID3B 4H9PB 1M19A 5AV6A 3KUYB 3AN2B 5AVCD 3AYWB 3UT9B 1P3IA 1ID3C 3LZ1D 4KGCD 3B6FA 3EPHA 5B33D 3AYWC 4Z2MG 5AV9A 3UT9C 4H9NB 2RIQA 4XZQD 5B0ZA 4WU8D 3X1TC 1WWSA 5B24A 1KX3D 4J8UB 3AZHD 2DQNC 4QLCD 1F66A 3W99D 1H3OB 5JA4B 3A6NB 4J8UC 2DF4C 1EQZD 1KX5B 3KFUG 5B31B 3AZFB 3A6NC 3AV1A 4UUZB 5AV5B 1KX5C 5B31C 3UTAA 1W2EA 4J8XD 1P3BD 2CV5B 1P3KC 2F8NA 2BYMA 3REJB 3LELA 3AZFC 5AV5C 3IP4C 3R45A 5E5AD 5F99B 2FJ7B 1P3FA 2CV5C 1U35D 3REID 5GSUA 5B32D 4J8WB 4J8VA 3UT9D 2FJ7C 3KSYA 3X1TD 3AZIA 1KX4A 3REHB 4Z66B 3AZKC 5FUGA 2AROA 2NZDD 5CPJB 1P3AC 5GT0A 1P3LA 4AWLB 3REHC 1P3GA 5B2IA 5CPKA 3REKB 5B40A 5B32G 3MVDB 5CPJC 2RVQD 4JJNA 4AWLC 1KX5D 1P3MA 3B0BA 1Z2CB 4ZUXB 4LD9A 4CSRB 1P3KD 1P3OA 4WJ3C 3RELB 3AZJB 1BH8A 4HGAC 3X1UD 1ZLAD 3VH5A 3AZMD 4ZUXC 2UWXA 5B1LA 2PYOA 5BNVB 5G49A 3AZGA 3AZLB 3MGSB 3RELC 3AZJC 5B0YD 4KUDB 2FJ7D 1ID3A 4H9OB 3LJAD 4H9SA 3AZLC 3MGSC 3KUYA 3AN2A 2Y2IA 5B31G 4R8PB 1TZYD 4EO5B 3C1CA 3AZKD 3W98B 3KWQB 1P3AD 5B2JB 3O62D 4R8PC 4H9NA 4EO5C 1ULYA 3W98C 5B2JC 4J8UA 3KXBB 5AV8C 3AZNB 4UPKA 1H3OA 5GXQD 3A6NA 2XD1A 2ZM5A 3H0MC 3A1KA 3AZNC 4UUZA 5AV5A 3TU4C 5DNMC 4YM6C 2HIOB 3REJA 3B6GB 5F99A 4ZBJC 5AVCB 2HIOC 2CWEA 2JE5A 5BS7C 3B6GC 3LZ1B 4KGCB 4J8WA 1T3UA 2Y2PA 4KHAA 3VH5T 3AV2A 3X1SD 3MGPA 3WAAD 4XZQB 1P3PD 4WU8B 4KGCC 5AV8D 5CPID 2ZY3A 4NE5A 4Z66A 1HQ3A 3AZHB 3C1BA 4WU8C 4QLCB 5CPJA 1M1AD 2ZY4A 3W99B 1EQZB 5KDMA 3AZND 3REKA 3MVDA 3W99C 3TU4D 1PZRA 5DNMD 2IO5C 4YM6D 3UTBD 1EQZC 4CSRA 1P3BB 4H9RA 4J8XB 3RELA 2JCHA 5E5AB 5AY8C 1BH9B 5BNVA 4J8XC 1U35B 3REIB 5DNNA 5B32B 5B24D 4KUDA 5E5AC 1AOIA 4CAYA 1U35C 3REIC 5BNXA 2ZY2A 5B32C 4YS3D 3X1TB 5B1MC 5CP6C 3W98A 3KWQA 5BO0B 1M18A 3AV1D 3NQUB 2NZDB 4Z5TA 3KXBA 2NZDC 5AVBC 2NQBC 3A1IA 4NE6A 3MGQA 1P3KB 4J8VD 2RVQC 1S32A 5AY8D 5JRGC 3X1UB 3AZMB 1ZLAB 3MGRB 2XD5A 5B0YB 1KX4D 3X1UC 1ZLAC 3AZMC 3B6GA 3LJAB 3MNNA 3MGRC 5CHLB 5B1MD 5B0YC 4XUJA 5AVCA 2Y2GA 5CP6D 5B2ID 3LJAC 5B40D 3LZ1A 1TZYB 3AZKB 5B33A 4JJND 2YFWA 1KU5A 4WU9A 1P3AB 3O62B 1JFIB 4LD9D 4XZQA 3AFAA 1TZYC 4WU8A 3W96A 1P3OD 3W97C 3LZ0C 3EPKA 4WZSB 5AVBD 3B0DB 1KX3A 3O62C 2NQBD 2BYKB 3AZHA 1R4VA 3AZGD 3WKJA 4QLCA 2Y2QA 3B0DC 5GXQB 1EQZA 3X1VD 4HGAB 5JRGD 5GXQC 1P34C 1BFMA 1P3BA 5GT3B 3FDDA 3C1CD 3WTPE 3MGRD 5E5AA 4WNNB 5GT3C 4H9PA 1U35A 3REIA 3WKJB 2Y2LA 3AYWA 3UT9A 3W97D 3X1TA 3AZEC 3X1SB 3LZ0D 3WAAB 1P3PB 1TAFB 5AV8B 3NQJB 5CPIB 5BO0A 2Y2NA 3WAAC 3X1SC 1P3PC 3NQUA 1M1AB 5CPIC 3VH6A 3EPJA 5JA4A 2Y2KA 1P34D 1M1AC 1KX5A 5B31A 3TU4B 5DNMB 4YM6B 3UTBB 1M19C 3H0RC 1P3KA 1HTAA 3WTPD 3AZFA 2HUEC 5AV6C 4ZBJB 3X1UA 3UTBC 5GT3D 1P3IC 1ZLAA 2CV5A 3F6TA 3MGPD 4X23D 5B0ZB 3B6FC 4H9QB 2J8PA 5B24B 2FJ7A 3LJAA 3WA9D 5B0ZC 3C1BD 3AZED 5B24C 4YS3B 3H0LC 1TZYA 3AZKA 4YS3C 1P3AA 3AV1B 3O62A 1JFIA 3REHA 2F8NB 3VH6W 3AV1C 2BYKA 3UTAC 2IO5B 1M19D 3LELC 5AV6D 1AOID 4J8VB 4Z2MH 1P3ID 4ZUXA 1P3FC 3AL0C 5AY8B 5BT1D 5GSUC 3B6FD 3AZJA 1WWIA 2Y2OA 4J8VC 2YFVB 5AV9D 1KX4B
chains in the Genus database with same CATH topology
3P5JB 5B0ZD 3AZLA 3MGSA 1M18D 3VH6T 4NE3A 4WNNA 5GT0B 5B1MB 3AZIC 1KX4C 4H9OA 3V9RB 4Z5TD 5CP6B 2Y2HA 5B2IB 1F66D 2AROC 5B40B 5GT0C 4R8PA 2FFFB 2W8SA 4JJNB 1P3LC 1P3GC 5C3IC 3X1SA 5B2IC 3MGQD 3EPLA 5B40C 5CPKC 1TAFA 1P3PA 5B2JA 1P3OB 4JJNC 5AV8A 5AVBB 3UTAD 1N1JB 5CPIA 1S32D 2ZY5A 2NQBB 4LD9C 2F8ND 3AZGB 1A7WA 1P3OC 3LELD 1M1AA 1P3FD 3X1VB 3AZNA 5B1LC 5JRGB 2PYOC 3AZGC 5GSUD 3MNND 4DRAA 4XUJD 3TU4A 5DNMA 4YM6A 3UTBA 3X1VC 4H9SC 3KUYC 3C1CB 3AN2C 4WU9D 3AZID 2HIOA 3AFAD 5BS7A 3C1CC 2F8NG 4H9QA 3W96D 2AROD 4LD9B 5GT0D 1P3LD 1P3GD 3WKJD 5CPKD 3W97B 4M6BA 4KGCA 4YS3A 3LZ0B 1P3MD 4E45A 2LY8A 2G5IC 2Y2MA 5B1LD 2PYOD 3W99A 2BG1A 1P34B 1ID3D 3REJC 3KUYD 3AN2D 3WTPB 5F99C 3AYWD 2JSSA 5AY8A 4KHAB 4J8XA 3AV2B 3MGPB 4X23B 3WTPC 4J8WC 2YFVA 2G5HC 1BH9A 3AV2C 1HQ3B 3MGPC 4X23C 3C1BB 3WA9B 5B32A 3AZEB 4J8UD 5B1MA 3V9RA 4Z66C 5CP6A 1HQ3C 5KDMB 1B67A 3C1BC 3WA9C 3A6ND 2Y2JA 5B31D 4WV4B 4DRBA 3MVDC 3REKC 4H9RB 3AZFD 5AV5D 2NZDA 1F1EA 5AVBA 1N1JA 2NQBA 2CV5D 3REJD 1M19B 3EG5B 2HUEB 5F99D 5DNNB 5AV6B 3X1VA 1AOIB 5JRGA 2F8NK 1P3IB 4CAYB 4NFTA 5DNNC 5BNXB 4J8WD 3B6FB 4KUDC 1AOIC 3AZMA 5AV9B 3AV2D 5BT1C 4DQYB 3MGRA 1M18B 5B0YA 2VQRA 5AV9C 3REHD 4Z66D 1HQ3D 3KWQC 4Z5TB 5CPJD 1M18C 1F66B 3REKD 3MVDD 3W97A 4Z5TC 1F66C 3LZ0A 3MGQB 3KXBC 3B0CW 4G91B 4ZUXD 1S32B 3UTAB 3VH5W 3RELD 3MGQC 3AZJD 2BYMB 3LELB 4G91C 3R45B 1S32C 3AZLD 3MGSD 1P3FB 5GSUB 5DNND 5GXQA 3MNNB 4KUDD 1P34A 4XUJB 3MNNC 3WTPA 5B33B 4R8PD 3B0CT 2YFWB 4XUJC 5AVCC 4WU9B 5GT3A 3AZIB 3W98D 3KWQD 4X23A 3LZ1C 3AFAB 3W96B 2F2AC 5B2JD 5FUGB 2AROB 5B33C 4WU9C 1KX3B 1P3LB 4XZQC 3AFAC 1P3GB 3WA9A 3W96C 3AZEA 5C3IB 5CPKB 4E44A 3KXBD 4G92B 2L5AA 1KX3C 3AZHC 1P3MB 3WKJC 4QLCC 3WAAA 1B6WA 1Q9CA 4G92C 3NQJA 1BH8B 1P3MC 5B1LB 2PYOB 2F8NH 5G49B 2HIOD 1P3BC 3B6GD 1ID3B 4H9PB 1M19A 5AV6A 3KUYB 3AN2B 5AVCD 3AYWB 3UT9B 1P3IA 1ID3C 3LZ1D 4KGCD 3B6FA 3EPHA 5B33D 3AYWC 4Z2MG 5AV9A 3UT9C 4H9NB 2RIQA 4XZQD 5B0ZA 4WU8D 3X1TC 1WWSA 5B24A 1KX3D 4J8UB 3AZHD 2DQNC 4QLCD 1F66A 3W99D 1H3OB 5JA4B 3A6NB 4J8UC 2DF4C 1EQZD 1KX5B 3KFUG 5B31B 3AZFB 3A6NC 3AV1A 4UUZB 5AV5B 1KX5C 5B31C 3UTAA 1W2EA 4J8XD 1P3BD 2CV5B 1P3KC 2F8NA 2BYMA 3REJB 3LELA 3AZFC 5AV5C 3IP4C 3R45A 5E5AD 5F99B 2FJ7B 1P3FA 2CV5C 1U35D 3REID 5GSUA 5B32D 4J8WB 4J8VA 3UT9D 2FJ7C 3KSYA 3X1TD 3AZIA 1KX4A 3REHB 4Z66B 3AZKC 5FUGA 2AROA 2NZDD 5CPJB 1P3AC 5GT0A 1P3LA 4AWLB 3REHC 1P3GA 5B2IA 5CPKA 3REKB 5B40A 5B32G 3MVDB 5CPJC 2RVQD 4JJNA 4AWLC 1KX5D 1P3MA 3B0BA 1Z2CB 4ZUXB 4LD9A 4CSRB 1P3KD 1P3OA 4WJ3C 3RELB 3AZJB 1BH8A 4HGAC 3X1UD 1ZLAD 3VH5A 3AZMD 4ZUXC 2UWXA 5B1LA 2PYOA 5BNVB 5G49A 3AZGA 3AZLB 3MGSB 3RELC 3AZJC 5B0YD 4KUDB 2FJ7D 1ID3A 4H9OB 3LJAD 4H9SA 3AZLC 3MGSC 3KUYA 3AN2A 2Y2IA 5B31G 4R8PB 1TZYD 4EO5B 3C1CA 3AZKD 3W98B 3KWQB 1P3AD 5B2JB 3O62D 4R8PC 4H9NA 4EO5C 1ULYA 3W98C 5B2JC 4J8UA 3KXBB 5AV8C 3AZNB 4UPKA 1H3OA 5GXQD 3A6NA 2XD1A 2ZM5A 3H0MC 3A1KA 3AZNC 4UUZA 5AV5A 3TU4C 5DNMC 4YM6C 2HIOB 3REJA 3B6GB 5F99A 4ZBJC 5AVCB 2HIOC 2CWEA 2JE5A 5BS7C 3B6GC 3LZ1B 4KGCB 4J8WA 1T3UA 2Y2PA 4KHAA 3VH5T 3AV2A 3X1SD 3MGPA 3WAAD 4XZQB 1P3PD 4WU8B 4KGCC 5AV8D 5CPID 2ZY3A 4NE5A 4Z66A 1HQ3A 3AZHB 3C1BA 4WU8C 4QLCB 5CPJA 1M1AD 2ZY4A 3W99B 1EQZB 5KDMA 3AZND 3REKA 3MVDA 3W99C 3TU4D 1PZRA 5DNMD 2IO5C 4YM6D 3UTBD 1EQZC 4CSRA 1P3BB 4H9RA 4J8XB 3RELA 2JCHA 5E5AB 5AY8C 1BH9B 5BNVA 4J8XC 1U35B 3REIB 5DNNA 5B32B 5B24D 4KUDA 5E5AC 1AOIA 4CAYA 1U35C 3REIC 5BNXA 2ZY2A 5B32C 4YS3D 3X1TB 5B1MC 5CP6C 3W98A 3KWQA 5BO0B 1M18A 3AV1D 3NQUB 2NZDB 4Z5TA 3KXBA 2NZDC 5AVBC 2NQBC 3A1IA 4NE6A 3MGQA 1P3KB 4J8VD 2RVQC 1S32A 5AY8D 5JRGC 3X1UB 3AZMB 1ZLAB 3MGRB 2XD5A 5B0YB 1KX4D 3X1UC 1ZLAC 3AZMC 3B6GA 3LJAB 3MNNA 3MGRC 5CHLB 5B1MD 5B0YC 4XUJA 5AVCA 2Y2GA 5CP6D 5B2ID 3LJAC 5B40D 3LZ1A 1TZYB 3AZKB 5B33A 4JJND 2YFWA 1KU5A 4WU9A 1P3AB 3O62B 1JFIB 4LD9D 4XZQA 3AFAA 1TZYC 4WU8A 3W96A 1P3OD 3W97C 3LZ0C 3EPKA 4WZSB 5AVBD 3B0DB 1KX3A 3O62C 2NQBD 2BYKB 3AZHA 1R4VA 3AZGD 3WKJA 4QLCA 2Y2QA 3B0DC 5GXQB 1EQZA 3X1VD 4HGAB 5JRGD 5GXQC 1P34C 1BFMA 1P3BA 5GT3B 3FDDA 3C1CD 3WTPE 3MGRD 5E5AA 4WNNB 5GT3C 4H9PA 1U35A 3REIA 3WKJB 2Y2LA 3AYWA 3UT9A 3W97D 3X1TA 3AZEC 3X1SB 3LZ0D 3WAAB 1P3PB 1TAFB 5AV8B 3NQJB 5CPIB 5BO0A 2Y2NA 3WAAC 3X1SC 1P3PC 3NQUA 1M1AB 5CPIC 3VH6A 3EPJA 5JA4A 2Y2KA 1P34D 1M1AC 1KX5A 5B31A 3TU4B 5DNMB 4YM6B 3UTBB 1M19C 3H0RC 1P3KA 1HTAA 3WTPD 3AZFA 2HUEC 5AV6C 4ZBJB 3X1UA 3UTBC 5GT3D 1P3IC 1ZLAA 2CV5A 3F6TA 3MGPD 4X23D 5B0ZB 3B6FC 4H9QB 2J8PA 5B24B 2FJ7A 3LJAA 3WA9D 5B0ZC 3C1BD 3AZED 5B24C 4YS3B 3H0LC 1TZYA 3AZKA 4YS3C 1P3AA 3AV1B 3O62A 1JFIA 3REHA 2F8NB 3VH6W 3AV1C 2BYKA 3UTAC 2IO5B 1M19D 3LELC 5AV6D 1AOID 4J8VB 4Z2MH 1P3ID 4ZUXA 1P3FC 3AL0C 5AY8B 5BT1D 5GSUC 3B6FD 3AZJA 1WWIA 2Y2OA 4J8VC 2YFVB 5AV9D 1KX4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Z D;  3AZL A;  3MGS A;  1M18 D;  3VH6 T;  4NE3 A;  4WNN A;  5GT0 B;  5B1M B;  3AZI C;  1KX4 C;  4H9O A;  3V9R B;  4Z5T D;  5CP6 B;  5B2I B;  1F66 D;  2ARO C;  5B40 B;  5GT0 C;  4R8P A;  1P3L C;  4JJN B;  1P3G C;  5C3I C;  3X1S A;  5B2I C;  3MGQ D;  5B40 C;  5CPK C;  1P3P A;  1TAF A;  1P3O B;  5B2J A;  4JJN C;  5AV8 A;  5AVB B;  3UTA D;  1N1J B;  5CPI A;  1S32 D;  2NQB B;  4LD9 C;  2F8N D;  3AZG B;  1A7W A;  1P3O C;  3LEL D;  1M1A A;  1P3F D;  3X1V B;  3AZN A;  5B1L C;  5JRG B;  2PYO C;  3AZG C;  5GSU D;  3MNN D;  4DRA A;  4XUJ D;  3TU4 A;  5DNM A;  4YM6 A;  3UTB A;  3X1V C;  4H9S C;  3KUY C;  3C1C B;  3AN2 C;  4WU9 D;  3AZI D;  2HIO A;  3AFA D;  5BS7 A;  3C1C C;  2F8N G;  4H9Q A;  3W96 D;  2ARO D;  4LD9 B;  5GT0 D;  1P3L D;  1P3G D;  3WKJ D;  5CPK D;  3W97 B;  4M6B A;  4KGC A;  4YS3 A;  3LZ0 B;  1P3M D;  4E45 A;  2LY8 A;  5B1L D;  2PYO D;  3W99 A;  1P34 B;  1ID3 D;  3REJ C;  3KUY D;  3AN2 D;  3WTP B;  5F99 C;  3AYW D;  2JSS A;  5AY8 A;  4KHA B;  4J8X A;  3AV2 B;  3MGP B;  4X23 B;  3WTP C;  4J8W C;  2YFV A;  1BH9 A;  3AV2 C;  1HQ3 B;  3MGP C;  4X23 C;  3C1B B;  3WA9 B;  5B32 A;  3AZE B;  4J8U D;  5B1M A;  3V9R A;  4Z66 C;  5CP6 A;  1HQ3 C;  5KDM B;  1B67 A;  3C1B C;  3WA9 C;  3A6N D;  5B31 D;  4WV4 B;  4DRB A;  3MVD C;  3REK C;  4H9R B;  3AZF D;  5AV5 D;  2NZD A;  1F1E A;  5AVB A;  1N1J A;  2NQB A;  2CV5 D;  3REJ D;  1M19 B;  5F99 D;  2HUE B;  5DNN B;  5AV6 B;  3X1V A;  1AOI B;  5JRG A;  2F8N K;  1P3I B;  4CAY B;  4NFT A;  5DNN C;  5BNX B;  4J8W D;  3B6F B;  4KUD C;  1AOI C;  3AZM A;  5AV9 B;  3AV2 D;  5BT1 C;  1M18 B;  3MGR A;  5B0Y A;  5AV9 C;  3REH D;  4Z66 D;  1HQ3 D;  3KWQ C;  4Z5T B;  5CPJ D;  1M18 C;  1F66 B;  3REK D;  3MVD D;  3W97 A;  4Z5T C;  1F66 C;  3LZ0 A;  3MGQ B;  3KXB C;  3B0C W;  4G91 B;  4ZUX D;  1S32 B;  3UTA B;  3VH5 W;  3REL D;  3MGQ C;  3AZJ D;  2BYM B;  3LEL B;  4G91 C;  3R45 B;  1S32 C;  3AZL D;  3MGS D;  1P3F B;  5GSU B;  5DNN D;  5GXQ A;  3MNN B;  4KUD D;  1P34 A;  4XUJ B;  3MNN C;  3WTP A;  5B33 B;  4R8P D;  5AVC C;  3B0C T;  2YFW B;  4XUJ C;  4WU9 B;  5GT3 A;  3AZI B;  3W98 D;  3KWQ D;  4X23 A;  3LZ1 C;  3AFA B;  3W96 B;  5B2J D;  5FUG B;  2ARO B;  5B33 C;  4WU9 C;  1KX3 B;  1P3L B;  4XZQ C;  3AFA C;  1P3G B;  3WA9 A;  3W96 C;  3AZE A;  5C3I B;  5CPK B;  4E44 A;  3KXB D;  4G92 B;  2L5A A;  1KX3 C;  3AZH C;  1P3M B;  3WKJ C;  4QLC C;  3WAA A;  1B6W A;  1Q9C A;  4G92 C;  3NQJ A;  1BH8 B;  1P3M C;  5B1L B;  2PYO B;  2F8N H;  5G49 B;  2HIO D;  1P3B C;  3B6G D;  1ID3 B;  4H9P B;  1M19 A;  5AV6 A;  3KUY B;  3AN2 B;  5AVC D;  3AYW B;  3UT9 B;  1P3I A;  1ID3 C;  3LZ1 D;  4KGC D;  3B6F A;  5B33 D;  3AYW C;  4Z2M G;  5AV9 A;  3UT9 C;  4H9N B;  4XZQ D;  5B0Z A;  4WU8 D;  3X1T C;  1WWS A;  5B24 A;  1KX3 D;  4J8U B;  3AZH D;  4QLC D;  1F66 A;  3W99 D;  1H3O B;  5JA4 B;  3A6N B;  4J8U C;  1EQZ D;  1KX5 B;  5B31 B;  3AZF B;  3A6N C;  3AV1 A;  4UUZ B;  5AV5 B;  1KX5 C;  5B31 C;  3UTA A;  1P3B D;  4J8X D;  2CV5 B;  1P3K C;  2F8N A;  2BYM A;  3REJ B;  3LEL A;  3AZF C;  5AV5 C;  3R45 A;  5E5A D;  5F99 B;  2FJ7 B;  1P3F A;  2CV5 C;  1U35 D;  3REI D;  5GSU A;  5B32 D;  4J8W B;  4J8V A;  3UT9 D;  2FJ7 C;  3KSY A;  3X1T D;  3AZI A;  1KX4 A;  3REH B;  4Z66 B;  3AZK C;  5FUG A;  2ARO A;  2NZD D;  5CPJ B;  1P3A C;  5GT0 A;  1P3L A;  4AWL B;  3REH C;  1P3G A;  5B2I A;  5CPK A;  3REK B;  5B40 A;  5B32 G;  3MVD B;  5CPJ C;  2RVQ D;  4JJN A;  4AWL C;  1KX5 D;  1P3M A;  3B0B A;  4ZUX B;  4LD9 A;  4CSR B;  1P3K D;  1P3O A;  3REL B;  3AZJ B;  1BH8 A;  4HGA C;  3X1U D;  1ZLA D;  3VH5 A;  3AZM D;  4ZUX C;  5B1L A;  2PYO A;  5BNV B;  5G49 A;  3AZG A;  3AZL B;  3MGS B;  3REL C;  3AZJ C;  5B0Y D;  4KUD B;  2FJ7 D;  1ID3 A;  4H9O B;  3LJA D;  4H9S A;  3AZL C;  3MGS C;  3KUY A;  3AN2 A;  5B31 G;  4R8P B;  1TZY D;  4EO5 B;  3C1C A;  3AZK D;  3W98 B;  3KWQ B;  1P3A D;  5B2J B;  3O62 D;  4R8P C;  4H9N A;  4EO5 C;  1ULY A;  3W98 C;  5B2J C;  4J8U A;  3KXB B;  5AV8 C;  3AZN B;  1H3O A;  5GXQ D;  3A6N A;  3AZN C;  4UUZ A;  5AV5 A;  3TU4 C;  5DNM C;  4YM6 C;  2HIO B;  3REJ A;  3B6G B;  5F99 A;  4ZBJ C;  5AVC B;  2HIO C;  2CWE A;  5BS7 C;  3B6G C;  3LZ1 B;  4KGC B;  4J8W A;  4KHA A;  3VH5 T;  3AV2 A;  3X1S D;  3MGP A;  3WAA D;  4XZQ B;  1P3P D;  4WU8 B;  4KGC C;  5AV8 D;  5CPI D;  4NE5 A;  4Z66 A;  1HQ3 A;  3AZH B;  3C1B A;  4WU8 C;  4QLC B;  5CPJ A;  1M1A D;  3W99 B;  1EQZ B;  5KDM A;  3AZN D;  3REK A;  3MVD A;  3W99 C;  3TU4 D;  1EQZ C;  5DNM D;  2IO5 C;  4YM6 D;  3UTB D;  4CSR A;  1P3B B;  4H9R A;  4J8X B;  3REL A;  5E5A B;  5AY8 C;  1BH9 B;  5BNV A;  4J8X C;  1U35 B;  3REI B;  5DNN A;  5B32 B;  5B24 D;  4KUD A;  5E5A C;  1AOI A;  4CAY A;  1U35 C;  3REI C;  5BNX A;  5B32 C;  4YS3 D;  3X1T B;  5B1M C;  5CP6 C;  3W98 A;  3KWQ A;  5BO0 B;  1M18 A;  3AV1 D;  3NQU B;  2NZD B;  4Z5T A;  3KXB A;  2NZD C;  5AVB C;  2NQB C;  4NE6 A;  3MGQ A;  1P3K B;  4J8V D;  2RVQ C;  1S32 A;  5AY8 D;  5JRG C;  3X1U B;  3AZM B;  1ZLA B;  3MGR B;  5B0Y B;  1KX4 D;  3X1U C;  1ZLA C;  3AZM C;  3B6G A;  3LJA B;  3MNN A;  3MGR C;  5CHL B;  5B1M D;  5B0Y C;  4XUJ A;  5AVC A;  5CP6 D;  5B2I D;  3LJA C;  5B40 D;  3LZ1 A;  1TZY B;  3AZK B;  5B33 A;  4JJN D;  2YFW A;  1KU5 A;  4WU9 A;  1P3A B;  3O62 B;  1JFI B;  4LD9 D;  4XZQ A;  3AFA A;  1TZY C;  4WU8 A;  3W96 A;  1P3O D;  3W97 C;  3LZ0 C;  4WZS B;  5AVB D;  3B0D B;  1KX3 A;  3O62 C;  2NQB D;  2BYK B;  3AZH A;  1R4V A;  3AZG D;  3WKJ A;  4QLC A;  3B0D C;  5GXQ B;  1EQZ A;  3X1V D;  4HGA B;  5JRG D;  5GXQ C;  1P34 C;  1BFM A;  1P3B A;  5GT3 B;  3C1C D;  3WTP E;  3MGR D;  5E5A A;  4WNN B;  5GT3 C;  4H9P A;  1U35 A;  3REI A;  3WKJ B;  3AYW A;  3UT9 A;  3W97 D;  3X1T A;  3AZE C;  3X1S B;  3LZ0 D;  3WAA B;  1P3P B;  1TAF B;  5AV8 B;  3NQJ B;  5CPI B;  5BO0 A;  3WAA C;  3X1S C;  1P3P C;  3NQU A;  1M1A B;  5CPI C;  3VH6 A;  5JA4 A;  1P34 D;  1M1A C;  1KX5 A;  5B31 A;  3TU4 B;  5DNM B;  4YM6 B;  3UTB B;  1M19 C;  1P3K A;  1HTA A;  3WTP D;  3AZF A;  2HUE C;  5AV6 C;  4ZBJ B;  3X1U A;  3UTB C;  5GT3 D;  1P3I C;  1ZLA A;  2CV5 A;  3MGP D;  4X23 D;  5B0Z B;  3B6F C;  4H9Q B;  5B24 B;  2FJ7 A;  3LJA A;  3WA9 D;  5B0Z C;  3C1B D;  3AZE D;  5B24 C;  4YS3 B;  1TZY A;  3AZK A;  4YS3 C;  1P3A A;  3AV1 B;  3O62 A;  1JFI A;  3REH A;  2F8N B;  3VH6 W;  3AV1 C;  2BYK A;  3UTA C;  2IO5 B;  1M19 D;  3LEL C;  5AV6 D;  1AOI D;  4J8V B;  4Z2M H;  1P3I D;  4ZUX A;  1P3F C;  5AY8 B;  5BT1 D;  5GSU C;  3B6F D;  3AZJ A;  1WWI A;  4J8V C;  2YFV B;  5AV9 D;  1KX4 B; 
#chains in the Genus database with same CATH topology
 3P5J B;  5B0Z D;  3AZL A;  3MGS A;  1M18 D;  3VH6 T;  4NE3 A;  4WNN A;  5GT0 B;  5B1M B;  3AZI C;  1KX4 C;  4H9O A;  3V9R B;  4Z5T D;  5CP6 B;  2Y2H A;  5B2I B;  1F66 D;  2ARO C;  5B40 B;  5GT0 C;  4R8P A;  2FFF B;  2W8S A;  4JJN B;  1P3L C;  1P3G C;  5C3I C;  3X1S A;  5B2I C;  3MGQ D;  3EPL A;  5B40 C;  5CPK C;  1TAF A;  1P3P A;  5B2J A;  1P3O B;  4JJN C;  5AV8 A;  5AVB B;  3UTA D;  1N1J B;  5CPI A;  1S32 D;  2ZY5 A;  2NQB B;  4LD9 C;  2F8N D;  3AZG B;  1A7W A;  1P3O C;  3LEL D;  1M1A A;  1P3F D;  3X1V B;  3AZN A;  5B1L C;  5JRG B;  2PYO C;  3AZG C;  5GSU D;  3MNN D;  4DRA A;  4XUJ D;  3TU4 A;  5DNM A;  4YM6 A;  3UTB A;  3X1V C;  4H9S C;  3KUY C;  3C1C B;  3AN2 C;  4WU9 D;  3AZI D;  2HIO A;  3AFA D;  5BS7 A;  3C1C C;  2F8N G;  4H9Q A;  3W96 D;  2ARO D;  4LD9 B;  5GT0 D;  1P3L D;  1P3G D;  3WKJ D;  5CPK D;  3W97 B;  4M6B A;  4KGC A;  4YS3 A;  3LZ0 B;  1P3M D;  4E45 A;  2LY8 A;  2G5I C;  2Y2M A;  5B1L D;  2PYO D;  3W99 A;  2BG1 A;  1P34 B;  1ID3 D;  3REJ C;  3KUY D;  3AN2 D;  3WTP B;  5F99 C;  3AYW D;  2JSS A;  5AY8 A;  4KHA B;  4J8X A;  3AV2 B;  3MGP B;  4X23 B;  3WTP C;  4J8W C;  2YFV A;  2G5H C;  1BH9 A;  3AV2 C;  1HQ3 B;  3MGP C;  4X23 C;  3C1B B;  3WA9 B;  5B32 A;  3AZE B;  4J8U D;  5B1M A;  3V9R A;  4Z66 C;  5CP6 A;  1HQ3 C;  5KDM B;  1B67 A;  3C1B C;  3WA9 C;  3A6N D;  2Y2J A;  5B31 D;  4WV4 B;  4DRB A;  3MVD C;  3REK C;  4H9R B;  3AZF D;  5AV5 D;  2NZD A;  1F1E A;  5AVB A;  1N1J A;  2NQB A;  2CV5 D;  3REJ D;  1M19 B;  3EG5 B;  2HUE B;  5F99 D;  5DNN B;  5AV6 B;  3X1V A;  1AOI B;  5JRG A;  2F8N K;  1P3I B;  4CAY B;  4NFT A;  5DNN C;  5BNX B;  4J8W D;  3B6F B;  4KUD C;  1AOI C;  3AZM A;  5AV9 B;  3AV2 D;  5BT1 C;  4DQY B;  3MGR A;  1M18 B;  5B0Y A;  2VQR A;  5AV9 C;  3REH D;  4Z66 D;  1HQ3 D;  3KWQ C;  4Z5T B;  5CPJ D;  1M18 C;  1F66 B;  3REK D;  3MVD D;  3W97 A;  4Z5T C;  1F66 C;  3LZ0 A;  3MGQ B;  3KXB C;  3B0C W;  4G91 B;  4ZUX D;  1S32 B;  3UTA B;  3VH5 W;  3REL D;  3MGQ C;  3AZJ D;  2BYM B;  3LEL B;  4G91 C;  3R45 B;  1S32 C;  3AZL D;  3MGS D;  1P3F B;  5GSU B;  5DNN D;  5GXQ A;  3MNN B;  4KUD D;  1P34 A;  4XUJ B;  3MNN C;  3WTP A;  5B33 B;  4R8P D;  3B0C T;  2YFW B;  4XUJ C;  5AVC C;  4WU9 B;  5GT3 A;  3AZI B;  3W98 D;  3KWQ D;  4X23 A;  3LZ1 C;  3AFA B;  3W96 B;  2F2A C;  5B2J D;  5FUG B;  2ARO B;  5B33 C;  4WU9 C;  1KX3 B;  1P3L B;  4XZQ C;  3AFA C;  1P3G B;  3WA9 A;  3W96 C;  3AZE A;  5C3I B;  5CPK B;  4E44 A;  3KXB D;  4G92 B;  2L5A A;  1KX3 C;  3AZH C;  1P3M B;  3WKJ C;  4QLC C;  3WAA A;  1B6W A;  1Q9C A;  4G92 C;  3NQJ A;  1BH8 B;  1P3M C;  5B1L B;  2PYO B;  2F8N H;  5G49 B;  2HIO D;  1P3B C;  3B6G D;  1ID3 B;  4H9P B;  1M19 A;  5AV6 A;  3KUY B;  3AN2 B;  5AVC D;  3AYW B;  3UT9 B;  1P3I A;  1ID3 C;  3LZ1 D;  4KGC D;  3B6F A;  3EPH A;  5B33 D;  3AYW C;  4Z2M G;  5AV9 A;  3UT9 C;  4H9N B;  2RIQ A;  4XZQ D;  5B0Z A;  4WU8 D;  3X1T C;  1WWS A;  5B24 A;  1KX3 D;  4J8U B;  3AZH D;  2DQN C;  4QLC D;  1F66 A;  3W99 D;  1H3O B;  5JA4 B;  3A6N B;  4J8U C;  2DF4 C;  1EQZ D;  1KX5 B;  3KFU G;  5B31 B;  3AZF B;  3A6N C;  3AV1 A;  4UUZ B;  5AV5 B;  1KX5 C;  5B31 C;  3UTA A;  1W2E A;  4J8X D;  1P3B D;  2CV5 B;  1P3K C;  2F8N A;  2BYM A;  3REJ B;  3LEL A;  3AZF C;  5AV5 C;  3IP4 C;  3R45 A;  5E5A D;  5F99 B;  2FJ7 B;  1P3F A;  2CV5 C;  1U35 D;  3REI D;  5GSU A;  5B32 D;  4J8W B;  4J8V A;  3UT9 D;  2FJ7 C;  3KSY A;  3X1T D;  3AZI A;  1KX4 A;  3REH B;  4Z66 B;  3AZK C;  5FUG A;  2ARO A;  2NZD D;  5CPJ B;  1P3A C;  5GT0 A;  1P3L A;  4AWL B;  3REH C;  1P3G A;  5B2I A;  5CPK A;  3REK B;  5B40 A;  5B32 G;  3MVD B;  5CPJ C;  2RVQ D;  4JJN A;  4AWL C;  1KX5 D;  1P3M A;  3B0B A;  1Z2C B;  4ZUX B;  4LD9 A;  4CSR B;  1P3K D;  1P3O A;  4WJ3 C;  3REL B;  3AZJ B;  1BH8 A;  4HGA C;  3X1U D;  1ZLA D;  3VH5 A;  3AZM D;  4ZUX C;  2UWX A;  5B1L A;  2PYO A;  5BNV B;  5G49 A;  3AZG A;  3AZL B;  3MGS B;  3REL C;  3AZJ C;  5B0Y D;  4KUD B;  2FJ7 D;  1ID3 A;  4H9O B;  3LJA D;  4H9S A;  3AZL C;  3MGS C;  3KUY A;  3AN2 A;  2Y2I A;  5B31 G;  4R8P B;  1TZY D;  4EO5 B;  3C1C A;  3AZK D;  3W98 B;  3KWQ B;  1P3A D;  5B2J B;  3O62 D;  4R8P C;  4H9N A;  4EO5 C;  1ULY A;  3W98 C;  5B2J C;  4J8U A;  3KXB B;  5AV8 C;  3AZN B;  4UPK A;  1H3O A;  5GXQ D;  3A6N A;  2XD1 A;  2ZM5 A;  3H0M C;  3A1K A;  3AZN C;  4UUZ A;  5AV5 A;  3TU4 C;  5DNM C;  4YM6 C;  2HIO B;  3REJ A;  3B6G B;  5F99 A;  4ZBJ C;  5AVC B;  2HIO C;  2CWE A;  2JE5 A;  5BS7 C;  3B6G C;  3LZ1 B;  4KGC B;  4J8W A;  1T3U A;  2Y2P A;  4KHA A;  3VH5 T;  3AV2 A;  3X1S D;  3MGP A;  3WAA D;  4XZQ B;  1P3P D;  4WU8 B;  4KGC C;  5AV8 D;  5CPI D;  2ZY3 A;  4NE5 A;  4Z66 A;  1HQ3 A;  3AZH B;  3C1B A;  4WU8 C;  4QLC B;  5CPJ A;  1M1A D;  2ZY4 A;  3W99 B;  1EQZ B;  5KDM A;  3AZN D;  3REK A;  3MVD A;  3W99 C;  3TU4 D;  1PZR A;  5DNM D;  2IO5 C;  4YM6 D;  3UTB D;  1EQZ C;  4CSR A;  1P3B B;  4H9R A;  4J8X B;  3REL A;  2JCH A;  5E5A B;  5AY8 C;  1BH9 B;  5BNV A;  4J8X C;  1U35 B;  3REI B;  5DNN A;  5B32 B;  5B24 D;  4KUD A;  5E5A C;  1AOI A;  4CAY A;  1U35 C;  3REI C;  5BNX A;  2ZY2 A;  5B32 C;  4YS3 D;  3X1T B;  5B1M C;  5CP6 C;  3W98 A;  3KWQ A;  5BO0 B;  1M18 A;  3AV1 D;  3NQU B;  2NZD B;  4Z5T A;  3KXB A;  2NZD C;  5AVB C;  2NQB C;  3A1I A;  4NE6 A;  3MGQ A;  1P3K B;  4J8V D;  2RVQ C;  1S32 A;  5AY8 D;  5JRG C;  3X1U B;  3AZM B;  1ZLA B;  3MGR B;  2XD5 A;  5B0Y B;  1KX4 D;  3X1U C;  1ZLA C;  3AZM C;  3B6G A;  3LJA B;  3MNN A;  3MGR C;  5CHL B;  5B1M D;  5B0Y C;  4XUJ A;  5AVC A;  2Y2G A;  5CP6 D;  5B2I D;  3LJA C;  5B40 D;  3LZ1 A;  1TZY B;  3AZK B;  5B33 A;  4JJN D;  2YFW A;  1KU5 A;  4WU9 A;  1P3A B;  3O62 B;  1JFI B;  4LD9 D;  4XZQ A;  3AFA A;  1TZY C;  4WU8 A;  3W96 A;  1P3O D;  3W97 C;  3LZ0 C;  3EPK A;  4WZS B;  5AVB D;  3B0D B;  1KX3 A;  3O62 C;  2NQB D;  2BYK B;  3AZH A;  1R4V A;  3AZG D;  3WKJ A;  4QLC A;  2Y2Q A;  3B0D C;  5GXQ B;  1EQZ A;  3X1V D;  4HGA B;  5JRG D;  5GXQ C;  1P34 C;  1BFM A;  1P3B A;  5GT3 B;  3FDD A;  3C1C D;  3WTP E;  3MGR D;  5E5A A;  4WNN B;  5GT3 C;  4H9P A;  1U35 A;  3REI A;  3WKJ B;  2Y2L A;  3AYW A;  3UT9 A;  3W97 D;  3X1T A;  3AZE C;  3X1S B;  3LZ0 D;  3WAA B;  1P3P B;  1TAF B;  5AV8 B;  3NQJ B;  5CPI B;  5BO0 A;  2Y2N A;  3WAA C;  3X1S C;  1P3P C;  3NQU A;  1M1A B;  5CPI C;  3VH6 A;  3EPJ A;  5JA4 A;  2Y2K A;  1P34 D;  1M1A C;  1KX5 A;  5B31 A;  3TU4 B;  5DNM B;  4YM6 B;  3UTB B;  1M19 C;  3H0R C;  1P3K A;  1HTA A;  3WTP D;  3AZF A;  2HUE C;  5AV6 C;  4ZBJ B;  3X1U A;  3UTB C;  5GT3 D;  1P3I C;  1ZLA A;  2CV5 A;  3F6T A;  3MGP D;  4X23 D;  5B0Z B;  3B6F C;  4H9Q B;  2J8P A;  5B24 B;  2FJ7 A;  3LJA A;  3WA9 D;  5B0Z C;  3C1B D;  3AZE D;  5B24 C;  4YS3 B;  3H0L C;  1TZY A;  3AZK A;  4YS3 C;  1P3A A;  3AV1 B;  3O62 A;  1JFI A;  3REH A;  2F8N B;  3VH6 W;  3AV1 C;  2BYK A;  3UTA C;  2IO5 B;  1M19 D;  3LEL C;  5AV6 D;  1AOI D;  4J8V B;  4Z2M H;  1P3I D;  4ZUX A;  1P3F C;  3AL0 C;  5AY8 B;  5BT1 D;  5GSU C;  3B6F D;  3AZJ A;  1WWI A;  2Y2O A;  4J8V C;  2YFV B;  5AV9 D;  1KX4 B; 
#chains in the Genus database with same CATH homology
 3P5J B;  5B0Z D;  3AZL A;  3MGS A;  1M18 D;  3VH6 T;  4NE3 A;  4WNN A;  5GT0 B;  5B1M B;  3AZI C;  1KX4 C;  4H9O A;  3V9R B;  4Z5T D;  5CP6 B;  2Y2H A;  5B2I B;  1F66 D;  2ARO C;  5B40 B;  5GT0 C;  4R8P A;  2FFF B;  2W8S A;  4JJN B;  1P3L C;  1P3G C;  5C3I C;  3X1S A;  5B2I C;  3MGQ D;  3EPL A;  5B40 C;  5CPK C;  1TAF A;  1P3P A;  5B2J A;  1P3O B;  4JJN C;  5AV8 A;  5AVB B;  3UTA D;  1N1J B;  5CPI A;  1S32 D;  2ZY5 A;  2NQB B;  4LD9 C;  2F8N D;  3AZG B;  1A7W A;  1P3O C;  3LEL D;  1M1A A;  1P3F D;  3X1V B;  3AZN A;  5B1L C;  5JRG B;  2PYO C;  3AZG C;  5GSU D;  3MNN D;  4DRA A;  4XUJ D;  3TU4 A;  5DNM A;  4YM6 A;  3UTB A;  3X1V C;  4H9S C;  3KUY C;  3C1C B;  3AN2 C;  4WU9 D;  3AZI D;  2HIO A;  3AFA D;  5BS7 A;  3C1C C;  2F8N G;  4H9Q A;  3W96 D;  2ARO D;  4LD9 B;  5GT0 D;  1P3L D;  1P3G D;  3WKJ D;  5CPK D;  3W97 B;  4M6B A;  4KGC A;  4YS3 A;  3LZ0 B;  1P3M D;  4E45 A;  2LY8 A;  2G5I C;  2Y2M A;  5B1L D;  2PYO D;  3W99 A;  2BG1 A;  1P34 B;  1ID3 D;  3REJ C;  3KUY D;  3AN2 D;  3WTP B;  5F99 C;  3AYW D;  2JSS A;  5AY8 A;  4KHA B;  4J8X A;  3AV2 B;  3MGP B;  4X23 B;  3WTP C;  4J8W C;  2YFV A;  2G5H C;  1BH9 A;  3AV2 C;  1HQ3 B;  3MGP C;  4X23 C;  3C1B B;  3WA9 B;  5B32 A;  3AZE B;  4J8U D;  5B1M A;  3V9R A;  4Z66 C;  5CP6 A;  1HQ3 C;  5KDM B;  1B67 A;  3C1B C;  3WA9 C;  3A6N D;  2Y2J A;  5B31 D;  4WV4 B;  4DRB A;  3MVD C;  3REK C;  4H9R B;  3AZF D;  5AV5 D;  2NZD A;  1F1E A;  5AVB A;  1N1J A;  2NQB A;  2CV5 D;  3REJ D;  1M19 B;  3EG5 B;  2HUE B;  5F99 D;  5DNN B;  5AV6 B;  3X1V A;  1AOI B;  5JRG A;  2F8N K;  1P3I B;  4CAY B;  4NFT A;  5DNN C;  5BNX B;  4J8W D;  3B6F B;  4KUD C;  1AOI C;  3AZM A;  5AV9 B;  3AV2 D;  5BT1 C;  4DQY B;  3MGR A;  1M18 B;  5B0Y A;  2VQR A;  5AV9 C;  3REH D;  4Z66 D;  1HQ3 D;  3KWQ C;  4Z5T B;  5CPJ D;  1M18 C;  1F66 B;  3REK D;  3MVD D;  3W97 A;  4Z5T C;  1F66 C;  3LZ0 A;  3MGQ B;  3KXB C;  3B0C W;  4G91 B;  4ZUX D;  1S32 B;  3UTA B;  3VH5 W;  3REL D;  3MGQ C;  3AZJ D;  2BYM B;  3LEL B;  4G91 C;  3R45 B;  1S32 C;  3AZL D;  3MGS D;  1P3F B;  5GSU B;  5DNN D;  5GXQ A;  3MNN B;  4KUD D;  1P34 A;  4XUJ B;  3MNN C;  3WTP A;  5B33 B;  4R8P D;  3B0C T;  2YFW B;  4XUJ C;  5AVC C;  4WU9 B;  5GT3 A;  3AZI B;  3W98 D;  3KWQ D;  4X23 A;  3LZ1 C;  3AFA B;  3W96 B;  2F2A C;  5B2J D;  5FUG B;  2ARO B;  5B33 C;  4WU9 C;  1KX3 B;  1P3L B;  4XZQ C;  3AFA C;  1P3G B;  3WA9 A;  3W96 C;  3AZE A;  5C3I B;  5CPK B;  4E44 A;  3KXB D;  4G92 B;  2L5A A;  1KX3 C;  3AZH C;  1P3M B;  3WKJ C;  4QLC C;  3WAA A;  1B6W A;  1Q9C A;  4G92 C;  3NQJ A;  1BH8 B;  1P3M C;  5B1L B;  2PYO B;  2F8N H;  5G49 B;  2HIO D;  1P3B C;  3B6G D;  1ID3 B;  4H9P B;  1M19 A;  5AV6 A;  3KUY B;  3AN2 B;  5AVC D;  3AYW B;  3UT9 B;  1P3I A;  1ID3 C;  3LZ1 D;  4KGC D;  3B6F A;  3EPH A;  5B33 D;  3AYW C;  4Z2M G;  5AV9 A;  3UT9 C;  4H9N B;  2RIQ A;  4XZQ D;  5B0Z A;  4WU8 D;  3X1T C;  1WWS A;  5B24 A;  1KX3 D;  4J8U B;  3AZH D;  2DQN C;  4QLC D;  1F66 A;  3W99 D;  1H3O B;  5JA4 B;  3A6N B;  4J8U C;  2DF4 C;  1EQZ D;  1KX5 B;  3KFU G;  5B31 B;  3AZF B;  3A6N C;  3AV1 A;  4UUZ B;  5AV5 B;  1KX5 C;  5B31 C;  3UTA A;  1W2E A;  4J8X D;  1P3B D;  2CV5 B;  1P3K C;  2F8N A;  2BYM A;  3REJ B;  3LEL A;  3AZF C;  5AV5 C;  3IP4 C;  3R45 A;  5E5A D;  5F99 B;  2FJ7 B;  1P3F A;  2CV5 C;  1U35 D;  3REI D;  5GSU A;  5B32 D;  4J8W B;  4J8V A;  3UT9 D;  2FJ7 C;  3KSY A;  3X1T D;  3AZI A;  1KX4 A;  3REH B;  4Z66 B;  3AZK C;  5FUG A;  2ARO A;  2NZD D;  5CPJ B;  1P3A C;  5GT0 A;  1P3L A;  4AWL B;  3REH C;  1P3G A;  5B2I A;  5CPK A;  3REK B;  5B40 A;  5B32 G;  3MVD B;  5CPJ C;  2RVQ D;  4JJN A;  4AWL C;  1KX5 D;  1P3M A;  3B0B A;  1Z2C B;  4ZUX B;  4LD9 A;  4CSR B;  1P3K D;  1P3O A;  4WJ3 C;  3REL B;  3AZJ B;  1BH8 A;  4HGA C;  3X1U D;  1ZLA D;  3VH5 A;  3AZM D;  4ZUX C;  2UWX A;  5B1L A;  2PYO A;  5BNV B;  5G49 A;  3AZG A;  3AZL B;  3MGS B;  3REL C;  3AZJ C;  5B0Y D;  4KUD B;  2FJ7 D;  1ID3 A;  4H9O B;  3LJA D;  4H9S A;  3AZL C;  3MGS C;  3KUY A;  3AN2 A;  2Y2I A;  5B31 G;  4R8P B;  1TZY D;  4EO5 B;  3C1C A;  3AZK D;  3W98 B;  3KWQ B;  1P3A D;  5B2J B;  3O62 D;  4R8P C;  4H9N A;  4EO5 C;  1ULY A;  3W98 C;  5B2J C;  4J8U A;  3KXB B;  5AV8 C;  3AZN B;  4UPK A;  1H3O A;  5GXQ D;  3A6N A;  2XD1 A;  2ZM5 A;  3H0M C;  3A1K A;  3AZN C;  4UUZ A;  5AV5 A;  3TU4 C;  5DNM C;  4YM6 C;  2HIO B;  3REJ A;  3B6G B;  5F99 A;  4ZBJ C;  5AVC B;  2HIO C;  2CWE A;  2JE5 A;  5BS7 C;  3B6G C;  3LZ1 B;  4KGC B;  4J8W A;  1T3U A;  2Y2P A;  4KHA A;  3VH5 T;  3AV2 A;  3X1S D;  3MGP A;  3WAA D;  4XZQ B;  1P3P D;  4WU8 B;  4KGC C;  5AV8 D;  5CPI D;  2ZY3 A;  4NE5 A;  4Z66 A;  1HQ3 A;  3AZH B;  3C1B A;  4WU8 C;  4QLC B;  5CPJ A;  1M1A D;  2ZY4 A;  3W99 B;  1EQZ B;  5KDM A;  3AZN D;  3REK A;  3MVD A;  3W99 C;  3TU4 D;  1PZR A;  5DNM D;  2IO5 C;  4YM6 D;  3UTB D;  1EQZ C;  4CSR A;  1P3B B;  4H9R A;  4J8X B;  3REL A;  2JCH A;  5E5A B;  5AY8 C;  1BH9 B;  5BNV A;  4J8X C;  1U35 B;  3REI B;  5DNN A;  5B32 B;  5B24 D;  4KUD A;  5E5A C;  1AOI A;  4CAY A;  1U35 C;  3REI C;  5BNX A;  2ZY2 A;  5B32 C;  4YS3 D;  3X1T B;  5B1M C;  5CP6 C;  3W98 A;  3KWQ A;  5BO0 B;  1M18 A;  3AV1 D;  3NQU B;  2NZD B;  4Z5T A;  3KXB A;  2NZD C;  5AVB C;  2NQB C;  3A1I A;  4NE6 A;  3MGQ A;  1P3K B;  4J8V D;  2RVQ C;  1S32 A;  5AY8 D;  5JRG C;  3X1U B;  3AZM B;  1ZLA B;  3MGR B;  2XD5 A;  5B0Y B;  1KX4 D;  3X1U C;  1ZLA C;  3AZM C;  3B6G A;  3LJA B;  3MNN A;  3MGR C;  5CHL B;  5B1M D;  5B0Y C;  4XUJ A;  5AVC A;  2Y2G A;  5CP6 D;  5B2I D;  3LJA C;  5B40 D;  3LZ1 A;  1TZY B;  3AZK B;  5B33 A;  4JJN D;  2YFW A;  1KU5 A;  4WU9 A;  1P3A B;  3O62 B;  1JFI B;  4LD9 D;  4XZQ A;  3AFA A;  1TZY C;  4WU8 A;  3W96 A;  1P3O D;  3W97 C;  3LZ0 C;  3EPK A;  4WZS B;  5AVB D;  3B0D B;  1KX3 A;  3O62 C;  2NQB D;  2BYK B;  3AZH A;  1R4V A;  3AZG D;  3WKJ A;  4QLC A;  2Y2Q A;  3B0D C;  5GXQ B;  1EQZ A;  3X1V D;  4HGA B;  5JRG D;  5GXQ C;  1P34 C;  1BFM A;  1P3B A;  5GT3 B;  3FDD A;  3C1C D;  3WTP E;  3MGR D;  5E5A A;  4WNN B;  5GT3 C;  4H9P A;  1U35 A;  3REI A;  3WKJ B;  2Y2L A;  3AYW A;  3UT9 A;  3W97 D;  3X1T A;  3AZE C;  3X1S B;  3LZ0 D;  3WAA B;  1P3P B;  1TAF B;  5AV8 B;  3NQJ B;  5CPI B;  5BO0 A;  2Y2N A;  3WAA C;  3X1S C;  1P3P C;  3NQU A;  1M1A B;  5CPI C;  3VH6 A;  3EPJ A;  5JA4 A;  2Y2K A;  1P34 D;  1M1A C;  1KX5 A;  5B31 A;  3TU4 B;  5DNM B;  4YM6 B;  3UTB B;  1M19 C;  3H0R C;  1P3K A;  1HTA A;  3WTP D;  3AZF A;  2HUE C;  5AV6 C;  4ZBJ B;  3X1U A;  3UTB C;  5GT3 D;  1P3I C;  1ZLA A;  2CV5 A;  3F6T A;  3MGP D;  4X23 D;  5B0Z B;  3B6F C;  4H9Q B;  2J8P A;  5B24 B;  2FJ7 A;  3LJA A;  3WA9 D;  5B0Z C;  3C1B D;  3AZE D;  5B24 C;  4YS3 B;  3H0L C;  1TZY A;  3AZK A;  4YS3 C;  1P3A A;  3AV1 B;  3O62 A;  1JFI A;  3REH A;  2F8N B;  3VH6 W;  3AV1 C;  2BYK A;  3UTA C;  2IO5 B;  1M19 D;  3LEL C;  5AV6 D;  1AOI D;  4J8V B;  4Z2M H;  1P3I D;  4ZUX A;  1P3F C;  3AL0 C;  5AY8 B;  5BT1 D;  5GSU C;  3B6F D;  3AZJ A;  1WWI A;  2Y2O A;  4J8V C;  2YFV B;  5AV9 D;  1KX4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...