3AZKA

Crystal structure of human nucleosome core particle containing h4k59q mutation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azkA00
1TAFA 4Z5TB 5B2JC 3UTBA 5B40C 3WTPB 2HIOA 1S32C 5E5AB 5B0ZA 5BT1D 3TU4C 4WV4B 3MGPB 2F8NA 5AV8A 1P3BB 4WU8D 2NZDA 1A7WA 3LELD 2CV5D 1AOIC 1N1JA 3UT9A 1BH9A 3C1BD 3REHC 1P3IB 5G49B 3W98D 5B31C 4G92B 4KUDD 5AV5D 3AZGA 3AZHD 5GSUC 3WTPA 4YS3D 1EQZD 5E5AA 3LELB 2CV5B 2IO5B 3C1BB 3MVDA 5BNXA 1P3BA 4Z2MG 5AV6C 5CP6B 3AFAB 3V9RB 1P3IA 5GXQD 2CWEA 5G49A 3AZMD 3W98B 1M1AC 3VH6A 3AZHB 5B1LD 1P34D 4YS3B 1EQZB 2YFWB 1U35A 4J8UD 4ZUXC 5BS7C 5CPIA 1F66A 2HUEC 5GXQB 5B24D 3RELD 5CP6A 5FUGB 5B33D 4XZQA 3AFAA 3A6NC 3LJAD 5AY8C 1WWIA 1P34B 5B1LB 3W99C 3KXBC 5CPJD 3B0BA 1P3FC 4YS3A 2YFWA 3AZNC 1P3MA 5F99C 1HQ3B 3AV1D 5B24B 4J8VB 5BO0A 3RELB 3MNNA 4LD9A 4X23C 5B2ID 5DNND 4CSRB 5CPJB 5FUGA 1KX3D 4EO5B 1R4VA 1ID3D 3AV2A 5B32C 3REJA 3AV1B 2PYOC 3B6FB 1P3PD 1ZLAC 1HQ3A 1M19D 5B2IB 4XUJD 5B24A 4J8VA 3AZIA 4J8WD 5DNNB 4HGAB 3AZLD 3X1SD 4YM6A 1KX3B 4WNNB 3WTPE 3MGSC 3AYWC 1JFIB 2NQBC 5CPJA 4H9SA 4J8XA 3UTAA 1ID3B 4H9NA 3REKD 4AWLB 1M19B 4XUJB 5GT3A 5B1MC 3LZ1A 4J8WB 3B6FA 3X1SB 2AROB 5B2IA 5DNNA 1P3LC 3WAAC 1BH8B 4WNNA 3KWQD 1JFIA 3REKB 1P3AD 3AZFD 5AV9A 3AN2A 5CPKD 1M19A 2FJ7C 3LZ0C 5GT0C 2AROA 4R8PC 3KWQB 3REIC 2RVQC 5B2JD 5B40D 1P3AB 3AZFB 1M18C 3B6GA 1S32D 3C1CA 5AVCC 3TU4D 3O62A 5B32G 5CPKB 4KGCC 1AOID 3REHD 2LY8A 3W97C 5B2JB 2F8NH 2L5AA 4M6BA 5B40B 2BYKB 1S32B 5B31D 3TU4B 4H9RB 1B67A 5GSUD 1P3OC 3MGRC 1AOIB 3MGQC 5AVBA 3NQUB 3REHB 1P3GC 5AV6D 3X1VA 4ZBJB 3KUYD 2YFVB 4JJNA 3UTBC 5B31B 5B2JA 1KX4A 2HIOC 5B40A 1M1AD 4NE6A 1BFMA 5B0ZC 5GSUB 1S32A 4Z5TA 5AV8C 2NZDC 4H9RA 3UT9C 5AV6B 4ZUXD 5DNMC 4WU8B 4NE5A 3KUYB 3MGPA 1M1AB 1KX5C 3A6ND 5AY8D 3WKJC 3KXBD 3AZGC 1P3FD 1P3KC 5AV5B 4KUDB 5JRGD 3MVDC 4ZUXB 3AZND 1P3BC 5F99D 1Q9CA 1H3OB 2HUEB 1P3IC 4WU8A 3LELA 2JSSA 4X23D 3KUYA 2CV5A 3VH5A 3A6NB 3C1BA 5AY8B 3KXBB 3AZMB 1P3FB 3V9RA 5JRGB 1U35C 3WA9C 3AZNB 3W98A 5F99B 4WZSB 5B32D 5CPIC 1F66C 2IO5C 5AV5A 4KUDA 2PYOD 4J8UB 5BS7A 3AZHA 1ZLAD 1EQZA 3R45B 4X23B 5CP6C 1H3OA 1ULYA 4XZQC 3AFAC 3VH6T 3A6NA 5B33B 3MGSD 3AYWD 2NQBD 3AZJC 5GXQA 3LJAB 3AZMA 5B32B 1P3FA 1P3MC 2PYOB 5JRGA 1P34A 5B1LA 3AZNA 1ZLAB 5B31G 3MNNC 4LD9C 5B1MD 4J8UA 3W96C 4E45A 3AYWB 5B0YC 2NQBB 3RELA 1P3LD 3WAAD 5B33A 3AV2C 4H9QB 5BNVB 2BYMB 3LJAA 3REJC 4CSRA 5B32A 2PYOA 1HQ3C 4G91C 3AZIC 4WU9C 4J8VC 1P3PB 3X1UC 3AV1A 4YM6C 2FJ7D 3LZ0D 1P3LB 5GT0D 3AZLB 4R8PD 3REID 3WAAB 4J8XC 3UTAC 2NQBA 2RVQD 3AZEC 1M18D 4NFTA 1KX3A 4H9QA 5BNVA 5AVCD 5GT3C 3LZ1C 3B6FC 1ID3A 4KGCD 5C3IC 2FJ7B 3LZ0B 5GT0B 4E44A 1P3PA 4R8PB 3REIB 3W97D 1KU5A 4XUJA 4J8WA 3AZLA 3VH6W 4QLCC 1TZYC 1M18B 3X1SA 4Z2MH 3AZKC 2F8NK 5AVCB 4DRBA 5AV9C 3AN2C 4KGCB 1BH8A 1P3OD 3MGQD 3REKA 1WWSA 3B0DC 2AROC 3LZ0A 5GT0A 3REIA 3UTBD 3B6GC 1HTAA 3C1CC 1M18A 5B0ZD 2F8ND 3O62C 3KWQA 1P3OB 5AVCA 5AV8D 2NZDD 1P3AA 3UT9D 3AZFA 5DNMD 4Z66C 3X1TC 5CPKA 1KX5D 2F8NB 3WKJD 3AZGD 5AV8B 1P3KD 1N1JB 3UT9B 1BH9B 2BYKA 5AVBC 3MVDD 5DNMB 1P3BD 3X1VC 3TU4A 4JJNC 1P3ID 5JA4B 1AOIA 1KX5B 1KX4C 3NQUA 3REHA 3WKJB 3AZGB 4Z5TC 1P3KB 2YFVA 3MVDB 5BNXB 1U35D 1B6WA 3WA9D 3B0CT 3W99D 5B31A 1F66D 3WTPC 5CPID 5E5AC 3MGPC 5GSUA 5DNMA 1F1EA 5CP6D 4ZBJC 4XZQD 3AFAD 5AV6A 5JA4A 1KX5A 3WKJA 3AZJD 1U35B 3WA9B 3W99B 1F66B 5CPIB 1P3KA 1P3MD 1M1AA 4G92C 5BT1C 3MNND 4LD9D 4WU8C 3KSYA 3LELC 5CHLB 4XZQB 3KUYC 2CV5C 3W96D 3C1BC 4ZUXA 5B0YD 3AZJB 3W98C 1P3MB 3AV2D 3REJD 4KUDC 5AY8A 5AV5C 3WA9A 3W99A 5BO0B 3KXBA 3MNNB 4LD9B 3AZHC 4YS3C 1EQZC 4NE3A 1HQ3D 2F8NG 3AZID 4WU9D 3NQJB 3VH5T 4J8VD 3W96B 3X1UD 5F99A 5B0YB 4YM6D 4DRAA 5GXQC 3R45A 3AZMC 4X23A 4J8XD 3UTAD 3AV2B 3AZJA 3MGSB 3REJB 3AZED 5JRGC 1P34C 5B1LC 4G91B 3AZIB 3B0CW 5GT3D 4WU9B 3LZ1D 3B6FD 4J8UC 3X1UB 4YM6B 3W96A 3NQJA 5B1MB 1ZLAA 5B24C 3RELC 5B0YA 4J8XB 3UTAB 5B33C 3AZEB 4H9NB 4KHAB 4QLCD 3LJAC 1TZYD 5CPJC 4H9SC 3AZKD 3MGSA 3AYWA 5KDMB 5GT3B 4H9PB 4EO5C 3LZ1B 5AV9D 3AN2D 5C3IB 4WU9A 3AV1C 2BYMA 3X1UA 2AROD 5B1MA 5B2IC 4QLCB 1TZYB 5DNNC 4HGAC 3AZKB 3B6GD 3AZEA 1KX3C 4KHAA 1P3LA 3C1CD 5AV9B 3AN2B 4H9OB 3O62D 3WAAA 1ID3C 5KDMA 4H9PA 1P3PC 3B0DB 4AWLC 3VH5W 4CAYB 1M19C 3MGRD 4XUJC 4J8WC 4Z66D 3X1TD 3AZLC 1P3GD 3B6GB 3X1SC 3W97B 4QLCA 2FJ7A 3C1CB 1TZYA 3AZKA 4R8PA 3O62B 2HIOD 3REKC 4H9OA 5AVBD 3X1VD 3MGRB 3MGQB 4UUZB 4Z66B 3X1TB 4JJND 4KGCA 1P3GB 4CAYA 1TAFB 1KX4D 3UTBB 3W97A 3KWQC 4Z5TD 2HIOB 5AVBB 5B0ZB 1P3AC 3AZFC 3X1VB 3WTPD 2NZDB 5E5AD 4JJNB 3MGPD 1P3OA 5CPKC 3MGRA 3MGQA 4UUZA 4Z66A 3X1TA 1KX4B 1P3GA
chains in the Genus database with same CATH superfamily
1TAFA 4Z5TB 5B2JC 3UTBA 5B40C 3FDDA 3WTPB 2HIOA 1S32C 5E5AB 5B0ZA 5BT1D 3TU4C 4WV4B 3MGPB 2F8NA 5AV8A 1P3BB 4WU8D 2NZDA 1A7WA 3LELD 2CV5D 1AOIC 1N1JA 3UT9A 1BH9A 2ZY4A 3C1BD 3REHC 1P3IB 5G49B 3W98D 5B31C 4G92B 4KUDD 5AV5D 3AZGA 3AZHD 5GSUC 3WTPA 4YS3D 1EQZD 5E5AA 3LELB 2CV5B 2IO5B 3C1BB 3MVDA 5BNXA 1P3BA 2Y2HA 4Z2MG 5AV6C 5CP6B 3AFAB 3V9RB 1P3IA 5GXQD 2CWEA 5G49A 3AZMD 3W98B 1M1AC 3VH6A 3AZHB 5B1LD 1P34D 4YS3B 1EQZB 2YFWB 2W8SA 1U35A 4J8UD 4ZUXC 5BS7C 5CPIA 1F66A 2HUEC 1W2EA 5GXQB 5B24D 3RELD 5CP6A 5FUGB 5B33D 4XZQA 3AFAA 3A6NC 3LJAD 5AY8C 1WWIA 1P34B 5B1LB 3W99C 3KXBC 5CPJD 3B0BA 1P3FC 4YS3A 2YFWA 3AZNC 1P3MA 5F99C 1HQ3B 3AV1D 5B24B 4J8VB 5BO0A 3RELB 3MNNA 4LD9A 4X23C 5B2ID 5DNND 4CSRB 5CPJB 5FUGA 2G5IC 1KX3D 4EO5B 1R4VA 2Y2IA 1ID3D 3AV2A 5B32C 3REJA 3AV1B 2PYOC 3B6FB 1P3PD 1ZLAC 1HQ3A 1M19D 5B2IB 4XUJD 5B24A 4J8VA 3AZIA 4J8WD 5DNNB 4HGAB 3AZLD 3X1SD 4YM6A 3H0MC 4WNNB 3WTPE 3MGSC 3AYWC 1KX3B 1JFIB 2NQBC 5CPJA 4H9SA 4J8XA 3UTAA 1ID3B 4H9NA 3REKD 3P5JB 4AWLB 1M19B 4XUJB 5GT3A 5B1MC 3LZ1A 4J8WB 3B6FA 3X1SB 2AROB 5B2IA 5DNNA 1P3LC 3WAAC 1BH8B 4WNNA 3KWQD 1JFIA 3REKB 1P3AD 3AZFD 5AV9A 3AN2A 5CPKD 1M19A 2FJ7C 3LZ0C 5GT0C 2AROA 4R8PC 3KWQB 3REIC 2RVQC 5B2JD 5B40D 1P3AB 3AZFB 1M18C 3B6GA 1Z2CB 1S32D 3C1CA 5AVCC 3TU4D 3O62A 5B32G 5CPKB 4KGCC 1AOID 3REHD 2LY8A 3W97C 5B2JB 2F8NH 2L5AA 4M6BA 5B40B 2BYKB 1S32B 2ZY5A 5B31D 3TU4B 4H9RB 1B67A 5GSUD 1P3OC 3MGRC 1AOIB 3MGQC 5AVBA 3NQUB 3REHB 1P3GC 2FFFB 3EPKA 5AV6D 3X1VA 2DQNC 4ZBJB 3KUYD 2YFVB 4JJNA 3UTBC 5B31B 5B2JA 1KX4A 2HIOC 5B40A 1M1AD 4NE6A 1BFMA 5B0ZC 5GSUB 1S32A 4Z5TA 5AV8C 2NZDC 2XD5A 4H9RA 3UT9C 5AV6B 4ZUXD 5DNMC 4WU8B 4NE5A 3KUYB 3MGPA 3EPHA 1M1AB 1KX5C 3A6ND 5AY8D 3WKJC 3KXBD 3AZGC 1P3FD 1P3KC 5AV5B 4KUDB 5JRGD 3MVDC 4ZUXB 3AZND 1P3BC 5F99D 1Q9CA 1H3OB 2HUEB 1P3IC 4WU8A 3LELA 2JSSA 4X23D 3KUYA 2CV5A 3VH5A 3A6NB 3C1BA 5AY8B 3KXBB 3AZMB 1P3FB 3V9RA 5JRGB 1U35C 3WA9C 3AZNB 3W98A 5F99B 4WZSB 5B32D 5CPIC 1F66C 2IO5C 5AV5A 4KUDA 2PYOD 3H0LC 4J8UB 5BS7A 3AZHA 1ZLAD 1EQZA 3R45B 4X23B 5CP6C 1H3OA 1ULYA 4XZQC 3AFAC 3VH6T 3A6NA 5B33B 3MGSD 3AYWD 2NQBD 3AZJC 5GXQA 3LJAB 3AZMA 1PZRA 5B32B 1P3FA 1P3MC 3A1KA 2PYOB 5JRGA 1P34A 5B1LA 3AZNA 1ZLAB 5B31G 3MNNC 4LD9C 2Y2OA 5B1MD 4J8UA 3W96C 4E45A 3AYWB 5B0YC 2F2AC 2NQBB 3RELA 1P3LD 3WAAD 5B33A 3AV2C 4H9QB 5BNVB 2BYMB 3LJAA 3REJC 3F6TA 4CSRA 5B32A 4DQYB 2PYOA 1HQ3C 4G91C 2Y2NA 3AZIC 4WU9C 4J8VC 1P3PB 3X1UC 3AV1A 4YM6C 2FJ7D 3LZ0D 1P3LB 5GT0D 2DF4C 3AZLB 2Y2PA 4R8PD 3REID 3WAAB 4J8XC 3UTAC 2NQBA 2Y2GA 2RVQD 3AZEC 1M18D 4NFTA 2VQRA 1KX3A 4H9QA 3H0RC 5BNVA 5AVCD 5GT3C 3LZ1C 3B6FC 1ID3A 4KGCD 5C3IC 2FJ7B 3LZ0B 5GT0B 4E44A 1P3PA 4R8PB 3REIB 3W97D 1KU5A 4XUJA 4J8WA 3AZLA 3VH6W 4QLCC 1TZYC 1M18B 3X1SA 4Z2MH 3AZKC 2F8NK 5AVCB 4DRBA 5AV9C 3AN2C 4KGCB 1BH8A 2Y2MA 1P3OD 3MGQD 3REKA 1WWSA 3B0DC 2AROC 3LZ0A 5GT0A 3KFUG 3REIA 2Y2JA 3UTBD 3B6GC 1HTAA 3C1CC 1M18A 5B0ZD 2RIQA 2F8ND 3O62C 3KWQA 2J8PA 1P3OB 5AVCA 5AV8D 2NZDD 1P3AA 3UT9D 3AZFA 5DNMD 4UPKA 4Z66C 3X1TC 5CPKA 1KX5D 2F8NB 3WKJD 3IP4C 3AZGD 5AV8B 1P3KD 1N1JB 3UT9B 1BH9B 2BYKA 5AVBC 3MVDD 5DNMB 1P3BD 3X1VC 4WJ3C 3TU4A 2JCHA 3AL0C 4JJNC 1P3ID 5JA4B 1AOIA 1KX5B 1KX4C 3NQUA 3REHA 3WKJB 3AZGB 4Z5TC 1P3KB 2YFVA 3MVDB 5BNXB 1U35D 1B6WA 3WA9D 3B0CT 3W99D 5B31A 1F66D 3WTPC 5CPID 5E5AC 3MGPC 5GSUA 5DNMA 1F1EA 3A1IA 5CP6D 4ZBJC 4XZQD 3AFAD 5AV6A 5JA4A 1KX5A 1T3UA 3WKJA 3AZJD 1U35B 3WA9B 2BG1A 3W99B 1F66B 5CPIB 1P3KA 1P3MD 1M1AA 4G92C 5BT1C 3MNND 4LD9D 4WU8C 3KSYA 3LELC 5CHLB 4XZQB 3KUYC 2CV5C 3W96D 3C1BC 4ZUXA 2ZY2A 5B0YD 2JE5A 3AZJB 3W98C 1P3MB 3AV2D 3REJD 4KUDC 5AY8A 5AV5C 3WA9A 3W99A 5BO0B 3KXBA 3MNNB 4LD9B 3AZHC 4YS3C 1EQZC 4NE3A 2UWXA 3EG5B 1HQ3D 2F8NG 3AZID 4WU9D 3NQJB 3VH5T 4J8VD 3W96B 3X1UD 5F99A 5B0YB 4YM6D 4DRAA 5GXQC 3R45A 2ZY3A 3AZMC 4X23A 4J8XD 3UTAD 3AV2B 3AZJA 3MGSB 3REJB 3AZED 5JRGC 1P34C 5B1LC 4G91B 3AZIB 3B0CW 5GT3D 4WU9B 3LZ1D 3B6FD 4J8UC 3X1UB 4YM6B 3W96A 3NQJA 5B1MB 1ZLAA 5B24C 3RELC 5B0YA 4J8XB 3UTAB 3EPLA 5B33C 3AZEB 4H9NB 4KHAB 4QLCD 3LJAC 1TZYD 5CPJC 4H9SC 3AZKD 3MGSA 3AYWA 5KDMB 5GT3B 4H9PB 4EO5C 3LZ1B 3EPJA 5AV9D 3AN2D 5C3IB 4WU9A 3AV1C 2BYMA 3X1UA 2ZM5A 2AROD 5B1MA 5B2IC 4QLCB 1TZYB 5DNNC 4HGAC 3AZKB 3B6GD 3AZEA 1KX3C 4KHAA 1P3LA 3C1CD 2XD1A 5AV9B 3AN2B 4H9OB 3O62D 3WAAA 1ID3C 5KDMA 4H9PA 1P3PC 3B0DB 4AWLC 3VH5W 4CAYB 1M19C 3MGRD 4XUJC 2Y2LA 4J8WC 4Z66D 3X1TD 2Y2KA 3AZLC 1P3GD 3B6GB 3X1SC 3W97B 4QLCA 2FJ7A 3C1CB 1TZYA 3AZKA 4R8PA 3O62B 2HIOD 3REKC 4H9OA 5AVBD 3X1VD 3MGRB 3MGQB 4UUZB 4Z66B 3X1TB 4JJND 4KGCA 1P3GB 2G5HC 4CAYA 1TAFB 1KX4D 3UTBB 3W97A 3KWQC 4Z5TD 2HIOB 5AVBB 5B0ZB 2Y2QA 1P3AC 3AZFC 3X1VB 3WTPD 2NZDB 5E5AD 4JJNB 3MGPD 1P3OA 5CPKC 3MGRA 3MGQA 4UUZA 4Z66A 3X1TA 1KX4B 1P3GA
chains in the Genus database with same CATH topology
1TAFA 4Z5TB 5B2JC 3UTBA 5B40C 3FDDA 3WTPB 2HIOA 1S32C 5E5AB 5B0ZA 5BT1D 3TU4C 4WV4B 3MGPB 2F8NA 5AV8A 1P3BB 4WU8D 2NZDA 1A7WA 3LELD 2CV5D 1AOIC 1N1JA 3UT9A 1BH9A 2ZY4A 3C1BD 3REHC 1P3IB 5G49B 3W98D 5B31C 4G92B 4KUDD 5AV5D 3AZGA 3AZHD 5GSUC 3WTPA 4YS3D 1EQZD 5E5AA 3LELB 2CV5B 2IO5B 3C1BB 3MVDA 5BNXA 1P3BA 2Y2HA 4Z2MG 5AV6C 5CP6B 3AFAB 3V9RB 1P3IA 5GXQD 2CWEA 5G49A 3AZMD 3W98B 1M1AC 3VH6A 3AZHB 5B1LD 1P34D 4YS3B 1EQZB 2YFWB 2W8SA 1U35A 4J8UD 4ZUXC 5BS7C 5CPIA 1F66A 2HUEC 1W2EA 5GXQB 5B24D 3RELD 5CP6A 5FUGB 5B33D 4XZQA 3AFAA 3A6NC 3LJAD 5AY8C 1WWIA 1P34B 5B1LB 3W99C 3KXBC 5CPJD 3B0BA 1P3FC 4YS3A 2YFWA 3AZNC 1P3MA 5F99C 1HQ3B 3AV1D 5B24B 4J8VB 5BO0A 3RELB 3MNNA 4LD9A 4X23C 5B2ID 5DNND 4CSRB 5CPJB 5FUGA 2G5IC 1KX3D 4EO5B 1R4VA 2Y2IA 1ID3D 3AV2A 5B32C 3REJA 3AV1B 2PYOC 3B6FB 1P3PD 1ZLAC 1HQ3A 1M19D 5B2IB 4XUJD 5B24A 4J8VA 3AZIA 4J8WD 5DNNB 4HGAB 3AZLD 3X1SD 4YM6A 3H0MC 4WNNB 3WTPE 3MGSC 3AYWC 1KX3B 1JFIB 2NQBC 5CPJA 4H9SA 4J8XA 3UTAA 1ID3B 4H9NA 3REKD 3P5JB 4AWLB 1M19B 4XUJB 5GT3A 5B1MC 3LZ1A 4J8WB 3B6FA 3X1SB 2AROB 5B2IA 5DNNA 1P3LC 3WAAC 1BH8B 4WNNA 3KWQD 1JFIA 3REKB 1P3AD 3AZFD 5AV9A 3AN2A 5CPKD 1M19A 2FJ7C 3LZ0C 5GT0C 2AROA 4R8PC 3KWQB 3REIC 2RVQC 5B2JD 5B40D 1P3AB 3AZFB 1M18C 3B6GA 1Z2CB 1S32D 3C1CA 5AVCC 3TU4D 3O62A 5B32G 5CPKB 4KGCC 1AOID 3REHD 2LY8A 3W97C 5B2JB 2F8NH 2L5AA 4M6BA 5B40B 2BYKB 1S32B 2ZY5A 5B31D 3TU4B 4H9RB 1B67A 5GSUD 1P3OC 3MGRC 1AOIB 3MGQC 5AVBA 3NQUB 3REHB 1P3GC 2FFFB 3EPKA 5AV6D 3X1VA 2DQNC 4ZBJB 3KUYD 2YFVB 4JJNA 3UTBC 5B31B 5B2JA 1KX4A 2HIOC 5B40A 1M1AD 4NE6A 1BFMA 5B0ZC 5GSUB 1S32A 4Z5TA 5AV8C 2NZDC 2XD5A 4H9RA 3UT9C 5AV6B 4ZUXD 5DNMC 4WU8B 4NE5A 3KUYB 3MGPA 3EPHA 1M1AB 1KX5C 3A6ND 5AY8D 3WKJC 3KXBD 3AZGC 1P3FD 1P3KC 5AV5B 4KUDB 5JRGD 3MVDC 4ZUXB 3AZND 1P3BC 5F99D 1Q9CA 1H3OB 2HUEB 1P3IC 4WU8A 3LELA 2JSSA 4X23D 3KUYA 2CV5A 3VH5A 3A6NB 3C1BA 5AY8B 3KXBB 3AZMB 1P3FB 3V9RA 5JRGB 1U35C 3WA9C 3AZNB 3W98A 5F99B 4WZSB 5B32D 5CPIC 1F66C 2IO5C 5AV5A 4KUDA 2PYOD 3H0LC 4J8UB 5BS7A 3AZHA 1ZLAD 1EQZA 3R45B 4X23B 5CP6C 1H3OA 1ULYA 4XZQC 3AFAC 3VH6T 3A6NA 5B33B 3MGSD 3AYWD 2NQBD 3AZJC 5GXQA 3LJAB 3AZMA 1PZRA 5B32B 1P3FA 1P3MC 3A1KA 2PYOB 5JRGA 1P34A 5B1LA 3AZNA 1ZLAB 5B31G 3MNNC 4LD9C 2Y2OA 5B1MD 4J8UA 3W96C 4E45A 3AYWB 5B0YC 2F2AC 2NQBB 3RELA 1P3LD 3WAAD 5B33A 3AV2C 4H9QB 5BNVB 2BYMB 3LJAA 3REJC 3F6TA 4CSRA 5B32A 4DQYB 2PYOA 1HQ3C 4G91C 2Y2NA 3AZIC 4WU9C 4J8VC 1P3PB 3X1UC 3AV1A 4YM6C 2FJ7D 3LZ0D 1P3LB 5GT0D 2DF4C 3AZLB 2Y2PA 4R8PD 3REID 3WAAB 4J8XC 3UTAC 2NQBA 2Y2GA 2RVQD 3AZEC 1M18D 4NFTA 2VQRA 1KX3A 4H9QA 3H0RC 5BNVA 5AVCD 5GT3C 3LZ1C 3B6FC 1ID3A 4KGCD 5C3IC 2FJ7B 3LZ0B 5GT0B 4E44A 1P3PA 4R8PB 3REIB 3W97D 1KU5A 4XUJA 4J8WA 3AZLA 3VH6W 4QLCC 1TZYC 1M18B 3X1SA 4Z2MH 3AZKC 2F8NK 5AVCB 4DRBA 5AV9C 3AN2C 4KGCB 1BH8A 2Y2MA 1P3OD 3MGQD 3REKA 1WWSA 3B0DC 2AROC 3LZ0A 5GT0A 3KFUG 3REIA 2Y2JA 3UTBD 3B6GC 1HTAA 3C1CC 1M18A 5B0ZD 2RIQA 2F8ND 3O62C 3KWQA 2J8PA 1P3OB 5AVCA 5AV8D 2NZDD 1P3AA 3UT9D 3AZFA 5DNMD 4UPKA 4Z66C 3X1TC 5CPKA 1KX5D 2F8NB 3WKJD 3IP4C 3AZGD 5AV8B 1P3KD 1N1JB 3UT9B 1BH9B 2BYKA 5AVBC 3MVDD 5DNMB 1P3BD 3X1VC 4WJ3C 3TU4A 2JCHA 3AL0C 4JJNC 1P3ID 5JA4B 1AOIA 1KX5B 1KX4C 3NQUA 3REHA 3WKJB 3AZGB 4Z5TC 1P3KB 2YFVA 3MVDB 5BNXB 1U35D 1B6WA 3WA9D 3B0CT 3W99D 5B31A 1F66D 3WTPC 5CPID 5E5AC 3MGPC 5GSUA 5DNMA 1F1EA 3A1IA 5CP6D 4ZBJC 4XZQD 3AFAD 5AV6A 5JA4A 1KX5A 1T3UA 3WKJA 3AZJD 1U35B 3WA9B 2BG1A 3W99B 1F66B 5CPIB 1P3KA 1P3MD 1M1AA 4G92C 5BT1C 3MNND 4LD9D 4WU8C 3KSYA 3LELC 5CHLB 4XZQB 3KUYC 2CV5C 3W96D 3C1BC 4ZUXA 2ZY2A 5B0YD 2JE5A 3AZJB 3W98C 1P3MB 3AV2D 3REJD 4KUDC 5AY8A 5AV5C 3WA9A 3W99A 5BO0B 3KXBA 3MNNB 4LD9B 3AZHC 4YS3C 1EQZC 4NE3A 2UWXA 3EG5B 1HQ3D 2F8NG 3AZID 4WU9D 3NQJB 3VH5T 4J8VD 3W96B 3X1UD 5F99A 5B0YB 4YM6D 4DRAA 5GXQC 3R45A 2ZY3A 3AZMC 4X23A 4J8XD 3UTAD 3AV2B 3AZJA 3MGSB 3REJB 3AZED 5JRGC 1P34C 5B1LC 4G91B 3AZIB 3B0CW 5GT3D 4WU9B 3LZ1D 3B6FD 4J8UC 3X1UB 4YM6B 3W96A 3NQJA 5B1MB 1ZLAA 5B24C 3RELC 5B0YA 4J8XB 3UTAB 3EPLA 5B33C 3AZEB 4H9NB 4KHAB 4QLCD 3LJAC 1TZYD 5CPJC 4H9SC 3AZKD 3MGSA 3AYWA 5KDMB 5GT3B 4H9PB 4EO5C 3LZ1B 3EPJA 5AV9D 3AN2D 5C3IB 4WU9A 3AV1C 2BYMA 3X1UA 2ZM5A 2AROD 5B1MA 5B2IC 4QLCB 1TZYB 5DNNC 4HGAC 3AZKB 3B6GD 3AZEA 1KX3C 4KHAA 1P3LA 3C1CD 2XD1A 5AV9B 3AN2B 4H9OB 3O62D 3WAAA 1ID3C 5KDMA 4H9PA 1P3PC 3B0DB 4AWLC 3VH5W 4CAYB 1M19C 3MGRD 4XUJC 2Y2LA 4J8WC 4Z66D 3X1TD 2Y2KA 3AZLC 1P3GD 3B6GB 3X1SC 3W97B 4QLCA 2FJ7A 3C1CB 1TZYA 3AZKA 4R8PA 3O62B 2HIOD 3REKC 4H9OA 5AVBD 3X1VD 3MGRB 3MGQB 4UUZB 4Z66B 3X1TB 4JJND 4KGCA 1P3GB 2G5HC 4CAYA 1TAFB 1KX4D 3UTBB 3W97A 3KWQC 4Z5TD 2HIOB 5AVBB 5B0ZB 2Y2QA 1P3AC 3AZFC 3X1VB 3WTPD 2NZDB 5E5AD 4JJNB 3MGPD 1P3OA 5CPKC 3MGRA 3MGQA 4UUZA 4Z66A 3X1TA 1KX4B 1P3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TAF A;  4Z5T B;  5B2J C;  3UTB A;  5B40 C;  3WTP B;  2HIO A;  1S32 C;  5E5A B;  5B0Z A;  5BT1 D;  3TU4 C;  4WV4 B;  3MGP B;  2F8N A;  5AV8 A;  1P3B B;  4WU8 D;  2NZD A;  1A7W A;  3LEL D;  2CV5 D;  1AOI C;  1N1J A;  3UT9 A;  1BH9 A;  3C1B D;  3REH C;  1P3I B;  5G49 B;  3W98 D;  5B31 C;  4G92 B;  4KUD D;  5AV5 D;  3AZG A;  3AZH D;  5GSU C;  3WTP A;  4YS3 D;  1EQZ D;  5E5A A;  3LEL B;  2CV5 B;  2IO5 B;  3C1B B;  3MVD A;  5BNX A;  1P3B A;  4Z2M G;  5AV6 C;  5CP6 B;  3AFA B;  3V9R B;  1P3I A;  5GXQ D;  2CWE A;  5G49 A;  3AZM D;  3W98 B;  1M1A C;  3VH6 A;  3AZH B;  5B1L D;  1P34 D;  4YS3 B;  1EQZ B;  2YFW B;  1U35 A;  4J8U D;  4ZUX C;  5BS7 C;  5CPI A;  1F66 A;  2HUE C;  5GXQ B;  5B24 D;  3REL D;  5CP6 A;  5FUG B;  5B33 D;  4XZQ A;  3AFA A;  3A6N C;  3LJA D;  5AY8 C;  1WWI A;  1P34 B;  5B1L B;  3W99 C;  3KXB C;  5CPJ D;  3B0B A;  1P3F C;  4YS3 A;  2YFW A;  3AZN C;  1P3M A;  5F99 C;  1HQ3 B;  3AV1 D;  5B24 B;  4J8V B;  5BO0 A;  3REL B;  3MNN A;  4LD9 A;  4X23 C;  5B2I D;  5DNN D;  4CSR B;  5CPJ B;  5FUG A;  1KX3 D;  4EO5 B;  1R4V A;  1ID3 D;  3AV2 A;  5B32 C;  3REJ A;  3AV1 B;  2PYO C;  3B6F B;  1P3P D;  1ZLA C;  1HQ3 A;  1M19 D;  5B2I B;  4XUJ D;  5B24 A;  4J8V A;  3AZI A;  4J8W D;  5DNN B;  4HGA B;  3AZL D;  3X1S D;  4YM6 A;  1KX3 B;  4WNN B;  3WTP E;  3MGS C;  3AYW C;  1JFI B;  2NQB C;  5CPJ A;  4H9S A;  4J8X A;  3UTA A;  1ID3 B;  4H9N A;  3REK D;  4AWL B;  1M19 B;  4XUJ B;  5GT3 A;  5B1M C;  3LZ1 A;  4J8W B;  3B6F A;  3X1S B;  2ARO B;  5B2I A;  5DNN A;  1P3L C;  3WAA C;  1BH8 B;  4WNN A;  3KWQ D;  1JFI A;  3REK B;  1P3A D;  3AZF D;  5AV9 A;  3AN2 A;  5CPK D;  1M19 A;  2FJ7 C;  3LZ0 C;  5GT0 C;  2ARO A;  4R8P C;  3KWQ B;  3REI C;  2RVQ C;  5B2J D;  5B40 D;  1P3A B;  3AZF B;  1M18 C;  3B6G A;  1S32 D;  3C1C A;  5AVC C;  3TU4 D;  3O62 A;  5B32 G;  5CPK B;  4KGC C;  1AOI D;  3REH D;  2LY8 A;  3W97 C;  5B2J B;  2F8N H;  2L5A A;  4M6B A;  5B40 B;  2BYK B;  1S32 B;  5B31 D;  3TU4 B;  4H9R B;  1B67 A;  5GSU D;  1P3O C;  3MGR C;  1AOI B;  3MGQ C;  5AVB A;  3NQU B;  3REH B;  1P3G C;  5AV6 D;  3X1V A;  4ZBJ B;  3KUY D;  2YFV B;  4JJN A;  3UTB C;  5B31 B;  5B2J A;  1KX4 A;  2HIO C;  5B40 A;  1M1A D;  4NE6 A;  1BFM A;  5B0Z C;  5GSU B;  1S32 A;  4Z5T A;  5AV8 C;  2NZD C;  4H9R A;  3UT9 C;  5AV6 B;  4ZUX D;  5DNM C;  4WU8 B;  4NE5 A;  3KUY B;  3MGP A;  1M1A B;  1KX5 C;  3A6N D;  5AY8 D;  3WKJ C;  3KXB D;  3AZG C;  1P3F D;  1P3K C;  5AV5 B;  4KUD B;  5JRG D;  3MVD C;  4ZUX B;  3AZN D;  1P3B C;  5F99 D;  1Q9C A;  1H3O B;  2HUE B;  1P3I C;  4WU8 A;  3LEL A;  2JSS A;  4X23 D;  3KUY A;  2CV5 A;  3VH5 A;  3A6N B;  3C1B A;  5AY8 B;  3KXB B;  3AZM B;  1P3F B;  3V9R A;  5JRG B;  1U35 C;  3WA9 C;  3AZN B;  3W98 A;  5F99 B;  4WZS B;  5B32 D;  5CPI C;  1F66 C;  2IO5 C;  5AV5 A;  4KUD A;  2PYO D;  4J8U B;  5BS7 A;  3AZH A;  1ZLA D;  1EQZ A;  3R45 B;  4X23 B;  5CP6 C;  1H3O A;  1ULY A;  4XZQ C;  3AFA C;  3VH6 T;  3A6N A;  5B33 B;  3MGS D;  3AYW D;  2NQB D;  3AZJ C;  5GXQ A;  3LJA B;  3AZM A;  5B32 B;  1P3F A;  1P3M C;  2PYO B;  5JRG A;  1P34 A;  5B1L A;  3AZN A;  1ZLA B;  5B31 G;  3MNN C;  4LD9 C;  5B1M D;  4J8U A;  3W96 C;  4E45 A;  3AYW B;  5B0Y C;  2NQB B;  3REL A;  1P3L D;  3WAA D;  5B33 A;  3AV2 C;  4H9Q B;  5BNV B;  2BYM B;  3LJA A;  3REJ C;  4CSR A;  5B32 A;  2PYO A;  1HQ3 C;  4G91 C;  3AZI C;  4WU9 C;  4J8V C;  1P3P B;  3X1U C;  3AV1 A;  4YM6 C;  2FJ7 D;  3LZ0 D;  1P3L B;  5GT0 D;  3AZL B;  4R8P D;  3REI D;  3WAA B;  4J8X C;  3UTA C;  2NQB A;  2RVQ D;  3AZE C;  1M18 D;  4NFT A;  1KX3 A;  4H9Q A;  5BNV A;  5AVC D;  5GT3 C;  3LZ1 C;  3B6F C;  1ID3 A;  4KGC D;  5C3I C;  2FJ7 B;  3LZ0 B;  5GT0 B;  4E44 A;  1P3P A;  4R8P B;  3REI B;  3W97 D;  1KU5 A;  4XUJ A;  4J8W A;  3AZL A;  3VH6 W;  4QLC C;  1TZY C;  1M18 B;  3X1S A;  4Z2M H;  3AZK C;  2F8N K;  5AVC B;  4DRB A;  5AV9 C;  3AN2 C;  4KGC B;  1BH8 A;  1P3O D;  3MGQ D;  3REK A;  1WWS A;  3B0D C;  2ARO C;  3LZ0 A;  5GT0 A;  3REI A;  3UTB D;  3B6G C;  1HTA A;  3C1C C;  1M18 A;  5B0Z D;  2F8N D;  3O62 C;  3KWQ A;  1P3O B;  5AVC A;  5AV8 D;  2NZD D;  1P3A A;  3UT9 D;  3AZF A;  5DNM D;  4Z66 C;  3X1T C;  5CPK A;  1KX5 D;  2F8N B;  3WKJ D;  3AZG D;  5AV8 B;  1P3K D;  1N1J B;  3UT9 B;  1BH9 B;  2BYK A;  5AVB C;  3MVD D;  5DNM B;  1P3B D;  3X1V C;  3TU4 A;  4JJN C;  1P3I D;  5JA4 B;  1AOI A;  1KX5 B;  1KX4 C;  3NQU A;  3REH A;  3WKJ B;  3AZG B;  4Z5T C;  1P3K B;  2YFV A;  3MVD B;  5BNX B;  1U35 D;  1B6W A;  3WA9 D;  3B0C T;  3W99 D;  5B31 A;  1F66 D;  3WTP C;  5CPI D;  5E5A C;  3MGP C;  5GSU A;  5DNM A;  1F1E A;  5CP6 D;  4ZBJ C;  4XZQ D;  3AFA D;  5AV6 A;  5JA4 A;  1KX5 A;  3WKJ A;  3AZJ D;  1U35 B;  3WA9 B;  3W99 B;  1F66 B;  5CPI B;  1P3K A;  1P3M D;  1M1A A;  4G92 C;  5BT1 C;  3MNN D;  4LD9 D;  4WU8 C;  3KSY A;  3LEL C;  5CHL B;  4XZQ B;  3KUY C;  2CV5 C;  3W96 D;  3C1B C;  4ZUX A;  5B0Y D;  3AZJ B;  3W98 C;  1P3M B;  3AV2 D;  3REJ D;  4KUD C;  5AY8 A;  5AV5 C;  3WA9 A;  3W99 A;  5BO0 B;  3KXB A;  3MNN B;  4LD9 B;  3AZH C;  4YS3 C;  1EQZ C;  4NE3 A;  1HQ3 D;  2F8N G;  3AZI D;  4WU9 D;  3NQJ B;  3VH5 T;  4J8V D;  3W96 B;  3X1U D;  5F99 A;  5B0Y B;  4YM6 D;  4DRA A;  5GXQ C;  3R45 A;  3AZM C;  4X23 A;  4J8X D;  3UTA D;  3AV2 B;  3AZJ A;  3MGS B;  3REJ B;  3AZE D;  5JRG C;  1P34 C;  5B1L C;  4G91 B;  3AZI B;  3B0C W;  5GT3 D;  4WU9 B;  3LZ1 D;  3B6F D;  4J8U C;  3X1U B;  4YM6 B;  3W96 A;  3NQJ A;  5B1M B;  1ZLA A;  5B24 C;  3REL C;  5B0Y A;  4J8X B;  3UTA B;  5B33 C;  3AZE B;  4H9N B;  4KHA B;  4QLC D;  3LJA C;  1TZY D;  5CPJ C;  4H9S C;  3AZK D;  3MGS A;  3AYW A;  5KDM B;  5GT3 B;  4H9P B;  4EO5 C;  3LZ1 B;  5AV9 D;  3AN2 D;  5C3I B;  4WU9 A;  3AV1 C;  2BYM A;  3X1U A;  2ARO D;  5B1M A;  5B2I C;  4QLC B;  1TZY B;  5DNN C;  4HGA C;  3AZK B;  3B6G D;  3AZE A;  1KX3 C;  4KHA A;  1P3L A;  3C1C D;  5AV9 B;  3AN2 B;  4H9O B;  3O62 D;  3WAA A;  1ID3 C;  5KDM A;  4H9P A;  1P3P C;  3B0D B;  4AWL C;  3VH5 W;  4CAY B;  1M19 C;  3MGR D;  4XUJ C;  4J8W C;  4Z66 D;  3X1T D;  3AZL C;  1P3G D;  3B6G B;  3X1S C;  3W97 B;  4QLC A;  2FJ7 A;  3C1C B;  1TZY A;  3AZK A;  4R8P A;  3O62 B;  2HIO D;  3REK C;  4H9O A;  5AVB D;  3X1V D;  3MGR B;  3MGQ B;  4UUZ B;  4Z66 B;  3X1T B;  4JJN D;  4KGC A;  1P3G B;  4CAY A;  1TAF B;  1KX4 D;  3UTB B;  3W97 A;  3KWQ C;  4Z5T D;  2HIO B;  5AVB B;  5B0Z B;  1P3A C;  3AZF C;  3X1V B;  3WTP D;  2NZD B;  5E5A D;  4JJN B;  3MGP D;  1P3O A;  5CPK C;  3MGR A;  3MGQ A;  4UUZ A;  4Z66 A;  3X1T A;  1KX4 B;  1P3G A; 
#chains in the Genus database with same CATH topology
 1TAF A;  4Z5T B;  5B2J C;  3UTB A;  5B40 C;  3FDD A;  3WTP B;  2HIO A;  1S32 C;  5E5A B;  5B0Z A;  5BT1 D;  3TU4 C;  4WV4 B;  3MGP B;  2F8N A;  5AV8 A;  1P3B B;  4WU8 D;  2NZD A;  1A7W A;  3LEL D;  2CV5 D;  1AOI C;  1N1J A;  3UT9 A;  1BH9 A;  2ZY4 A;  3C1B D;  3REH C;  1P3I B;  5G49 B;  3W98 D;  5B31 C;  4G92 B;  4KUD D;  5AV5 D;  3AZG A;  3AZH D;  5GSU C;  3WTP A;  4YS3 D;  1EQZ D;  5E5A A;  3LEL B;  2CV5 B;  2IO5 B;  3C1B B;  3MVD A;  5BNX A;  1P3B A;  2Y2H A;  4Z2M G;  5AV6 C;  5CP6 B;  3AFA B;  3V9R B;  1P3I A;  5GXQ D;  2CWE A;  5G49 A;  3AZM D;  3W98 B;  1M1A C;  3VH6 A;  3AZH B;  5B1L D;  1P34 D;  4YS3 B;  1EQZ B;  2YFW B;  2W8S A;  1U35 A;  4J8U D;  4ZUX C;  5BS7 C;  5CPI A;  1F66 A;  2HUE C;  1W2E A;  5GXQ B;  5B24 D;  3REL D;  5CP6 A;  5FUG B;  5B33 D;  4XZQ A;  3AFA A;  3A6N C;  3LJA D;  5AY8 C;  1WWI A;  1P34 B;  5B1L B;  3W99 C;  3KXB C;  5CPJ D;  3B0B A;  1P3F C;  4YS3 A;  2YFW A;  3AZN C;  1P3M A;  5F99 C;  1HQ3 B;  3AV1 D;  5B24 B;  4J8V B;  5BO0 A;  3REL B;  3MNN A;  4LD9 A;  4X23 C;  5B2I D;  5DNN D;  4CSR B;  5CPJ B;  5FUG A;  2G5I C;  1KX3 D;  4EO5 B;  1R4V A;  2Y2I A;  1ID3 D;  3AV2 A;  5B32 C;  3REJ A;  3AV1 B;  2PYO C;  3B6F B;  1P3P D;  1ZLA C;  1HQ3 A;  1M19 D;  5B2I B;  4XUJ D;  5B24 A;  4J8V A;  3AZI A;  4J8W D;  5DNN B;  4HGA B;  3AZL D;  3X1S D;  4YM6 A;  3H0M C;  4WNN B;  3WTP E;  3MGS C;  3AYW C;  1KX3 B;  1JFI B;  2NQB C;  5CPJ A;  4H9S A;  4J8X A;  3UTA A;  1ID3 B;  4H9N A;  3REK D;  3P5J B;  4AWL B;  1M19 B;  4XUJ B;  5GT3 A;  5B1M C;  3LZ1 A;  4J8W B;  3B6F A;  3X1S B;  2ARO B;  5B2I A;  5DNN A;  1P3L C;  3WAA C;  1BH8 B;  4WNN A;  3KWQ D;  1JFI A;  3REK B;  1P3A D;  3AZF D;  5AV9 A;  3AN2 A;  5CPK D;  1M19 A;  2FJ7 C;  3LZ0 C;  5GT0 C;  2ARO A;  4R8P C;  3KWQ B;  3REI C;  2RVQ C;  5B2J D;  5B40 D;  1P3A B;  3AZF B;  1M18 C;  3B6G A;  1Z2C B;  1S32 D;  3C1C A;  5AVC C;  3TU4 D;  3O62 A;  5B32 G;  5CPK B;  4KGC C;  1AOI D;  3REH D;  2LY8 A;  3W97 C;  5B2J B;  2F8N H;  2L5A A;  4M6B A;  5B40 B;  2BYK B;  1S32 B;  2ZY5 A;  5B31 D;  3TU4 B;  4H9R B;  1B67 A;  5GSU D;  1P3O C;  3MGR C;  1AOI B;  3MGQ C;  5AVB A;  3NQU B;  3REH B;  1P3G C;  2FFF B;  3EPK A;  5AV6 D;  3X1V A;  2DQN C;  4ZBJ B;  3KUY D;  2YFV B;  4JJN A;  3UTB C;  5B31 B;  5B2J A;  1KX4 A;  2HIO C;  5B40 A;  1M1A D;  4NE6 A;  1BFM A;  5B0Z C;  5GSU B;  1S32 A;  4Z5T A;  5AV8 C;  2NZD C;  2XD5 A;  4H9R A;  3UT9 C;  5AV6 B;  4ZUX D;  5DNM C;  4WU8 B;  4NE5 A;  3KUY B;  3MGP A;  3EPH A;  1M1A B;  1KX5 C;  3A6N D;  5AY8 D;  3WKJ C;  3KXB D;  3AZG C;  1P3F D;  1P3K C;  5AV5 B;  4KUD B;  5JRG D;  3MVD C;  4ZUX B;  3AZN D;  1P3B C;  5F99 D;  1Q9C A;  1H3O B;  2HUE B;  1P3I C;  4WU8 A;  3LEL A;  2JSS A;  4X23 D;  3KUY A;  2CV5 A;  3VH5 A;  3A6N B;  3C1B A;  5AY8 B;  3KXB B;  3AZM B;  1P3F B;  3V9R A;  5JRG B;  1U35 C;  3WA9 C;  3AZN B;  3W98 A;  5F99 B;  4WZS B;  5B32 D;  5CPI C;  1F66 C;  2IO5 C;  5AV5 A;  4KUD A;  2PYO D;  3H0L C;  4J8U B;  5BS7 A;  3AZH A;  1ZLA D;  1EQZ A;  3R45 B;  4X23 B;  5CP6 C;  1H3O A;  1ULY A;  4XZQ C;  3AFA C;  3VH6 T;  3A6N A;  5B33 B;  3MGS D;  3AYW D;  2NQB D;  3AZJ C;  5GXQ A;  3LJA B;  3AZM A;  1PZR A;  5B32 B;  1P3F A;  1P3M C;  3A1K A;  2PYO B;  5JRG A;  1P34 A;  5B1L A;  3AZN A;  1ZLA B;  5B31 G;  3MNN C;  4LD9 C;  2Y2O A;  5B1M D;  4J8U A;  3W96 C;  4E45 A;  3AYW B;  5B0Y C;  2F2A C;  2NQB B;  3REL A;  1P3L D;  3WAA D;  5B33 A;  3AV2 C;  4H9Q B;  5BNV B;  2BYM B;  3LJA A;  3REJ C;  3F6T A;  4CSR A;  5B32 A;  4DQY B;  2PYO A;  1HQ3 C;  4G91 C;  2Y2N A;  3AZI C;  4WU9 C;  4J8V C;  1P3P B;  3X1U C;  3AV1 A;  4YM6 C;  2FJ7 D;  3LZ0 D;  1P3L B;  5GT0 D;  2DF4 C;  3AZL B;  2Y2P A;  4R8P D;  3REI D;  3WAA B;  4J8X C;  3UTA C;  2NQB A;  2Y2G A;  2RVQ D;  3AZE C;  1M18 D;  4NFT A;  2VQR A;  1KX3 A;  4H9Q A;  3H0R C;  5BNV A;  5AVC D;  5GT3 C;  3LZ1 C;  3B6F C;  1ID3 A;  4KGC D;  5C3I C;  2FJ7 B;  3LZ0 B;  5GT0 B;  4E44 A;  1P3P A;  4R8P B;  3REI B;  3W97 D;  1KU5 A;  4XUJ A;  4J8W A;  3AZL A;  3VH6 W;  4QLC C;  1TZY C;  1M18 B;  3X1S A;  4Z2M H;  3AZK C;  2F8N K;  5AVC B;  4DRB A;  5AV9 C;  3AN2 C;  4KGC B;  1BH8 A;  2Y2M A;  1P3O D;  3MGQ D;  3REK A;  1WWS A;  3B0D C;  2ARO C;  3LZ0 A;  5GT0 A;  3KFU G;  3REI A;  2Y2J A;  3UTB D;  3B6G C;  1HTA A;  3C1C C;  1M18 A;  5B0Z D;  2RIQ A;  2F8N D;  3O62 C;  3KWQ A;  2J8P A;  1P3O B;  5AVC A;  5AV8 D;  2NZD D;  1P3A A;  3UT9 D;  3AZF A;  5DNM D;  4UPK A;  4Z66 C;  3X1T C;  5CPK A;  1KX5 D;  2F8N B;  3WKJ D;  3IP4 C;  3AZG D;  5AV8 B;  1P3K D;  1N1J B;  3UT9 B;  1BH9 B;  2BYK A;  5AVB C;  3MVD D;  5DNM B;  1P3B D;  3X1V C;  4WJ3 C;  3TU4 A;  2JCH A;  3AL0 C;  4JJN C;  1P3I D;  5JA4 B;  1AOI A;  1KX5 B;  1KX4 C;  3NQU A;  3REH A;  3WKJ B;  3AZG B;  4Z5T C;  1P3K B;  2YFV A;  3MVD B;  5BNX B;  1U35 D;  1B6W A;  3WA9 D;  3B0C T;  3W99 D;  5B31 A;  1F66 D;  3WTP C;  5CPI D;  5E5A C;  3MGP C;  5GSU A;  5DNM A;  1F1E A;  3A1I A;  5CP6 D;  4ZBJ C;  4XZQ D;  3AFA D;  5AV6 A;  5JA4 A;  1KX5 A;  1T3U A;  3WKJ A;  3AZJ D;  1U35 B;  3WA9 B;  2BG1 A;  3W99 B;  1F66 B;  5CPI B;  1P3K A;  1P3M D;  1M1A A;  4G92 C;  5BT1 C;  3MNN D;  4LD9 D;  4WU8 C;  3KSY A;  3LEL C;  5CHL B;  4XZQ B;  3KUY C;  2CV5 C;  3W96 D;  3C1B C;  4ZUX A;  2ZY2 A;  5B0Y D;  2JE5 A;  3AZJ B;  3W98 C;  1P3M B;  3AV2 D;  3REJ D;  4KUD C;  5AY8 A;  5AV5 C;  3WA9 A;  3W99 A;  5BO0 B;  3KXB A;  3MNN B;  4LD9 B;  3AZH C;  4YS3 C;  1EQZ C;  4NE3 A;  2UWX A;  3EG5 B;  1HQ3 D;  2F8N G;  3AZI D;  4WU9 D;  3NQJ B;  3VH5 T;  4J8V D;  3W96 B;  3X1U D;  5F99 A;  5B0Y B;  4YM6 D;  4DRA A;  5GXQ C;  3R45 A;  2ZY3 A;  3AZM C;  4X23 A;  4J8X D;  3UTA D;  3AV2 B;  3AZJ A;  3MGS B;  3REJ B;  3AZE D;  5JRG C;  1P34 C;  5B1L C;  4G91 B;  3AZI B;  3B0C W;  5GT3 D;  4WU9 B;  3LZ1 D;  3B6F D;  4J8U C;  3X1U B;  4YM6 B;  3W96 A;  3NQJ A;  5B1M B;  1ZLA A;  5B24 C;  3REL C;  5B0Y A;  4J8X B;  3UTA B;  3EPL A;  5B33 C;  3AZE B;  4H9N B;  4KHA B;  4QLC D;  3LJA C;  1TZY D;  5CPJ C;  4H9S C;  3AZK D;  3MGS A;  3AYW A;  5KDM B;  5GT3 B;  4H9P B;  4EO5 C;  3LZ1 B;  3EPJ A;  5AV9 D;  3AN2 D;  5C3I B;  4WU9 A;  3AV1 C;  2BYM A;  3X1U A;  2ZM5 A;  2ARO D;  5B1M A;  5B2I C;  4QLC B;  1TZY B;  5DNN C;  4HGA C;  3AZK B;  3B6G D;  3AZE A;  1KX3 C;  4KHA A;  1P3L A;  3C1C D;  2XD1 A;  5AV9 B;  3AN2 B;  4H9O B;  3O62 D;  3WAA A;  1ID3 C;  5KDM A;  4H9P A;  1P3P C;  3B0D B;  4AWL C;  3VH5 W;  4CAY B;  1M19 C;  3MGR D;  4XUJ C;  2Y2L A;  4J8W C;  4Z66 D;  3X1T D;  2Y2K A;  3AZL C;  1P3G D;  3B6G B;  3X1S C;  3W97 B;  4QLC A;  2FJ7 A;  3C1C B;  1TZY A;  3AZK A;  4R8P A;  3O62 B;  2HIO D;  3REK C;  4H9O A;  5AVB D;  3X1V D;  3MGR B;  3MGQ B;  4UUZ B;  4Z66 B;  3X1T B;  4JJN D;  4KGC A;  1P3G B;  2G5H C;  4CAY A;  1TAF B;  1KX4 D;  3UTB B;  3W97 A;  3KWQ C;  4Z5T D;  2HIO B;  5AVB B;  5B0Z B;  2Y2Q A;  1P3A C;  3AZF C;  3X1V B;  3WTP D;  2NZD B;  5E5A D;  4JJN B;  3MGP D;  1P3O A;  5CPK C;  3MGR A;  3MGQ A;  4UUZ A;  4Z66 A;  3X1T A;  1KX4 B;  1P3G A; 
#chains in the Genus database with same CATH homology
 1TAF A;  4Z5T B;  5B2J C;  3UTB A;  5B40 C;  3FDD A;  3WTP B;  2HIO A;  1S32 C;  5E5A B;  5B0Z A;  5BT1 D;  3TU4 C;  4WV4 B;  3MGP B;  2F8N A;  5AV8 A;  1P3B B;  4WU8 D;  2NZD A;  1A7W A;  3LEL D;  2CV5 D;  1AOI C;  1N1J A;  3UT9 A;  1BH9 A;  2ZY4 A;  3C1B D;  3REH C;  1P3I B;  5G49 B;  3W98 D;  5B31 C;  4G92 B;  4KUD D;  5AV5 D;  3AZG A;  3AZH D;  5GSU C;  3WTP A;  4YS3 D;  1EQZ D;  5E5A A;  3LEL B;  2CV5 B;  2IO5 B;  3C1B B;  3MVD A;  5BNX A;  1P3B A;  2Y2H A;  4Z2M G;  5AV6 C;  5CP6 B;  3AFA B;  3V9R B;  1P3I A;  5GXQ D;  2CWE A;  5G49 A;  3AZM D;  3W98 B;  1M1A C;  3VH6 A;  3AZH B;  5B1L D;  1P34 D;  4YS3 B;  1EQZ B;  2YFW B;  2W8S A;  1U35 A;  4J8U D;  4ZUX C;  5BS7 C;  5CPI A;  1F66 A;  2HUE C;  1W2E A;  5GXQ B;  5B24 D;  3REL D;  5CP6 A;  5FUG B;  5B33 D;  4XZQ A;  3AFA A;  3A6N C;  3LJA D;  5AY8 C;  1WWI A;  1P34 B;  5B1L B;  3W99 C;  3KXB C;  5CPJ D;  3B0B A;  1P3F C;  4YS3 A;  2YFW A;  3AZN C;  1P3M A;  5F99 C;  1HQ3 B;  3AV1 D;  5B24 B;  4J8V B;  5BO0 A;  3REL B;  3MNN A;  4LD9 A;  4X23 C;  5B2I D;  5DNN D;  4CSR B;  5CPJ B;  5FUG A;  2G5I C;  1KX3 D;  4EO5 B;  1R4V A;  2Y2I A;  1ID3 D;  3AV2 A;  5B32 C;  3REJ A;  3AV1 B;  2PYO C;  3B6F B;  1P3P D;  1ZLA C;  1HQ3 A;  1M19 D;  5B2I B;  4XUJ D;  5B24 A;  4J8V A;  3AZI A;  4J8W D;  5DNN B;  4HGA B;  3AZL D;  3X1S D;  4YM6 A;  3H0M C;  4WNN B;  3WTP E;  3MGS C;  3AYW C;  1KX3 B;  1JFI B;  2NQB C;  5CPJ A;  4H9S A;  4J8X A;  3UTA A;  1ID3 B;  4H9N A;  3REK D;  3P5J B;  4AWL B;  1M19 B;  4XUJ B;  5GT3 A;  5B1M C;  3LZ1 A;  4J8W B;  3B6F A;  3X1S B;  2ARO B;  5B2I A;  5DNN A;  1P3L C;  3WAA C;  1BH8 B;  4WNN A;  3KWQ D;  1JFI A;  3REK B;  1P3A D;  3AZF D;  5AV9 A;  3AN2 A;  5CPK D;  1M19 A;  2FJ7 C;  3LZ0 C;  5GT0 C;  2ARO A;  4R8P C;  3KWQ B;  3REI C;  2RVQ C;  5B2J D;  5B40 D;  1P3A B;  3AZF B;  1M18 C;  3B6G A;  1Z2C B;  1S32 D;  3C1C A;  5AVC C;  3TU4 D;  3O62 A;  5B32 G;  5CPK B;  4KGC C;  1AOI D;  3REH D;  2LY8 A;  3W97 C;  5B2J B;  2F8N H;  2L5A A;  4M6B A;  5B40 B;  2BYK B;  1S32 B;  2ZY5 A;  5B31 D;  3TU4 B;  4H9R B;  1B67 A;  5GSU D;  1P3O C;  3MGR C;  1AOI B;  3MGQ C;  5AVB A;  3NQU B;  3REH B;  1P3G C;  2FFF B;  3EPK A;  5AV6 D;  3X1V A;  2DQN C;  4ZBJ B;  3KUY D;  2YFV B;  4JJN A;  3UTB C;  5B31 B;  5B2J A;  1KX4 A;  2HIO C;  5B40 A;  1M1A D;  4NE6 A;  1BFM A;  5B0Z C;  5GSU B;  1S32 A;  4Z5T A;  5AV8 C;  2NZD C;  2XD5 A;  4H9R A;  3UT9 C;  5AV6 B;  4ZUX D;  5DNM C;  4WU8 B;  4NE5 A;  3KUY B;  3MGP A;  3EPH A;  1M1A B;  1KX5 C;  3A6N D;  5AY8 D;  3WKJ C;  3KXB D;  3AZG C;  1P3F D;  1P3K C;  5AV5 B;  4KUD B;  5JRG D;  3MVD C;  4ZUX B;  3AZN D;  1P3B C;  5F99 D;  1Q9C A;  1H3O B;  2HUE B;  1P3I C;  4WU8 A;  3LEL A;  2JSS A;  4X23 D;  3KUY A;  2CV5 A;  3VH5 A;  3A6N B;  3C1B A;  5AY8 B;  3KXB B;  3AZM B;  1P3F B;  3V9R A;  5JRG B;  1U35 C;  3WA9 C;  3AZN B;  3W98 A;  5F99 B;  4WZS B;  5B32 D;  5CPI C;  1F66 C;  2IO5 C;  5AV5 A;  4KUD A;  2PYO D;  3H0L C;  4J8U B;  5BS7 A;  3AZH A;  1ZLA D;  1EQZ A;  3R45 B;  4X23 B;  5CP6 C;  1H3O A;  1ULY A;  4XZQ C;  3AFA C;  3VH6 T;  3A6N A;  5B33 B;  3MGS D;  3AYW D;  2NQB D;  3AZJ C;  5GXQ A;  3LJA B;  3AZM A;  1PZR A;  5B32 B;  1P3F A;  1P3M C;  3A1K A;  2PYO B;  5JRG A;  1P34 A;  5B1L A;  3AZN A;  1ZLA B;  5B31 G;  3MNN C;  4LD9 C;  2Y2O A;  5B1M D;  4J8U A;  3W96 C;  4E45 A;  3AYW B;  5B0Y C;  2F2A C;  2NQB B;  3REL A;  1P3L D;  3WAA D;  5B33 A;  3AV2 C;  4H9Q B;  5BNV B;  2BYM B;  3LJA A;  3REJ C;  3F6T A;  4CSR A;  5B32 A;  4DQY B;  2PYO A;  1HQ3 C;  4G91 C;  2Y2N A;  3AZI C;  4WU9 C;  4J8V C;  1P3P B;  3X1U C;  3AV1 A;  4YM6 C;  2FJ7 D;  3LZ0 D;  1P3L B;  5GT0 D;  2DF4 C;  3AZL B;  2Y2P A;  4R8P D;  3REI D;  3WAA B;  4J8X C;  3UTA C;  2NQB A;  2Y2G A;  2RVQ D;  3AZE C;  1M18 D;  4NFT A;  2VQR A;  1KX3 A;  4H9Q A;  3H0R C;  5BNV A;  5AVC D;  5GT3 C;  3LZ1 C;  3B6F C;  1ID3 A;  4KGC D;  5C3I C;  2FJ7 B;  3LZ0 B;  5GT0 B;  4E44 A;  1P3P A;  4R8P B;  3REI B;  3W97 D;  1KU5 A;  4XUJ A;  4J8W A;  3AZL A;  3VH6 W;  4QLC C;  1TZY C;  1M18 B;  3X1S A;  4Z2M H;  3AZK C;  2F8N K;  5AVC B;  4DRB A;  5AV9 C;  3AN2 C;  4KGC B;  1BH8 A;  2Y2M A;  1P3O D;  3MGQ D;  3REK A;  1WWS A;  3B0D C;  2ARO C;  3LZ0 A;  5GT0 A;  3KFU G;  3REI A;  2Y2J A;  3UTB D;  3B6G C;  1HTA A;  3C1C C;  1M18 A;  5B0Z D;  2RIQ A;  2F8N D;  3O62 C;  3KWQ A;  2J8P A;  1P3O B;  5AVC A;  5AV8 D;  2NZD D;  1P3A A;  3UT9 D;  3AZF A;  5DNM D;  4UPK A;  4Z66 C;  3X1T C;  5CPK A;  1KX5 D;  2F8N B;  3WKJ D;  3IP4 C;  3AZG D;  5AV8 B;  1P3K D;  1N1J B;  3UT9 B;  1BH9 B;  2BYK A;  5AVB C;  3MVD D;  5DNM B;  1P3B D;  3X1V C;  4WJ3 C;  3TU4 A;  2JCH A;  3AL0 C;  4JJN C;  1P3I D;  5JA4 B;  1AOI A;  1KX5 B;  1KX4 C;  3NQU A;  3REH A;  3WKJ B;  3AZG B;  4Z5T C;  1P3K B;  2YFV A;  3MVD B;  5BNX B;  1U35 D;  1B6W A;  3WA9 D;  3B0C T;  3W99 D;  5B31 A;  1F66 D;  3WTP C;  5CPI D;  5E5A C;  3MGP C;  5GSU A;  5DNM A;  1F1E A;  3A1I A;  5CP6 D;  4ZBJ C;  4XZQ D;  3AFA D;  5AV6 A;  5JA4 A;  1KX5 A;  1T3U A;  3WKJ A;  3AZJ D;  1U35 B;  3WA9 B;  2BG1 A;  3W99 B;  1F66 B;  5CPI B;  1P3K A;  1P3M D;  1M1A A;  4G92 C;  5BT1 C;  3MNN D;  4LD9 D;  4WU8 C;  3KSY A;  3LEL C;  5CHL B;  4XZQ B;  3KUY C;  2CV5 C;  3W96 D;  3C1B C;  4ZUX A;  2ZY2 A;  5B0Y D;  2JE5 A;  3AZJ B;  3W98 C;  1P3M B;  3AV2 D;  3REJ D;  4KUD C;  5AY8 A;  5AV5 C;  3WA9 A;  3W99 A;  5BO0 B;  3KXB A;  3MNN B;  4LD9 B;  3AZH C;  4YS3 C;  1EQZ C;  4NE3 A;  2UWX A;  3EG5 B;  1HQ3 D;  2F8N G;  3AZI D;  4WU9 D;  3NQJ B;  3VH5 T;  4J8V D;  3W96 B;  3X1U D;  5F99 A;  5B0Y B;  4YM6 D;  4DRA A;  5GXQ C;  3R45 A;  2ZY3 A;  3AZM C;  4X23 A;  4J8X D;  3UTA D;  3AV2 B;  3AZJ A;  3MGS B;  3REJ B;  3AZE D;  5JRG C;  1P34 C;  5B1L C;  4G91 B;  3AZI B;  3B0C W;  5GT3 D;  4WU9 B;  3LZ1 D;  3B6F D;  4J8U C;  3X1U B;  4YM6 B;  3W96 A;  3NQJ A;  5B1M B;  1ZLA A;  5B24 C;  3REL C;  5B0Y A;  4J8X B;  3UTA B;  3EPL A;  5B33 C;  3AZE B;  4H9N B;  4KHA B;  4QLC D;  3LJA C;  1TZY D;  5CPJ C;  4H9S C;  3AZK D;  3MGS A;  3AYW A;  5KDM B;  5GT3 B;  4H9P B;  4EO5 C;  3LZ1 B;  3EPJ A;  5AV9 D;  3AN2 D;  5C3I B;  4WU9 A;  3AV1 C;  2BYM A;  3X1U A;  2ZM5 A;  2ARO D;  5B1M A;  5B2I C;  4QLC B;  1TZY B;  5DNN C;  4HGA C;  3AZK B;  3B6G D;  3AZE A;  1KX3 C;  4KHA A;  1P3L A;  3C1C D;  2XD1 A;  5AV9 B;  3AN2 B;  4H9O B;  3O62 D;  3WAA A;  1ID3 C;  5KDM A;  4H9P A;  1P3P C;  3B0D B;  4AWL C;  3VH5 W;  4CAY B;  1M19 C;  3MGR D;  4XUJ C;  2Y2L A;  4J8W C;  4Z66 D;  3X1T D;  2Y2K A;  3AZL C;  1P3G D;  3B6G B;  3X1S C;  3W97 B;  4QLC A;  2FJ7 A;  3C1C B;  1TZY A;  3AZK A;  4R8P A;  3O62 B;  2HIO D;  3REK C;  4H9O A;  5AVB D;  3X1V D;  3MGR B;  3MGQ B;  4UUZ B;  4Z66 B;  3X1T B;  4JJN D;  4KGC A;  1P3G B;  2G5H C;  4CAY A;  1TAF B;  1KX4 D;  3UTB B;  3W97 A;  3KWQ C;  4Z5T D;  2HIO B;  5AVB B;  5B0Z B;  2Y2Q A;  1P3A C;  3AZF C;  3X1V B;  3WTP D;  2NZD B;  5E5A D;  4JJN B;  3MGP D;  1P3O A;  5CPK C;  3MGR A;  3MGQ A;  4UUZ A;  4Z66 A;  3X1T A;  1KX4 B;  1P3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...