3AZKA

Crystal structure of human nucleosome core particle containing h4k59q mutation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azkA00
1BH8B 4H9PB 3RELB 3W98A 1P3KC 1P3BD 4KHAB 3NQJA 3W97D 3WAAB 4E45A 1S32C 5B1LA 3MGQD 3REKA 5FUGA 4LD9B 1R4VA 3A6NA 3X1SC 1F66B 5CPJD 2PYOC 3O62D 3UTBB 1B6WA 1P3AA 2L5AA 5DNNB 3LZ1D 3AZEA 3AV2B 3MGPA 4J8UB 3WKJA 2F8ND 3WTPB 5JA4A 1M18A 4G91B 3KXBB 3KWQB 3MGSB 3W96D 4QLCD 1TAFB 3KUYA 5GT3A 4J8WA 5GT0A 3C1CA 1ZLAD 4WNNA 4XUJB 3AZMC 2YFVA 3C1BB 4YM6A 5B2JA 1P3GD 1F66C 3MNNA 3LZ0A 3AZEC 5JRGD 3MGPC 5AVBA 3AZJD 3AV2C 3REHA 4KUDD 1B67A 3KXBC 5B40B 2LY8A 5CPKD 2BYMB 5GT3C 4WU8B 3AZLB 4E44A 5CPID 5GT0C 3C1CC 2NQBB 3LELD 4YM6C 1BH9A 4XUJC 1TZYD 5AV6A 5B33D 3MNNC 3C1BC 5CP6A 4YS3B 1HQ3A 3REKD 5AVBC 3MVDA 5BNVA 2FJ7A 5B32D 1P34B 3B6FA 2NZDB 3REHC 2CV5B 5BO0B 4WZSB 1WWSA 4NE5A 4JJND 3AV1A 4J8VD 5AVCB 3AZID 1BFMA 3AZFD 4Z66B 1P3IA 4R8PD 1P3FB 3REIB 3B6GD 3AZKA 3X1TA 4XZQC 5KDMA 5AV5B 1HQ3C 4H9OA 4YS3C 3VH5A 3MVDC 1P3BA 2HIOD 5B24D 3B6FC 4J8WD 3MGQB 5AY8B 3AYWD 1HTAA 3W97A 1P34C 2NZDC 3AFAA 5B2JD 1KX4A 5CPJB 3AZHB 1P3IC 5AVCC 3O62A 4Z66C 3UTAB 3AZKC 3X1TC 3TU4D 3UT9D 1P3FC 3REIC 4X23D 3KSYA 4H9NA 5AV8D 3LZ1A 1AOID 3W99D 5B1MB 3X1VB 5B31D 2F8NA 5GSUB 3W97C 4WU9D 4WV4B 4QLCB 1KX3B 3MGQC 1Q9CA 4CSRA 3W96A 1ZLAB 3WA9A 1P3GB 5CPJC 4UUZA 3AZHC 3LJAD 3O62C 4Z2MG 4ZUXA 3X1UD 4CAYA 3NQUB 3UTAC 2AROD 3AZJB 5CPKB 4KUDA 3X1VC 3REJD 3W96C 3W98B 4QLCC 5CPIA 4KGCD 1P3PD 1ZLAC 3NQJB 2F8NG 3LELA 1P3GC 4ZBJC 1TZYA 5B1LB 4Z5TA 5B33A 3MGRD 3REKB 5FUGB 5JRGC 3A6NB 3AFAD 1KX4D 5B32A 3AZMB 3AZJC 4KUDC 1P3AB 5DNMD 5CPKC 3R45A 3AZEB 4JJNA 5CPIC 4J8VA 3MGPB 3AZIA 3AZFA 3WKJB 3W98C 5JA4B 1M18B 3LELC 4R8PA 1TZYC 3B6GA 3VH6W 5B1LC 3KUYB 1U35D 5GT3B 4J8WB 3REKC 5GT0B 3C1CB 5B32C 4WNNB 2HIOA 5B24A 3A6NC 2YFVB 3WA9D 3AYWA 4YM6B 5B2JB 3MNNB 2HUEC 1P3AC 3LZ0B 4ZUXD 5AVBB 3B0CW 3AZFC 1KX5A 3AN2D 5B32G 3AZND 3REHB 3WKJC 5F99D 1P3LD 1P3MD 5BT1D 1M18C 3TU4A 3UT9A 1ID3A 4X23A 5AV8A 3AZGD 1AOIA 3W99A 2HIOC 3KUYC 5B31A 4J8WC 3AYWC 1BH9B 5B0ZD 4WU9A 5AV6B 3WTPE 4XZQB 5CP6B 5B2JC 1HQ3B 1P3KD 4Z5TD 5GXQA 3MVDB 5BNVB 3LZ0C 2FJ7B 4G92C 3B6FB 3LJAA 1S32D 1EQZD 4NE6A 3TU4C 3UT9C 3X1UA 3B0BA 4H9QA 3AV1B 2AROA 3X1SD 1P3IB 2PYOD 5B31C 1M1AD 3AZKB 3X1TB 3REJA 5KDMB 5AV6C 3RELD 4H9OB 5CP6C 1P3BB 4KGCA 1P3PA 5B31G 2FJ7C 3W97B 3WAAD 3X1UC 3MGRA 3AFAB 1KX4B 2BYKA 2YFWA 2AROC 3VH6T 4DRBA 4LD9D 5AV9A 3AV1C 4H9SA 1F66D 4EO5C 5CHLB 3O62B 1KX5D 3UTBD 5DNMA 4H9NB 3LZ1B 5DNND 1ID3D 4KGCC 1P3PC 4J8UD 2F8NB 3B0CT 3WTPD 4J8XA 1P3BC 3KXBD 3KWQD 1JFIA 4CSRB 3W96B 3V9RA 3MGSD 1H3OA 1U35A 3AFAC 3WA9B 1M19A 1P3OA 1KX4C 5E5AA 4UUZB 4XUJD 5GXQD 4ZBJB 3C1BD 4ZUXB 4CAYB 2IO5B 4AWLB 5JRGB 3AN2A 3LZ1C 3AZNA 5F99A 1P3LA 1P3MA 5B0YA 4KUDB 5B2IA 5BNXA 1A7WA 5BS7A 5B40D 3AZGA 1U35C 5CPIB 4WU8D 1F1EA 3AZLD 4H9RA 2NQBD 3LELB 3WA9C 5B0ZA 1TZYB 4Z5TB 5B33B 5G49A 4ZUXC 3AZKD 1P3KA 4YS3D 2IO5C 4AWLC 3AN2C 5B32B 3AZNC 1S32A 1P34D 5AV9D 5F99C 1N1JA 2CV5D 1P3MC 2NZDD 1EQZA 2HUEB 3R45B 1ULYA 4JJNB 3X1SA 4J8VB 3AZIB 3AZFB 2PYOA 2JSSA 1M1AA 5B0ZC 4R8PB 3B6GB 1P3FD 4J8XD 3REID 1BH8A 4Z5TC 5AV5D 4H9PA 5B33C 3RELA 2HIOB 5B24B 4KHAA 2CWEA 1P3OD 1M19D 3AYWB 5AY8D 5E5AD 1EQZC 3WAAA 1WWIA 3AZMA 4HGAB 3AZHD 1KX5B 4LD9A 4G92B 4JJNC 4DRAA 4J8VC 3AZIC 1M1AC 1F66A 3UTBA 3VH5W 3UTAD 3UT9B 3TU4B 1ID3B 4R8PC 4NE3A 5B0YD 3B6GC 4X23B 5AV8B 5B2ID 1AOIB 5DNNA 3RELC 3W99B 3AV2A 5B31B 4J8UA 5B1MD 3X1VD 3WTPA 2RVQD 4WU9B 5GSUD 3WAAC 5B24C 3KXBA 3KWQA 1KX3D 3MGSA 1TAFA 5GXQB 4LD9C 3LJAB 4XUJA 4HGAC 1KX5C 3C1BA 3UTBC 3X1UB 4H9QB 2AROB 5DNNC 1ID3C 4X23C 5AV8C 4J8UC 1AOIC 4EO5B 3W99C 3WTPC 4G91C 4M6BA 3KWQC 3REJB 4WU9C 3B0DB 3MGSC 5B40A 3W98D 2BYMA 4KGCB 4WU8A 3AZLA 1P3PB 5GXQC 2NQBA 4XZQA 3LJAC 3MGRB 5B1LD 2BYKB 2YFWB 4YS3A 5AV9B 3A6ND 3VH6A 3AZMD 1P34A 2NZDA 2CV5A 5C3IB 5BO0A 5DNMB 1P3AD 5B40C 3REJC 3AZED 3B0DC 3AZLC 4WU8C 5AVCA 3MGPD 3WKJD 4Z66A 4J8XB 2NQBC 1M18D 3AV2D 1JFIB 1P3FA 3REIA 3VH5T 3V9RB 1H3OB 5AV5A 3MGRC 1U35B 3KUYD 1M19B 1P3OB 5GT3D 1KU5A 5E5AB 5GT0D 3C1CD 2F8NK 4Z2MH 5AV9C 3MGQA 2CV5C 5AY8A 4YM6D 4H9SC 3MNND 5C3IC 5DNMC 3LZ0D 5CPJA 3AZHA 3AN2B 5AVBD 3AZNB 5F99B 1P3LB 3REHD 5B0YB 1P3MB 5B2IB 5BNXB 4J8XC 3UTAA 3AZGB 5AV5C 4H9RB 2F8NH 5B1MA 1P3OC 3X1VA 1M19C 5AY8C 5GSUA 5E5AC 5B0ZB 5AV6D 4QLCA 5G49B 1KX3A 4XZQD 1P3KB 5CP6D 1HQ3D 1ZLAA 3MVDD 2FJ7D 1P3GA 1S32B 3B6FD 1N1JB 1EQZB 1P3LC 4NFTA 5JRGA 5B0YC 5BT1C 3NQUA 5B2IC 3X1SB 3AV1D 5BS7C 3AZJA 2PYOB 3AZGC 1P3ID 5B1MC 1M1AB 2RVQC 5GSUC 5AVCD 4Z66D 5CPKA 3X1TD 1KX3C
chains in the Genus database with same CATH superfamily
3A1KA 1BH8B 4H9PB 3IP4C 3RELB 3W98A 1P3KC 1P3BD 4KHAB 3NQJA 3W97D 3WAAB 4E45A 1S32C 5B1LA 3MGQD 3REKA 5FUGA 4LD9B 1R4VA 3A6NA 3X1SC 1F66B 5CPJD 2PYOC 3O62D 3UTBB 1B6WA 1P3AA 2L5AA 5DNNB 3LZ1D 3AZEA 3AV2B 3MGPA 4J8UB 3WKJA 2F8ND 3WTPB 5JA4A 1M18A 4G91B 3KXBB 3KWQB 3MGSB 3W96D 4QLCD 1TAFB 3KUYA 5GT3A 4J8WA 5GT0A 3C1CA 1ZLAD 4WNNA 4XUJB 3AZMC 2YFVA 3C1BB 4YM6A 5B2JA 1P3GD 1F66C 3MNNA 3LZ0A 3AZEC 5JRGD 3MGPC 5AVBA 3AZJD 3AV2C 3REHA 4KUDD 1B67A 3KXBC 5B40B 2LY8A 5CPKD 2BYMB 5GT3C 4WU8B 3AZLB 4E44A 5CPID 5GT0C 3C1CC 2NQBB 3LELD 2DF4C 1BH9A 4YM6C 4XUJC 1TZYD 2Y2LA 5AV6A 5B33D 3MNNC 3C1BC 5CP6A 4YS3B 1HQ3A 3REKD 5AVBC 3MVDA 5BNVA 2FJ7A 5B32D 1P34B 3B6FA 2NZDB 3REHC 2CV5B 5BO0B 4WZSB 1WWSA 4NE5A 4JJND 3AV1A 4UPKA 4J8VD 5AVCB 3AZID 1BFMA 3AZFD 4Z66B 1P3IA 4R8PD 1P3FB 3REIB 3B6GD 3AZKA 3X1TA 3H0LC 4XZQC 5KDMA 5AV5B 1HQ3C 4H9OA 4YS3C 3VH5A 3MVDC 1P3BA 2HIOD 5B24D 3B6FC 4J8WD 3MGQB 5AY8B 3AYWD 1HTAA 3W97A 1P34C 2NZDC 3AFAA 5B2JD 1KX4A 5CPJB 3AZHB 1P3IC 2G5IC 5AVCC 3O62A 4Z66C 3UTAB 3AZKC 3X1TC 3TU4D 3UT9D 1P3FC 3REIC 4X23D 3KSYA 4H9NA 5AV8D 3LZ1A 1AOID 3W99D 5B1MB 3X1VB 5B31D 3F6TA 2F8NA 5GSUB 3W97C 4WU9D 4WV4B 4QLCB 1KX3B 3MGQC 1Q9CA 2Y2NA 4CSRA 3W96A 1ZLAB 3WA9A 1P3GB 5CPJC 4UUZA 3AZHC 3LJAD 3O62C 4Z2MG 1T3UA 4ZUXA 3X1UD 4CAYA 3NQUB 3UTAC 2AROD 3AZJB 2XD5A 5CPKB 4KUDA 3X1VC 3REJD 3W96C 3W98B 4QLCC 5CPIA 4KGCD 1P3PD 1ZLAC 2Y2HA 3NQJB 2F8NG 3LELA 1P3GC 4ZBJC 1TZYA 5B1LB 4Z5TA 5B33A 3MGRD 3REKB 5FUGB 5JRGC 3A6NB 3AFAD 1KX4D 1W2EA 5B32A 3AZMB 3AZJC 2Y2GA 4KUDC 1P3AB 3EG5B 5DNMD 5CPKC 3R45A 3AZEB 4JJNA 5CPIC 4J8VA 3A1IA 3MGPB 3AZIA 3AZFA 3WKJB 3W98C 5JA4B 1M18B 3LELC 4R8PA 1TZYC 3B6GA 1Z2CB 3VH6W 5B1LC 3KUYB 1U35D 5GT3B 4J8WB 3REKC 5GT0B 3C1CB 5B32C 4WNNB 2HIOA 5B24A 3A6NC 2YFVB 3WA9D 3KFUG 2W8SA 4YM6B 5B2JB 3AYWA 2UWXA 3MNNB 2HUEC 1P3AC 3LZ0B 4ZUXD 3EPJA 5AVBB 3B0CW 3AZFC 1KX5A 3AN2D 5B32G 3AZND 3REHB 3WKJC 5F99D 1P3LD 1P3MD 5BT1D 1M18C 3TU4A 3UT9A 1ID3A 4X23A 5AV8A 3AZGD 1AOIA 1PZRA 3W99A 2HIOC 3KUYC 5B31A 4J8WC 2ZM5A 3AYWC 1BH9B 5B0ZD 4WU9A 3P5JB 5AV6B 3WTPE 4XZQB 5CP6B 5B2JC 1HQ3B 1P3KD 4Z5TD 5GXQA 3MVDB 5BNVB 3LZ0C 2FJ7B 4G92C 3B6FB 3LJAA 1S32D 1EQZD 4NE6A 3TU4C 3UT9C 3X1UA 3B0BA 3AL0C 4H9QA 3AV1B 2AROA 3X1SD 3H0MC 1P3IB 2PYOD 5B31C 1M1AD 3AZKB 3X1TB 2Y2KA 3REJA 5KDMB 2XD1A 5AV6C 3RELD 4H9OB 5CP6C 2ZY5A 1P3BB 3EPLA 1P3PA 4KGCA 5B31G 2FJ7C 3W97B 3WAAD 3X1UC 3MGRA 3AFAB 1KX4B 2BYKA 2YFWA 2AROC 3VH6T 4DRBA 4LD9D 5AV9A 2ZY3A 3AV1C 4H9SA 1F66D 4EO5C 5CHLB 3O62B 1KX5D 3UTBD 5DNMA 4H9NB 2VQRA 3LZ1B 5DNND 1ID3D 4KGCC 1P3PC 4J8UD 2F8NB 3B0CT 3H0RC 3WTPD 4J8XA 1P3BC 2JE5A 3KXBD 3KWQD 1JFIA 4CSRB 3W96B 3V9RA 3MGSD 1H3OA 1U35A 3AFAC 3WA9B 1M19A 1P3OA 1KX4C 5E5AA 4UUZB 4XUJD 5GXQD 4DQYB 2Y2JA 4ZBJB 3C1BD 4ZUXB 4CAYB 2IO5B 4AWLB 5JRGB 3AN2A 3LZ1C 3AZNA 5F99A 1P3LA 1P3MA 5B0YA 4KUDB 5B2IA 5BNXA 1A7WA 5BS7A 3EPHA 5B40D 3AZGA 1U35C 5CPIB 4WU8D 1F1EA 3AZLD 4H9RA 2NQBD 3LELB 3WA9C 5B0ZA 1TZYB 4Z5TB 5B33B 2F2AC 5G49A 4ZUXC 3AZKD 1P3KA 4YS3D 2IO5C 4AWLC 3AN2C 5B32B 2Y2OA 3AZNC 1S32A 1P34D 5AV9D 5F99C 1N1JA 2CV5D 1P3MC 2NZDD 1EQZA 2HUEB 3R45B 1ULYA 4JJNB 3X1SA 4J8VB 3AZIB 3AZFB 2PYOA 2JSSA 1M1AA 5B0ZC 4R8PB 3B6GB 1P3FD 4J8XD 3REID 2J8PA 1BH8A 4Z5TC 5AV5D 4H9PA 5B33C 3RELA 2HIOB 2Y2QA 5B24B 4KHAA 2CWEA 1P3OD 1M19D 3AYWB 5AY8D 5E5AD 1EQZC 3WAAA 1WWIA 3AZMA 4HGAB 3AZHD 1KX5B 4LD9A 4G92B 4JJNC 4DRAA 4J8VC 3AZIC 1M1AC 1F66A 3UTBA 3VH5W 3UTAD 3UT9B 3TU4B 2Y2MA 4R8PC 4NE3A 5B0YD 1ID3B 4X23B 5AV8B 5B2ID 3B6GC 1AOIB 5DNNA 3RELC 2Y2PA 3W99B 3AV2A 5B31B 4J8UA 5B1MD 3X1VD 3WTPA 2RVQD 4WU9B 5GSUD 3WAAC 2FFFB 5B24C 3KXBA 2Y2IA 3KWQA 1KX3D 3MGSA 1TAFA 5GXQB 4LD9C 3LJAB 4XUJA 4HGAC 1KX5C 3C1BA 3UTBC 4WJ3C 3X1UB 4H9QB 2AROB 5DNNC 1ID3C 4X23C 5AV8C 4J8UC 1AOIC 4EO5B 3W99C 3WTPC 4G91C 4M6BA 3KWQC 3REJB 4WU9C 3B0DB 3MGSC 5B40A 3W98D 2BG1A 2BYMA 4KGCB 4WU8A 3AZLA 1P3PB 2G5HC 5GXQC 2NQBA 4XZQA 3LJAC 3MGRB 5B1LD 2BYKB 2YFWB 3FDDA 4YS3A 5AV9B 3A6ND 3VH6A 3AZMD 1P34A 2NZDA 2CV5A 5C3IB 5BO0A 5DNMB 1P3AD 5B40C 3REJC 3AZED 3B0DC 3AZLC 4WU8C 5AVCA 3MGPD 3WKJD 4Z66A 4J8XB 2NQBC 2JCHA 1M18D 3AV2D 1JFIB 1P3FA 3REIA 3VH5T 3V9RB 1H3OB 2ZY4A 5AV5A 3MGRC 1U35B 3KUYD 1M19B 1P3OB 5GT3D 1KU5A 2ZY2A 5E5AB 5GT0D 3C1CD 2F8NK 4Z2MH 5AV9C 3MGQA 2CV5C 5AY8A 4YM6D 4H9SC 3MNND 2RIQA 5C3IC 5DNMC 3LZ0D 5CPJA 3AZHA 3AN2B 5AVBD 3AZNB 5F99B 1P3LB 3REHD 5B0YB 1P3MB 3EPKA 5B2IB 5BNXB 4J8XC 3UTAA 3AZGB 5AV5C 4H9RB 2F8NH 5B1MA 1P3OC 3X1VA 1M19C 2DQNC 5AY8C 5GSUA 5E5AC 5B0ZB 5AV6D 4QLCA 5G49B 1KX3A 4XZQD 1P3KB 5CP6D 1HQ3D 1ZLAA 3MVDD 2FJ7D 1P3GA 1S32B 3B6FD 1N1JB 1EQZB 1P3LC 4NFTA 5B0YC 5JRGA 5BT1C 3NQUA 5B2IC 3X1SB 3AV1D 5BS7C 3AZJA 2PYOB 3AZGC 1P3ID 5B1MC 1M1AB 2RVQC 5GSUC 5AVCD 4Z66D 5CPKA 3X1TD 1KX3C
chains in the Genus database with same CATH topology
3A1KA 1BH8B 4H9PB 3IP4C 3RELB 3W98A 1P3KC 1P3BD 4KHAB 3NQJA 3W97D 3WAAB 4E45A 1S32C 5B1LA 3MGQD 3REKA 5FUGA 4LD9B 1R4VA 3A6NA 3X1SC 1F66B 5CPJD 2PYOC 3O62D 3UTBB 1B6WA 1P3AA 2L5AA 5DNNB 3LZ1D 3AZEA 3AV2B 3MGPA 4J8UB 3WKJA 2F8ND 3WTPB 5JA4A 1M18A 4G91B 3KXBB 3KWQB 3MGSB 3W96D 4QLCD 1TAFB 3KUYA 5GT3A 4J8WA 5GT0A 3C1CA 1ZLAD 4WNNA 4XUJB 3AZMC 2YFVA 3C1BB 4YM6A 5B2JA 1P3GD 1F66C 3MNNA 3LZ0A 3AZEC 5JRGD 3MGPC 5AVBA 3AZJD 3AV2C 3REHA 4KUDD 1B67A 3KXBC 5B40B 2LY8A 5CPKD 2BYMB 5GT3C 4WU8B 3AZLB 4E44A 5CPID 5GT0C 3C1CC 2NQBB 3LELD 2DF4C 1BH9A 4YM6C 4XUJC 1TZYD 2Y2LA 5AV6A 5B33D 3MNNC 3C1BC 5CP6A 4YS3B 1HQ3A 3REKD 5AVBC 3MVDA 5BNVA 2FJ7A 5B32D 1P34B 3B6FA 2NZDB 3REHC 2CV5B 5BO0B 4WZSB 1WWSA 4NE5A 4JJND 3AV1A 4UPKA 4J8VD 5AVCB 3AZID 1BFMA 3AZFD 4Z66B 1P3IA 4R8PD 1P3FB 3REIB 3B6GD 3AZKA 3X1TA 3H0LC 4XZQC 5KDMA 5AV5B 1HQ3C 4H9OA 4YS3C 3VH5A 3MVDC 1P3BA 2HIOD 5B24D 3B6FC 4J8WD 3MGQB 5AY8B 3AYWD 1HTAA 3W97A 1P34C 2NZDC 3AFAA 5B2JD 1KX4A 5CPJB 3AZHB 1P3IC 2G5IC 5AVCC 3O62A 4Z66C 3UTAB 3AZKC 3X1TC 3TU4D 3UT9D 1P3FC 3REIC 4X23D 3KSYA 4H9NA 5AV8D 3LZ1A 1AOID 3W99D 5B1MB 3X1VB 5B31D 3F6TA 2F8NA 5GSUB 3W97C 4WU9D 4WV4B 4QLCB 1KX3B 3MGQC 1Q9CA 2Y2NA 4CSRA 3W96A 1ZLAB 3WA9A 1P3GB 5CPJC 4UUZA 3AZHC 3LJAD 3O62C 4Z2MG 1T3UA 4ZUXA 3X1UD 4CAYA 3NQUB 3UTAC 2AROD 3AZJB 2XD5A 5CPKB 4KUDA 3X1VC 3REJD 3W96C 3W98B 4QLCC 5CPIA 4KGCD 1P3PD 1ZLAC 2Y2HA 3NQJB 2F8NG 3LELA 1P3GC 4ZBJC 1TZYA 5B1LB 4Z5TA 5B33A 3MGRD 3REKB 5FUGB 5JRGC 3A6NB 3AFAD 1KX4D 1W2EA 5B32A 3AZMB 3AZJC 2Y2GA 4KUDC 1P3AB 3EG5B 5DNMD 5CPKC 3R45A 3AZEB 4JJNA 5CPIC 4J8VA 3A1IA 3MGPB 3AZIA 3AZFA 3WKJB 3W98C 5JA4B 1M18B 3LELC 4R8PA 1TZYC 3B6GA 1Z2CB 3VH6W 5B1LC 3KUYB 1U35D 5GT3B 4J8WB 3REKC 5GT0B 3C1CB 5B32C 4WNNB 2HIOA 5B24A 3A6NC 2YFVB 3WA9D 3KFUG 2W8SA 4YM6B 5B2JB 3AYWA 2UWXA 3MNNB 2HUEC 1P3AC 3LZ0B 4ZUXD 3EPJA 5AVBB 3B0CW 3AZFC 1KX5A 3AN2D 5B32G 3AZND 3REHB 3WKJC 5F99D 1P3LD 1P3MD 5BT1D 1M18C 3TU4A 3UT9A 1ID3A 4X23A 5AV8A 3AZGD 1AOIA 1PZRA 3W99A 2HIOC 3KUYC 5B31A 4J8WC 2ZM5A 3AYWC 1BH9B 5B0ZD 4WU9A 3P5JB 5AV6B 3WTPE 4XZQB 5CP6B 5B2JC 1HQ3B 1P3KD 4Z5TD 5GXQA 3MVDB 5BNVB 3LZ0C 2FJ7B 4G92C 3B6FB 3LJAA 1S32D 1EQZD 4NE6A 3TU4C 3UT9C 3X1UA 3B0BA 3AL0C 4H9QA 3AV1B 2AROA 3X1SD 3H0MC 1P3IB 2PYOD 5B31C 1M1AD 3AZKB 3X1TB 2Y2KA 3REJA 5KDMB 2XD1A 5AV6C 3RELD 4H9OB 5CP6C 2ZY5A 1P3BB 3EPLA 1P3PA 4KGCA 5B31G 2FJ7C 3W97B 3WAAD 3X1UC 3MGRA 3AFAB 1KX4B 2BYKA 2YFWA 2AROC 3VH6T 4DRBA 4LD9D 5AV9A 2ZY3A 3AV1C 4H9SA 1F66D 4EO5C 5CHLB 3O62B 1KX5D 3UTBD 5DNMA 4H9NB 2VQRA 3LZ1B 5DNND 1ID3D 4KGCC 1P3PC 4J8UD 2F8NB 3B0CT 3H0RC 3WTPD 4J8XA 1P3BC 2JE5A 3KXBD 3KWQD 1JFIA 4CSRB 3W96B 3V9RA 3MGSD 1H3OA 1U35A 3AFAC 3WA9B 1M19A 1P3OA 1KX4C 5E5AA 4UUZB 4XUJD 5GXQD 4DQYB 2Y2JA 4ZBJB 3C1BD 4ZUXB 4CAYB 2IO5B 4AWLB 5JRGB 3AN2A 3LZ1C 3AZNA 5F99A 1P3LA 1P3MA 5B0YA 4KUDB 5B2IA 5BNXA 1A7WA 5BS7A 3EPHA 5B40D 3AZGA 1U35C 5CPIB 4WU8D 1F1EA 3AZLD 4H9RA 2NQBD 3LELB 3WA9C 5B0ZA 1TZYB 4Z5TB 5B33B 2F2AC 5G49A 4ZUXC 3AZKD 1P3KA 4YS3D 2IO5C 4AWLC 3AN2C 5B32B 2Y2OA 3AZNC 1S32A 1P34D 5AV9D 5F99C 1N1JA 2CV5D 1P3MC 2NZDD 1EQZA 2HUEB 3R45B 1ULYA 4JJNB 3X1SA 4J8VB 3AZIB 3AZFB 2PYOA 2JSSA 1M1AA 5B0ZC 4R8PB 3B6GB 1P3FD 4J8XD 3REID 2J8PA 1BH8A 4Z5TC 5AV5D 4H9PA 5B33C 3RELA 2HIOB 2Y2QA 5B24B 4KHAA 2CWEA 1P3OD 1M19D 3AYWB 5AY8D 5E5AD 1EQZC 3WAAA 1WWIA 3AZMA 4HGAB 3AZHD 1KX5B 4LD9A 4G92B 4JJNC 4DRAA 4J8VC 3AZIC 1M1AC 1F66A 3UTBA 3VH5W 3UTAD 3UT9B 3TU4B 2Y2MA 4R8PC 4NE3A 5B0YD 1ID3B 4X23B 5AV8B 5B2ID 3B6GC 1AOIB 5DNNA 3RELC 2Y2PA 3W99B 3AV2A 5B31B 4J8UA 5B1MD 3X1VD 3WTPA 2RVQD 4WU9B 5GSUD 3WAAC 2FFFB 5B24C 3KXBA 2Y2IA 3KWQA 1KX3D 3MGSA 1TAFA 5GXQB 4LD9C 3LJAB 4XUJA 4HGAC 1KX5C 3C1BA 3UTBC 4WJ3C 3X1UB 4H9QB 2AROB 5DNNC 1ID3C 4X23C 5AV8C 4J8UC 1AOIC 4EO5B 3W99C 3WTPC 4G91C 4M6BA 3KWQC 3REJB 4WU9C 3B0DB 3MGSC 5B40A 3W98D 2BG1A 2BYMA 4KGCB 4WU8A 3AZLA 1P3PB 2G5HC 5GXQC 2NQBA 4XZQA 3LJAC 3MGRB 5B1LD 2BYKB 2YFWB 3FDDA 4YS3A 5AV9B 3A6ND 3VH6A 3AZMD 1P34A 2NZDA 2CV5A 5C3IB 5BO0A 5DNMB 1P3AD 5B40C 3REJC 3AZED 3B0DC 3AZLC 4WU8C 5AVCA 3MGPD 3WKJD 4Z66A 4J8XB 2NQBC 2JCHA 1M18D 3AV2D 1JFIB 1P3FA 3REIA 3VH5T 3V9RB 1H3OB 2ZY4A 5AV5A 3MGRC 1U35B 3KUYD 1M19B 1P3OB 5GT3D 1KU5A 2ZY2A 5E5AB 5GT0D 3C1CD 2F8NK 4Z2MH 5AV9C 3MGQA 2CV5C 5AY8A 4YM6D 4H9SC 3MNND 2RIQA 5C3IC 5DNMC 3LZ0D 5CPJA 3AZHA 3AN2B 5AVBD 3AZNB 5F99B 1P3LB 3REHD 5B0YB 1P3MB 3EPKA 5B2IB 5BNXB 4J8XC 3UTAA 3AZGB 5AV5C 4H9RB 2F8NH 5B1MA 1P3OC 3X1VA 1M19C 2DQNC 5AY8C 5GSUA 5E5AC 5B0ZB 5AV6D 4QLCA 5G49B 1KX3A 4XZQD 1P3KB 5CP6D 1HQ3D 1ZLAA 3MVDD 2FJ7D 1P3GA 1S32B 3B6FD 1N1JB 1EQZB 1P3LC 4NFTA 5B0YC 5JRGA 5BT1C 3NQUA 5B2IC 3X1SB 3AV1D 5BS7C 3AZJA 2PYOB 3AZGC 1P3ID 5B1MC 1M1AB 2RVQC 5GSUC 5AVCD 4Z66D 5CPKA 3X1TD 1KX3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BH8 B;  4H9P B;  3REL B;  3W98 A;  1P3K C;  1P3B D;  4KHA B;  3NQJ A;  3W97 D;  3WAA B;  4E45 A;  1S32 C;  5B1L A;  3MGQ D;  3REK A;  5FUG A;  4LD9 B;  1R4V A;  3A6N A;  3X1S C;  1F66 B;  5CPJ D;  2PYO C;  3O62 D;  3UTB B;  1B6W A;  1P3A A;  2L5A A;  5DNN B;  3LZ1 D;  3AZE A;  3AV2 B;  3MGP A;  4J8U B;  3WKJ A;  2F8N D;  3WTP B;  5JA4 A;  1M18 A;  4G91 B;  3KXB B;  3KWQ B;  3MGS B;  3W96 D;  4QLC D;  1TAF B;  3KUY A;  5GT3 A;  4J8W A;  5GT0 A;  3C1C A;  1ZLA D;  4WNN A;  4XUJ B;  3AZM C;  2YFV A;  3C1B B;  4YM6 A;  5B2J A;  1P3G D;  1F66 C;  3MNN A;  3LZ0 A;  3AZE C;  5JRG D;  3MGP C;  5AVB A;  3AZJ D;  3AV2 C;  3REH A;  4KUD D;  1B67 A;  3KXB C;  5B40 B;  2LY8 A;  5CPK D;  2BYM B;  5GT3 C;  4WU8 B;  3AZL B;  4E44 A;  5CPI D;  5GT0 C;  3C1C C;  2NQB B;  3LEL D;  4YM6 C;  1BH9 A;  4XUJ C;  1TZY D;  5AV6 A;  5B33 D;  3MNN C;  3C1B C;  5CP6 A;  4YS3 B;  1HQ3 A;  3REK D;  5AVB C;  3MVD A;  5BNV A;  2FJ7 A;  5B32 D;  1P34 B;  3B6F A;  2NZD B;  3REH C;  2CV5 B;  5BO0 B;  4WZS B;  1WWS A;  4NE5 A;  4JJN D;  3AV1 A;  4J8V D;  5AVC B;  3AZI D;  1BFM A;  3AZF D;  4Z66 B;  1P3I A;  4R8P D;  1P3F B;  3REI B;  3B6G D;  3AZK A;  3X1T A;  4XZQ C;  5KDM A;  5AV5 B;  1HQ3 C;  4H9O A;  4YS3 C;  3VH5 A;  3MVD C;  1P3B A;  2HIO D;  5B24 D;  3B6F C;  4J8W D;  3MGQ B;  5AY8 B;  3AYW D;  1HTA A;  3W97 A;  1P34 C;  2NZD C;  3AFA A;  5B2J D;  1KX4 A;  5CPJ B;  3AZH B;  1P3I C;  5AVC C;  3O62 A;  4Z66 C;  3UTA B;  3AZK C;  3X1T C;  3TU4 D;  3UT9 D;  1P3F C;  3REI C;  4X23 D;  3KSY A;  4H9N A;  5AV8 D;  3LZ1 A;  1AOI D;  3W99 D;  5B1M B;  3X1V B;  5B31 D;  2F8N A;  5GSU B;  3W97 C;  4WU9 D;  4WV4 B;  4QLC B;  1KX3 B;  3MGQ C;  1Q9C A;  4CSR A;  3W96 A;  1ZLA B;  3WA9 A;  1P3G B;  5CPJ C;  4UUZ A;  3AZH C;  3LJA D;  3O62 C;  4Z2M G;  4ZUX A;  3X1U D;  4CAY A;  3NQU B;  3UTA C;  2ARO D;  3AZJ B;  5CPK B;  4KUD A;  3X1V C;  3REJ D;  3W96 C;  3W98 B;  4QLC C;  5CPI A;  4KGC D;  1P3P D;  1ZLA C;  3NQJ B;  2F8N G;  3LEL A;  1P3G C;  4ZBJ C;  1TZY A;  5B1L B;  4Z5T A;  5B33 A;  3MGR D;  3REK B;  5FUG B;  5JRG C;  3A6N B;  3AFA D;  1KX4 D;  5B32 A;  3AZM B;  3AZJ C;  4KUD C;  1P3A B;  5DNM D;  5CPK C;  3R45 A;  3AZE B;  4JJN A;  5CPI C;  4J8V A;  3MGP B;  3AZI A;  3AZF A;  3WKJ B;  3W98 C;  5JA4 B;  1M18 B;  3LEL C;  4R8P A;  1TZY C;  3B6G A;  3VH6 W;  5B1L C;  3KUY B;  1U35 D;  5GT3 B;  4J8W B;  3REK C;  5GT0 B;  3C1C B;  5B32 C;  4WNN B;  2HIO A;  5B24 A;  3A6N C;  2YFV B;  3WA9 D;  3AYW A;  4YM6 B;  5B2J B;  3MNN B;  2HUE C;  1P3A C;  3LZ0 B;  4ZUX D;  5AVB B;  3B0C W;  3AZF C;  1KX5 A;  3AN2 D;  5B32 G;  3AZN D;  3REH B;  3WKJ C;  5F99 D;  1P3L D;  1P3M D;  5BT1 D;  1M18 C;  3TU4 A;  3UT9 A;  1ID3 A;  4X23 A;  5AV8 A;  3AZG D;  1AOI A;  3W99 A;  2HIO C;  3KUY C;  5B31 A;  4J8W C;  3AYW C;  1BH9 B;  5B0Z D;  4WU9 A;  5AV6 B;  3WTP E;  4XZQ B;  5CP6 B;  5B2J C;  1HQ3 B;  1P3K D;  4Z5T D;  5GXQ A;  3MVD B;  5BNV B;  3LZ0 C;  2FJ7 B;  4G92 C;  3B6F B;  3LJA A;  1S32 D;  1EQZ D;  4NE6 A;  3TU4 C;  3UT9 C;  3X1U A;  3B0B A;  4H9Q A;  3AV1 B;  2ARO A;  3X1S D;  1P3I B;  2PYO D;  5B31 C;  1M1A D;  3AZK B;  3X1T B;  3REJ A;  5KDM B;  5AV6 C;  3REL D;  4H9O B;  5CP6 C;  1P3B B;  4KGC A;  1P3P A;  5B31 G;  2FJ7 C;  3W97 B;  3WAA D;  3X1U C;  3MGR A;  3AFA B;  1KX4 B;  2BYK A;  2YFW A;  2ARO C;  3VH6 T;  4DRB A;  4LD9 D;  5AV9 A;  3AV1 C;  4H9S A;  1F66 D;  4EO5 C;  5CHL B;  3O62 B;  1KX5 D;  3UTB D;  5DNM A;  4H9N B;  3LZ1 B;  5DNN D;  1ID3 D;  4KGC C;  1P3P C;  4J8U D;  2F8N B;  3B0C T;  3WTP D;  4J8X A;  1P3B C;  3KXB D;  3KWQ D;  1JFI A;  4CSR B;  3W96 B;  3V9R A;  3MGS D;  1H3O A;  1U35 A;  3AFA C;  3WA9 B;  1M19 A;  1P3O A;  1KX4 C;  5E5A A;  4UUZ B;  4XUJ D;  5GXQ D;  4ZBJ B;  3C1B D;  4ZUX B;  4CAY B;  2IO5 B;  4AWL B;  5JRG B;  3AN2 A;  3LZ1 C;  3AZN A;  5F99 A;  1P3L A;  1P3M A;  5B0Y A;  4KUD B;  5B2I A;  5BNX A;  1A7W A;  5BS7 A;  5B40 D;  3AZG A;  1U35 C;  5CPI B;  4WU8 D;  1F1E A;  3AZL D;  4H9R A;  2NQB D;  3LEL B;  3WA9 C;  5B0Z A;  1TZY B;  4Z5T B;  5B33 B;  5G49 A;  4ZUX C;  3AZK D;  1P3K A;  4YS3 D;  2IO5 C;  4AWL C;  3AN2 C;  5B32 B;  3AZN C;  1S32 A;  1P34 D;  5AV9 D;  5F99 C;  1N1J A;  2CV5 D;  1P3M C;  2NZD D;  1EQZ A;  2HUE B;  3R45 B;  1ULY A;  4JJN B;  3X1S A;  4J8V B;  3AZI B;  3AZF B;  2PYO A;  2JSS A;  1M1A A;  5B0Z C;  4R8P B;  3B6G B;  1P3F D;  4J8X D;  3REI D;  1BH8 A;  4Z5T C;  5AV5 D;  4H9P A;  5B33 C;  3REL A;  2HIO B;  5B24 B;  4KHA A;  2CWE A;  1P3O D;  1M19 D;  3AYW B;  5AY8 D;  5E5A D;  1EQZ C;  3WAA A;  1WWI A;  3AZM A;  4HGA B;  3AZH D;  1KX5 B;  4LD9 A;  4G92 B;  4JJN C;  4DRA A;  4J8V C;  3AZI C;  1M1A C;  1F66 A;  3UTB A;  3VH5 W;  3UTA D;  3UT9 B;  3TU4 B;  1ID3 B;  4R8P C;  4NE3 A;  5B0Y D;  3B6G C;  4X23 B;  5AV8 B;  5B2I D;  1AOI B;  5DNN A;  3REL C;  3W99 B;  3AV2 A;  5B31 B;  4J8U A;  5B1M D;  3X1V D;  3WTP A;  2RVQ D;  4WU9 B;  5GSU D;  3WAA C;  5B24 C;  3KXB A;  3KWQ A;  1KX3 D;  3MGS A;  1TAF A;  5GXQ B;  4LD9 C;  3LJA B;  4XUJ A;  4HGA C;  1KX5 C;  3C1B A;  3UTB C;  3X1U B;  4H9Q B;  2ARO B;  5DNN C;  1ID3 C;  4X23 C;  5AV8 C;  4J8U C;  1AOI C;  4EO5 B;  3W99 C;  3WTP C;  4G91 C;  4M6B A;  3KWQ C;  3REJ B;  4WU9 C;  3B0D B;  3MGS C;  5B40 A;  3W98 D;  2BYM A;  4KGC B;  4WU8 A;  3AZL A;  1P3P B;  5GXQ C;  2NQB A;  4XZQ A;  3LJA C;  3MGR B;  5B1L D;  2BYK B;  2YFW B;  4YS3 A;  5AV9 B;  3A6N D;  3VH6 A;  3AZM D;  1P34 A;  2NZD A;  2CV5 A;  5C3I B;  5BO0 A;  5DNM B;  1P3A D;  5B40 C;  3REJ C;  3AZE D;  3B0D C;  3AZL C;  4WU8 C;  5AVC A;  3MGP D;  3WKJ D;  4Z66 A;  4J8X B;  2NQB C;  1M18 D;  3AV2 D;  1JFI B;  1P3F A;  3REI A;  3VH5 T;  3V9R B;  1H3O B;  5AV5 A;  3MGR C;  1U35 B;  3KUY D;  1M19 B;  1P3O B;  5GT3 D;  1KU5 A;  5E5A B;  5GT0 D;  3C1C D;  2F8N K;  4Z2M H;  5AV9 C;  3MGQ A;  2CV5 C;  5AY8 A;  4YM6 D;  4H9S C;  3MNN D;  5C3I C;  5DNM C;  3LZ0 D;  5CPJ A;  3AZH A;  3AN2 B;  5AVB D;  3AZN B;  5F99 B;  1P3L B;  3REH D;  5B0Y B;  1P3M B;  5B2I B;  5BNX B;  4J8X C;  3UTA A;  3AZG B;  5AV5 C;  4H9R B;  2F8N H;  5B1M A;  1P3O C;  3X1V A;  1M19 C;  5AY8 C;  5GSU A;  5E5A C;  5B0Z B;  5AV6 D;  4QLC A;  5G49 B;  1KX3 A;  4XZQ D;  1P3K B;  5CP6 D;  1HQ3 D;  1ZLA A;  3MVD D;  2FJ7 D;  1P3G A;  1S32 B;  3B6F D;  1N1J B;  1EQZ B;  1P3L C;  4NFT A;  5JRG A;  5B0Y C;  5BT1 C;  3NQU A;  5B2I C;  3X1S B;  3AV1 D;  5BS7 C;  3AZJ A;  2PYO B;  3AZG C;  1P3I D;  5B1M C;  1M1A B;  2RVQ C;  5GSU C;  5AVC D;  4Z66 D;  5CPK A;  3X1T D;  1KX3 C; 
#chains in the Genus database with same CATH topology
 3A1K A;  1BH8 B;  4H9P B;  3IP4 C;  3REL B;  3W98 A;  1P3K C;  1P3B D;  4KHA B;  3NQJ A;  3W97 D;  3WAA B;  4E45 A;  1S32 C;  5B1L A;  3MGQ D;  3REK A;  5FUG A;  4LD9 B;  1R4V A;  3A6N A;  3X1S C;  1F66 B;  5CPJ D;  2PYO C;  3O62 D;  3UTB B;  1B6W A;  1P3A A;  2L5A A;  5DNN B;  3LZ1 D;  3AZE A;  3AV2 B;  3MGP A;  4J8U B;  3WKJ A;  2F8N D;  3WTP B;  5JA4 A;  1M18 A;  4G91 B;  3KXB B;  3KWQ B;  3MGS B;  3W96 D;  4QLC D;  1TAF B;  3KUY A;  5GT3 A;  4J8W A;  5GT0 A;  3C1C A;  1ZLA D;  4WNN A;  4XUJ B;  3AZM C;  2YFV A;  3C1B B;  4YM6 A;  5B2J A;  1P3G D;  1F66 C;  3MNN A;  3LZ0 A;  3AZE C;  5JRG D;  3MGP C;  5AVB A;  3AZJ D;  3AV2 C;  3REH A;  4KUD D;  1B67 A;  3KXB C;  5B40 B;  2LY8 A;  5CPK D;  2BYM B;  5GT3 C;  4WU8 B;  3AZL B;  4E44 A;  5CPI D;  5GT0 C;  3C1C C;  2NQB B;  3LEL D;  2DF4 C;  1BH9 A;  4YM6 C;  4XUJ C;  1TZY D;  2Y2L A;  5AV6 A;  5B33 D;  3MNN C;  3C1B C;  5CP6 A;  4YS3 B;  1HQ3 A;  3REK D;  5AVB C;  3MVD A;  5BNV A;  2FJ7 A;  5B32 D;  1P34 B;  3B6F A;  2NZD B;  3REH C;  2CV5 B;  5BO0 B;  4WZS B;  1WWS A;  4NE5 A;  4JJN D;  3AV1 A;  4UPK A;  4J8V D;  5AVC B;  3AZI D;  1BFM A;  3AZF D;  4Z66 B;  1P3I A;  4R8P D;  1P3F B;  3REI B;  3B6G D;  3AZK A;  3X1T A;  3H0L C;  4XZQ C;  5KDM A;  5AV5 B;  1HQ3 C;  4H9O A;  4YS3 C;  3VH5 A;  3MVD C;  1P3B A;  2HIO D;  5B24 D;  3B6F C;  4J8W D;  3MGQ B;  5AY8 B;  3AYW D;  1HTA A;  3W97 A;  1P34 C;  2NZD C;  3AFA A;  5B2J D;  1KX4 A;  5CPJ B;  3AZH B;  1P3I C;  2G5I C;  5AVC C;  3O62 A;  4Z66 C;  3UTA B;  3AZK C;  3X1T C;  3TU4 D;  3UT9 D;  1P3F C;  3REI C;  4X23 D;  3KSY A;  4H9N A;  5AV8 D;  3LZ1 A;  1AOI D;  3W99 D;  5B1M B;  3X1V B;  5B31 D;  3F6T A;  2F8N A;  5GSU B;  3W97 C;  4WU9 D;  4WV4 B;  4QLC B;  1KX3 B;  3MGQ C;  1Q9C A;  2Y2N A;  4CSR A;  3W96 A;  1ZLA B;  3WA9 A;  1P3G B;  5CPJ C;  4UUZ A;  3AZH C;  3LJA D;  3O62 C;  4Z2M G;  1T3U A;  4ZUX A;  3X1U D;  4CAY A;  3NQU B;  3UTA C;  2ARO D;  3AZJ B;  2XD5 A;  5CPK B;  4KUD A;  3X1V C;  3REJ D;  3W96 C;  3W98 B;  4QLC C;  5CPI A;  4KGC D;  1P3P D;  1ZLA C;  2Y2H A;  3NQJ B;  2F8N G;  3LEL A;  1P3G C;  4ZBJ C;  1TZY A;  5B1L B;  4Z5T A;  5B33 A;  3MGR D;  3REK B;  5FUG B;  5JRG C;  3A6N B;  3AFA D;  1KX4 D;  1W2E A;  5B32 A;  3AZM B;  3AZJ C;  2Y2G A;  4KUD C;  1P3A B;  3EG5 B;  5DNM D;  5CPK C;  3R45 A;  3AZE B;  4JJN A;  5CPI C;  4J8V A;  3A1I A;  3MGP B;  3AZI A;  3AZF A;  3WKJ B;  3W98 C;  5JA4 B;  1M18 B;  3LEL C;  4R8P A;  1TZY C;  3B6G A;  1Z2C B;  3VH6 W;  5B1L C;  3KUY B;  1U35 D;  5GT3 B;  4J8W B;  3REK C;  5GT0 B;  3C1C B;  5B32 C;  4WNN B;  2HIO A;  5B24 A;  3A6N C;  2YFV B;  3WA9 D;  3KFU G;  2W8S A;  4YM6 B;  5B2J B;  3AYW A;  2UWX A;  3MNN B;  2HUE C;  1P3A C;  3LZ0 B;  4ZUX D;  3EPJ A;  5AVB B;  3B0C W;  3AZF C;  1KX5 A;  3AN2 D;  5B32 G;  3AZN D;  3REH B;  3WKJ C;  5F99 D;  1P3L D;  1P3M D;  5BT1 D;  1M18 C;  3TU4 A;  3UT9 A;  1ID3 A;  4X23 A;  5AV8 A;  3AZG D;  1AOI A;  1PZR A;  3W99 A;  2HIO C;  3KUY C;  5B31 A;  4J8W C;  2ZM5 A;  3AYW C;  1BH9 B;  5B0Z D;  4WU9 A;  3P5J B;  5AV6 B;  3WTP E;  4XZQ B;  5CP6 B;  5B2J C;  1HQ3 B;  1P3K D;  4Z5T D;  5GXQ A;  3MVD B;  5BNV B;  3LZ0 C;  2FJ7 B;  4G92 C;  3B6F B;  3LJA A;  1S32 D;  1EQZ D;  4NE6 A;  3TU4 C;  3UT9 C;  3X1U A;  3B0B A;  3AL0 C;  4H9Q A;  3AV1 B;  2ARO A;  3X1S D;  3H0M C;  1P3I B;  2PYO D;  5B31 C;  1M1A D;  3AZK B;  3X1T B;  2Y2K A;  3REJ A;  5KDM B;  2XD1 A;  5AV6 C;  3REL D;  4H9O B;  5CP6 C;  2ZY5 A;  1P3B B;  3EPL A;  1P3P A;  4KGC A;  5B31 G;  2FJ7 C;  3W97 B;  3WAA D;  3X1U C;  3MGR A;  3AFA B;  1KX4 B;  2BYK A;  2YFW A;  2ARO C;  3VH6 T;  4DRB A;  4LD9 D;  5AV9 A;  2ZY3 A;  3AV1 C;  4H9S A;  1F66 D;  4EO5 C;  5CHL B;  3O62 B;  1KX5 D;  3UTB D;  5DNM A;  4H9N B;  2VQR A;  3LZ1 B;  5DNN D;  1ID3 D;  4KGC C;  1P3P C;  4J8U D;  2F8N B;  3B0C T;  3H0R C;  3WTP D;  4J8X A;  1P3B C;  2JE5 A;  3KXB D;  3KWQ D;  1JFI A;  4CSR B;  3W96 B;  3V9R A;  3MGS D;  1H3O A;  1U35 A;  3AFA C;  3WA9 B;  1M19 A;  1P3O A;  1KX4 C;  5E5A A;  4UUZ B;  4XUJ D;  5GXQ D;  4DQY B;  2Y2J A;  4ZBJ B;  3C1B D;  4ZUX B;  4CAY B;  2IO5 B;  4AWL B;  5JRG B;  3AN2 A;  3LZ1 C;  3AZN A;  5F99 A;  1P3L A;  1P3M A;  5B0Y A;  4KUD B;  5B2I A;  5BNX A;  1A7W A;  5BS7 A;  3EPH A;  5B40 D;  3AZG A;  1U35 C;  5CPI B;  4WU8 D;  1F1E A;  3AZL D;  4H9R A;  2NQB D;  3LEL B;  3WA9 C;  5B0Z A;  1TZY B;  4Z5T B;  5B33 B;  2F2A C;  5G49 A;  4ZUX C;  3AZK D;  1P3K A;  4YS3 D;  2IO5 C;  4AWL C;  3AN2 C;  5B32 B;  2Y2O A;  3AZN C;  1S32 A;  1P34 D;  5AV9 D;  5F99 C;  1N1J A;  2CV5 D;  1P3M C;  2NZD D;  1EQZ A;  2HUE B;  3R45 B;  1ULY A;  4JJN B;  3X1S A;  4J8V B;  3AZI B;  3AZF B;  2PYO A;  2JSS A;  1M1A A;  5B0Z C;  4R8P B;  3B6G B;  1P3F D;  4J8X D;  3REI D;  2J8P A;  1BH8 A;  4Z5T C;  5AV5 D;  4H9P A;  5B33 C;  3REL A;  2HIO B;  2Y2Q A;  5B24 B;  4KHA A;  2CWE A;  1P3O D;  1M19 D;  3AYW B;  5AY8 D;  5E5A D;  1EQZ C;  3WAA A;  1WWI A;  3AZM A;  4HGA B;  3AZH D;  1KX5 B;  4LD9 A;  4G92 B;  4JJN C;  4DRA A;  4J8V C;  3AZI C;  1M1A C;  1F66 A;  3UTB A;  3VH5 W;  3UTA D;  3UT9 B;  3TU4 B;  2Y2M A;  4R8P C;  4NE3 A;  5B0Y D;  1ID3 B;  4X23 B;  5AV8 B;  5B2I D;  3B6G C;  1AOI B;  5DNN A;  3REL C;  2Y2P A;  3W99 B;  3AV2 A;  5B31 B;  4J8U A;  5B1M D;  3X1V D;  3WTP A;  2RVQ D;  4WU9 B;  5GSU D;  3WAA C;  2FFF B;  5B24 C;  3KXB A;  2Y2I A;  3KWQ A;  1KX3 D;  3MGS A;  1TAF A;  5GXQ B;  4LD9 C;  3LJA B;  4XUJ A;  4HGA C;  1KX5 C;  3C1B A;  3UTB C;  4WJ3 C;  3X1U B;  4H9Q B;  2ARO B;  5DNN C;  1ID3 C;  4X23 C;  5AV8 C;  4J8U C;  1AOI C;  4EO5 B;  3W99 C;  3WTP C;  4G91 C;  4M6B A;  3KWQ C;  3REJ B;  4WU9 C;  3B0D B;  3MGS C;  5B40 A;  3W98 D;  2BG1 A;  2BYM A;  4KGC B;  4WU8 A;  3AZL A;  1P3P B;  2G5H C;  5GXQ C;  2NQB A;  4XZQ A;  3LJA C;  3MGR B;  5B1L D;  2BYK B;  2YFW B;  3FDD A;  4YS3 A;  5AV9 B;  3A6N D;  3VH6 A;  3AZM D;  1P34 A;  2NZD A;  2CV5 A;  5C3I B;  5BO0 A;  5DNM B;  1P3A D;  5B40 C;  3REJ C;  3AZE D;  3B0D C;  3AZL C;  4WU8 C;  5AVC A;  3MGP D;  3WKJ D;  4Z66 A;  4J8X B;  2NQB C;  2JCH A;  1M18 D;  3AV2 D;  1JFI B;  1P3F A;  3REI A;  3VH5 T;  3V9R B;  1H3O B;  2ZY4 A;  5AV5 A;  3MGR C;  1U35 B;  3KUY D;  1M19 B;  1P3O B;  5GT3 D;  1KU5 A;  2ZY2 A;  5E5A B;  5GT0 D;  3C1C D;  2F8N K;  4Z2M H;  5AV9 C;  3MGQ A;  2CV5 C;  5AY8 A;  4YM6 D;  4H9S C;  3MNN D;  2RIQ A;  5C3I C;  5DNM C;  3LZ0 D;  5CPJ A;  3AZH A;  3AN2 B;  5AVB D;  3AZN B;  5F99 B;  1P3L B;  3REH D;  5B0Y B;  1P3M B;  3EPK A;  5B2I B;  5BNX B;  4J8X C;  3UTA A;  3AZG B;  5AV5 C;  4H9R B;  2F8N H;  5B1M A;  1P3O C;  3X1V A;  1M19 C;  2DQN C;  5AY8 C;  5GSU A;  5E5A C;  5B0Z B;  5AV6 D;  4QLC A;  5G49 B;  1KX3 A;  4XZQ D;  1P3K B;  5CP6 D;  1HQ3 D;  1ZLA A;  3MVD D;  2FJ7 D;  1P3G A;  1S32 B;  3B6F D;  1N1J B;  1EQZ B;  1P3L C;  4NFT A;  5B0Y C;  5JRG A;  5BT1 C;  3NQU A;  5B2I C;  3X1S B;  3AV1 D;  5BS7 C;  3AZJ A;  2PYO B;  3AZG C;  1P3I D;  5B1M C;  1M1A B;  2RVQ C;  5GSU C;  5AVC D;  4Z66 D;  5CPK A;  3X1T D;  1KX3 C; 
#chains in the Genus database with same CATH homology
 3A1K A;  1BH8 B;  4H9P B;  3IP4 C;  3REL B;  3W98 A;  1P3K C;  1P3B D;  4KHA B;  3NQJ A;  3W97 D;  3WAA B;  4E45 A;  1S32 C;  5B1L A;  3MGQ D;  3REK A;  5FUG A;  4LD9 B;  1R4V A;  3A6N A;  3X1S C;  1F66 B;  5CPJ D;  2PYO C;  3O62 D;  3UTB B;  1B6W A;  1P3A A;  2L5A A;  5DNN B;  3LZ1 D;  3AZE A;  3AV2 B;  3MGP A;  4J8U B;  3WKJ A;  2F8N D;  3WTP B;  5JA4 A;  1M18 A;  4G91 B;  3KXB B;  3KWQ B;  3MGS B;  3W96 D;  4QLC D;  1TAF B;  3KUY A;  5GT3 A;  4J8W A;  5GT0 A;  3C1C A;  1ZLA D;  4WNN A;  4XUJ B;  3AZM C;  2YFV A;  3C1B B;  4YM6 A;  5B2J A;  1P3G D;  1F66 C;  3MNN A;  3LZ0 A;  3AZE C;  5JRG D;  3MGP C;  5AVB A;  3AZJ D;  3AV2 C;  3REH A;  4KUD D;  1B67 A;  3KXB C;  5B40 B;  2LY8 A;  5CPK D;  2BYM B;  5GT3 C;  4WU8 B;  3AZL B;  4E44 A;  5CPI D;  5GT0 C;  3C1C C;  2NQB B;  3LEL D;  2DF4 C;  1BH9 A;  4YM6 C;  4XUJ C;  1TZY D;  2Y2L A;  5AV6 A;  5B33 D;  3MNN C;  3C1B C;  5CP6 A;  4YS3 B;  1HQ3 A;  3REK D;  5AVB C;  3MVD A;  5BNV A;  2FJ7 A;  5B32 D;  1P34 B;  3B6F A;  2NZD B;  3REH C;  2CV5 B;  5BO0 B;  4WZS B;  1WWS A;  4NE5 A;  4JJN D;  3AV1 A;  4UPK A;  4J8V D;  5AVC B;  3AZI D;  1BFM A;  3AZF D;  4Z66 B;  1P3I A;  4R8P D;  1P3F B;  3REI B;  3B6G D;  3AZK A;  3X1T A;  3H0L C;  4XZQ C;  5KDM A;  5AV5 B;  1HQ3 C;  4H9O A;  4YS3 C;  3VH5 A;  3MVD C;  1P3B A;  2HIO D;  5B24 D;  3B6F C;  4J8W D;  3MGQ B;  5AY8 B;  3AYW D;  1HTA A;  3W97 A;  1P34 C;  2NZD C;  3AFA A;  5B2J D;  1KX4 A;  5CPJ B;  3AZH B;  1P3I C;  2G5I C;  5AVC C;  3O62 A;  4Z66 C;  3UTA B;  3AZK C;  3X1T C;  3TU4 D;  3UT9 D;  1P3F C;  3REI C;  4X23 D;  3KSY A;  4H9N A;  5AV8 D;  3LZ1 A;  1AOI D;  3W99 D;  5B1M B;  3X1V B;  5B31 D;  3F6T A;  2F8N A;  5GSU B;  3W97 C;  4WU9 D;  4WV4 B;  4QLC B;  1KX3 B;  3MGQ C;  1Q9C A;  2Y2N A;  4CSR A;  3W96 A;  1ZLA B;  3WA9 A;  1P3G B;  5CPJ C;  4UUZ A;  3AZH C;  3LJA D;  3O62 C;  4Z2M G;  1T3U A;  4ZUX A;  3X1U D;  4CAY A;  3NQU B;  3UTA C;  2ARO D;  3AZJ B;  2XD5 A;  5CPK B;  4KUD A;  3X1V C;  3REJ D;  3W96 C;  3W98 B;  4QLC C;  5CPI A;  4KGC D;  1P3P D;  1ZLA C;  2Y2H A;  3NQJ B;  2F8N G;  3LEL A;  1P3G C;  4ZBJ C;  1TZY A;  5B1L B;  4Z5T A;  5B33 A;  3MGR D;  3REK B;  5FUG B;  5JRG C;  3A6N B;  3AFA D;  1KX4 D;  1W2E A;  5B32 A;  3AZM B;  3AZJ C;  2Y2G A;  4KUD C;  1P3A B;  3EG5 B;  5DNM D;  5CPK C;  3R45 A;  3AZE B;  4JJN A;  5CPI C;  4J8V A;  3A1I A;  3MGP B;  3AZI A;  3AZF A;  3WKJ B;  3W98 C;  5JA4 B;  1M18 B;  3LEL C;  4R8P A;  1TZY C;  3B6G A;  1Z2C B;  3VH6 W;  5B1L C;  3KUY B;  1U35 D;  5GT3 B;  4J8W B;  3REK C;  5GT0 B;  3C1C B;  5B32 C;  4WNN B;  2HIO A;  5B24 A;  3A6N C;  2YFV B;  3WA9 D;  3KFU G;  2W8S A;  4YM6 B;  5B2J B;  3AYW A;  2UWX A;  3MNN B;  2HUE C;  1P3A C;  3LZ0 B;  4ZUX D;  3EPJ A;  5AVB B;  3B0C W;  3AZF C;  1KX5 A;  3AN2 D;  5B32 G;  3AZN D;  3REH B;  3WKJ C;  5F99 D;  1P3L D;  1P3M D;  5BT1 D;  1M18 C;  3TU4 A;  3UT9 A;  1ID3 A;  4X23 A;  5AV8 A;  3AZG D;  1AOI A;  1PZR A;  3W99 A;  2HIO C;  3KUY C;  5B31 A;  4J8W C;  2ZM5 A;  3AYW C;  1BH9 B;  5B0Z D;  4WU9 A;  3P5J B;  5AV6 B;  3WTP E;  4XZQ B;  5CP6 B;  5B2J C;  1HQ3 B;  1P3K D;  4Z5T D;  5GXQ A;  3MVD B;  5BNV B;  3LZ0 C;  2FJ7 B;  4G92 C;  3B6F B;  3LJA A;  1S32 D;  1EQZ D;  4NE6 A;  3TU4 C;  3UT9 C;  3X1U A;  3B0B A;  3AL0 C;  4H9Q A;  3AV1 B;  2ARO A;  3X1S D;  3H0M C;  1P3I B;  2PYO D;  5B31 C;  1M1A D;  3AZK B;  3X1T B;  2Y2K A;  3REJ A;  5KDM B;  2XD1 A;  5AV6 C;  3REL D;  4H9O B;  5CP6 C;  2ZY5 A;  1P3B B;  3EPL A;  1P3P A;  4KGC A;  5B31 G;  2FJ7 C;  3W97 B;  3WAA D;  3X1U C;  3MGR A;  3AFA B;  1KX4 B;  2BYK A;  2YFW A;  2ARO C;  3VH6 T;  4DRB A;  4LD9 D;  5AV9 A;  2ZY3 A;  3AV1 C;  4H9S A;  1F66 D;  4EO5 C;  5CHL B;  3O62 B;  1KX5 D;  3UTB D;  5DNM A;  4H9N B;  2VQR A;  3LZ1 B;  5DNN D;  1ID3 D;  4KGC C;  1P3P C;  4J8U D;  2F8N B;  3B0C T;  3H0R C;  3WTP D;  4J8X A;  1P3B C;  2JE5 A;  3KXB D;  3KWQ D;  1JFI A;  4CSR B;  3W96 B;  3V9R A;  3MGS D;  1H3O A;  1U35 A;  3AFA C;  3WA9 B;  1M19 A;  1P3O A;  1KX4 C;  5E5A A;  4UUZ B;  4XUJ D;  5GXQ D;  4DQY B;  2Y2J A;  4ZBJ B;  3C1B D;  4ZUX B;  4CAY B;  2IO5 B;  4AWL B;  5JRG B;  3AN2 A;  3LZ1 C;  3AZN A;  5F99 A;  1P3L A;  1P3M A;  5B0Y A;  4KUD B;  5B2I A;  5BNX A;  1A7W A;  5BS7 A;  3EPH A;  5B40 D;  3AZG A;  1U35 C;  5CPI B;  4WU8 D;  1F1E A;  3AZL D;  4H9R A;  2NQB D;  3LEL B;  3WA9 C;  5B0Z A;  1TZY B;  4Z5T B;  5B33 B;  2F2A C;  5G49 A;  4ZUX C;  3AZK D;  1P3K A;  4YS3 D;  2IO5 C;  4AWL C;  3AN2 C;  5B32 B;  2Y2O A;  3AZN C;  1S32 A;  1P34 D;  5AV9 D;  5F99 C;  1N1J A;  2CV5 D;  1P3M C;  2NZD D;  1EQZ A;  2HUE B;  3R45 B;  1ULY A;  4JJN B;  3X1S A;  4J8V B;  3AZI B;  3AZF B;  2PYO A;  2JSS A;  1M1A A;  5B0Z C;  4R8P B;  3B6G B;  1P3F D;  4J8X D;  3REI D;  2J8P A;  1BH8 A;  4Z5T C;  5AV5 D;  4H9P A;  5B33 C;  3REL A;  2HIO B;  2Y2Q A;  5B24 B;  4KHA A;  2CWE A;  1P3O D;  1M19 D;  3AYW B;  5AY8 D;  5E5A D;  1EQZ C;  3WAA A;  1WWI A;  3AZM A;  4HGA B;  3AZH D;  1KX5 B;  4LD9 A;  4G92 B;  4JJN C;  4DRA A;  4J8V C;  3AZI C;  1M1A C;  1F66 A;  3UTB A;  3VH5 W;  3UTA D;  3UT9 B;  3TU4 B;  2Y2M A;  4R8P C;  4NE3 A;  5B0Y D;  1ID3 B;  4X23 B;  5AV8 B;  5B2I D;  3B6G C;  1AOI B;  5DNN A;  3REL C;  2Y2P A;  3W99 B;  3AV2 A;  5B31 B;  4J8U A;  5B1M D;  3X1V D;  3WTP A;  2RVQ D;  4WU9 B;  5GSU D;  3WAA C;  2FFF B;  5B24 C;  3KXB A;  2Y2I A;  3KWQ A;  1KX3 D;  3MGS A;  1TAF A;  5GXQ B;  4LD9 C;  3LJA B;  4XUJ A;  4HGA C;  1KX5 C;  3C1B A;  3UTB C;  4WJ3 C;  3X1U B;  4H9Q B;  2ARO B;  5DNN C;  1ID3 C;  4X23 C;  5AV8 C;  4J8U C;  1AOI C;  4EO5 B;  3W99 C;  3WTP C;  4G91 C;  4M6B A;  3KWQ C;  3REJ B;  4WU9 C;  3B0D B;  3MGS C;  5B40 A;  3W98 D;  2BG1 A;  2BYM A;  4KGC B;  4WU8 A;  3AZL A;  1P3P B;  2G5H C;  5GXQ C;  2NQB A;  4XZQ A;  3LJA C;  3MGR B;  5B1L D;  2BYK B;  2YFW B;  3FDD A;  4YS3 A;  5AV9 B;  3A6N D;  3VH6 A;  3AZM D;  1P34 A;  2NZD A;  2CV5 A;  5C3I B;  5BO0 A;  5DNM B;  1P3A D;  5B40 C;  3REJ C;  3AZE D;  3B0D C;  3AZL C;  4WU8 C;  5AVC A;  3MGP D;  3WKJ D;  4Z66 A;  4J8X B;  2NQB C;  2JCH A;  1M18 D;  3AV2 D;  1JFI B;  1P3F A;  3REI A;  3VH5 T;  3V9R B;  1H3O B;  2ZY4 A;  5AV5 A;  3MGR C;  1U35 B;  3KUY D;  1M19 B;  1P3O B;  5GT3 D;  1KU5 A;  2ZY2 A;  5E5A B;  5GT0 D;  3C1C D;  2F8N K;  4Z2M H;  5AV9 C;  3MGQ A;  2CV5 C;  5AY8 A;  4YM6 D;  4H9S C;  3MNN D;  2RIQ A;  5C3I C;  5DNM C;  3LZ0 D;  5CPJ A;  3AZH A;  3AN2 B;  5AVB D;  3AZN B;  5F99 B;  1P3L B;  3REH D;  5B0Y B;  1P3M B;  3EPK A;  5B2I B;  5BNX B;  4J8X C;  3UTA A;  3AZG B;  5AV5 C;  4H9R B;  2F8N H;  5B1M A;  1P3O C;  3X1V A;  1M19 C;  2DQN C;  5AY8 C;  5GSU A;  5E5A C;  5B0Z B;  5AV6 D;  4QLC A;  5G49 B;  1KX3 A;  4XZQ D;  1P3K B;  5CP6 D;  1HQ3 D;  1ZLA A;  3MVD D;  2FJ7 D;  1P3G A;  1S32 B;  3B6F D;  1N1J B;  1EQZ B;  1P3L C;  4NFT A;  5B0Y C;  5JRG A;  5BT1 C;  3NQU A;  5B2I C;  3X1S B;  3AV1 D;  5BS7 C;  3AZJ A;  2PYO B;  3AZG C;  1P3I D;  5B1M C;  1M1A B;  2RVQ C;  5GSU C;  5AVC D;  4Z66 D;  5CPK A;  3X1T D;  1KX3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...