3AZKD

Crystal structure of human nucleosome core particle containing h4k59q mutation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
95
structure length
95
Chain Sequence
KRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azkD00
3KXBC 5AVCA 2NQBB 4JJND 5AV5A 1WWSA 4Z5TC 5B24B 5JRGB 3AZJB 3KWQB 4E44A 4ZUXB 1HQ3C 3LELA 3AZLD 3REJD 4XZQB 1KX4A 2LY8A 4NE3A 5F99D 5CPIB 2JSSA 5CPKD 1TZYB 4J8VA 3LZ1B 1S32B 1AOID 3O62B 5B2JB 3B6FC 5B0YC 3W97C 3A6NA 5AVBC 4J8WA 3V9RA 1JFIB 2L5AA 2F8NB 5DNND 3KXBA 1F66A 5GT3D 5B0ZD 2RVQC 4Z5TA 3AZHC 4HGAC 2HIOB 4H9PA 5BS7C 3UTAC 4KGCB 4J8XD 3UTBC 3X1SD 3MGSD 1WWIA 4CAYB 5AY8D 3AZKB 3REKB 2HUEC 5GSUA 3MGQD 5B31B 4QLCC 1P3GC 3W97A 3WTPE 2NZDA 2YFWA 5B1MA 1R4VA 5AV6B 5AVCD 5CPJA 5AV5D 3R45A 3REHC 4X23D 5AV9D 5KDMA 3AZHA 3WTPD 1EQZD 4YM6C 3AZMD 3W99C 3UTBA 3LJAC 5BNVB 3WKJC 4UUZB 3W98D 3KUYD 1ID3B 3C1CA 3REIC 3MGPA 2CV5C 4QLCA 3UT9C 1U35A 1P3GA 3TU4B 4H9SC 4J8WD 4CSRB 1P3KC 4Z66A 1H3OA 3KXBD 4H9QA 4AWLC 3X1VB 5BT1C 5DNMC 2AROB 4Z5TD 3AV1B 1HQ3D 4XUJC 3AZFA 2F8NH 3AN2B 4YM6A 5GT0B 1P34B 3LJAA 3AFAB 1P3PB 3W96B 1BH8A 3MGRB 3REIA 3NQJB 3AZNB 2CV5A 3B6FD 5B0YD 3W97D 1P3IB 4H9SA 1P3MC 5AVBD 1KX5C 1P3KA 5B1LA 5GXQA 3AYWB 5B40A 2RVQD 3AZHD 4KUDB 3AV2C 3WA9B 3UTAD 5CP6C 4WU9C 5E5AB 3C1BC 3UTBD 4H9OA 5FUGB 4Z2MH 3B0BA 1P3FC 3MNNB 1ZLAC 4WU8B 3AZIC 4G92B 5B32G 4QLCD 1P3GD 1P3MA 2NQBC 5AV8B 4YS3B 3REHD 4ZUXC 2IO5C 5CP6A 3LELC 4YM6D 3W99D 3C1BA 4XZQC 3LJAD 3WKJD 3AZLB 1TAFB 3AZEB 2PYOA 1KX4C 5BNXA 1P3AB 2FJ7B 1S32C 1BH9B 3REJB 3REID 2BYMB 4J8VC 3AZGA 4R8PB 5F99B 2CV5D 3B6GA 3UT9D 3B0DC 5CPKB 3A6NC 2NQBA 1P3KD 5B24A 5JRGA 5BT1D 5DNMD 3KWQA 3AZJA 1AOIB 1F66C 4ZUXA 2HIOC 4KGCC 4WNNB 3NQUB 5DNNB 4XUJD 3VH6A 1P3BB 5GT3B 5B0ZB 4XZQA 2YFVB 5CPIA 1N1JB 4ZBJB 4J8XB 1TZYA 3X1SB 3MGSB 3LZ1A 1S32A 1P3LB 3O62A 5GSUC 5B2JA 1JFIA 4M6BA 5AV6C 2F8NA 1P3MD 1KX5D 2NZDC 3MGQB 5B1MC 5CPJC 2HIOA 4KGCA 3AV2D 4E45A 5CP6D 4WU9D 4CAYA 4X23B 5AV9B 3C1BD 3AZKA 3WTPB 3REKA 1P3FD 1EQZB 3AZMB 1ZLAD 3AZID 1M19B 5B31A 3W98B 2F8NG 3C1CC 3MGPC 3KUYB 5AV6A 1U35C 3X1VC 2NQBD 3VH6W 2AROC 4Z66C 3AV1C 4ZUXD 5JA4B 4WZSB 3AN2C 3LELD 5BNVA 3AZFC 4XZQD 4UUZA 1HQ3B 1KX4D 1ID3A 1S32D 3AZNC 5BO0B 4J8VD 1P3IC 3TU4A 3MVDB 4CSRA 2F8ND 5C3IB 3AYWC 3A6ND 3X1VA 1B6WA 3WAAB 2AROA 4Z2MG 4LD9B 5B1LC 5GXQC 3AV1A 1F66D 5B0YB 3B6FB 2HIOD 3WA9C 4KGCD 5B40C 5AVBB 4H9NB 5E5AC 3AN2A 1P34A 5GT0A 5B33B 3AFAA 4G91B 3W96A 3X1UB 4HGAB 3MNNC 4WU8C 3UTAB 1M1AB 3MGRA 3NQJA 3AZNA 5GSUD 4EO5C 1P3IA 2HUEB 5AV6D 4KHAB 3AYWA 2NZDD 5B1MD 5B2IB 5CPJD 4KUDA 3WA9A 5E5AA 1KX3C 4J8UB 3REHB 5FUGA 3AZEC 3MNNA 4WU8A 1P3AC 2FJ7C 3X1TB 1P3OB 3W99B 3RELB 2PYOC 3WKJB 4R8PC 3C1CD 1KU5A 3AZGC 3MGPD 1M18B 3B6GC 5AV8A 1U35D 3X1VD 4H9RB 2AROD 4Z66D 5B32B 3AV1D 5B24C 5JRGC 3UT9B 2BYKB 3KWQC 3AZJC 1P3BC 3LZ0B 3AN2D 4NE5A 1KX3A 4AWLB 1A7WA 4NFTA 5DNMB 3AZFD 4JJNB 3AZLA 3VH6T 4ZBJC 1TAFA 3AZEA 4XUJB 1P3AA 2FJ7A 5CPIC 2CWEA 1BH9A 5CHLB 3REJA 1P3LC 1B67A 1TZYC 2BYMA 3LZ1C 3AZND 4R8PA 5F99A 2F8NK 3O62C 1P3ID 5B2JC 5CPKA 3AYWD 5G49B 1AOIA 5B1LD 5GXQD 4WNNA 3NQUA 3WA9D 5DNNA 5B40D 1P3BA 1KX5B 5E5AD 5GT3A 5B0ZA 2YFVA 4WV4B 3AZKC 1N1JA 3MNND 3AV2B 4WU8D 4J8XA 3X1SA 3REKC 3MGSA 4WU9B 1M19C 1P3LA 5B31C 5AY8B 1P3FB 1ZLAB 3AZIB 3MGQA 1KX3D 4X23A 5AV9A 5AVCB 3WTPA 5AV5B 3AZED 1EQZA 2IO5B 3AZMA 1P3AD 2FJ7D 3LELB 1M19A 2PYOD 1ID3C 3W98A 4R8PD 3MVDC 3KUYA 5C3IC 1KX4B 3AZGD 3TU4C 3B6GD 3WAAC 4LD9C 3B0CW 4J8VB 3VH5W 4DRBA 5B24D 5JA4A 3B0DB 5JRGD 3KWQD 3AZJD 1P3BD 3A6NB 5B33C 4G91C 4J8WB 3V9RB 1P34C 3X1UC 5GT0C 3KXBB 1F66B 3AFAC 1P3PC 1HQ3A 3W96C 4Z5TB 1M1AC 5CPID 4H9PB 1F1EA 1P3LD 5B31G 5BO0A 1TZYD 3LZ1D 3MGRC 3MVDA 3O62D 5B2JD 5B2IC 3WAAA 4LD9A 5GSUB 3B6FA 5B0YA 4DRAA 5AVBA 4H9NA 1Q9CA 4J8UC 3W97B 4KUDC 5B33A 2NZDB 2YFWB 5B1MB 3X1UA 5CPJB 3R45B 3UTAA 5BS7A 3X1TC 3AZKD 1P3PA 5KDMB 1P3OC 1M1AA 3AZHB 3RELC 3REKD 1M19D 4NE6A 4G92C 3UTBB 5B31D 1M18C 4KHAA 3KSYA 5B2IA 5B32C 5AV8C 4YS3C 3C1CB 3LZ0C 3MGPB 4QLCB 1U35B 1P3GB 4J8UA 3REHA 4JJNC 4Z66B 1H3OB 4H9QB 3X1TA 3AZLC 1P3OA 3W99A 3RELA 3WKJA 3AZFB 4YM6B 1ID3D 3REJC 3LJAB 3MVDD 1M18A 5F99C 1BFMA 3TU4D 4H9RA 5CPKC 3WAAD 4LD9D 5B32A 3UT9A 1AOIC 2BYKA 4YS3A 1BH8B 3REIB 3LZ0A 2CV5B 5B33D 5DNNC 5DNMA 4JJNA 5B1LB 5GT3C 5GXQB 5B0ZC 3X1UD 5GT0D 1P34D 1P3KB 3AFAD 3B0CT 1P3PD 1HTAA 4XUJA 5B40B 3W96D 1M1AD 3VH5T 4J8XC 3X1SC 3MGSC 5AY8C 4H9OB 3MGRD 5G49A 5B2ID 3MGQC 4EO5B 1KX5A 4J8UD 4KUDD 5AVCC 1P3MB 1ULYA 5AV5C 4X23C 5AV9C 3AV2A 3VH5A 3X1TD 3WTPC 4WU9A 1P3OD 1KX3B 1EQZC 3RELD 3AZMC 5CP6B 5AY8A 3C1BB 1P3FA 1ZLAA 3W98C 1M18D 3AZIA 3KUYC 2PYOB 5BNXB 5B32D 5AV8D 4YS3D 3LZ0D 3AZGB 3B6GB 4J8WC
chains in the Genus database with same CATH superfamily
3KXBC 5AVCA 2NQBB 4JJND 5AV5A 1WWSA 4Z5TC 5B24B 5JRGB 3AZJB 3KWQB 4E44A 4ZUXB 1HQ3C 3LELA 3AZLD 2VQRA 3REJD 4XZQB 1KX4A 2LY8A 4NE3A 5F99D 5CPIB 2JSSA 2Y2MA 5CPKD 1TZYB 4J8VA 3LZ1B 1S32B 1AOID 3O62B 5B2JB 3B6FC 5B0YC 3W97C 3A6NA 5AVBC 4J8WA 3V9RA 1JFIB 2L5AA 2Y2HA 2F8NB 5DNND 3KXBA 1F66A 3EPKA 5GT3D 5B0ZD 2RVQC 4Z5TA 3AZHC 4HGAC 2HIOB 4H9PA 5BS7C 3UTAC 4KGCB 4J8XD 3UTBC 3X1SD 3MGSD 1WWIA 3H0MC 4CAYB 5AY8D 3AZKB 3REKB 2HUEC 5GSUA 3MGQD 5B31B 2BG1A 4QLCC 1P3GC 3W97A 3WTPE 2NZDA 2YFWA 5B1MA 1R4VA 5AV6B 5AVCD 5CPJA 5AV5D 3R45A 3REHC 3H0RC 5AV9D 4X23D 5KDMA 3AZHA 3WTPD 2XD1A 2JE5A 1EQZD 4YM6C 3AZMD 3W99C 3UTBA 3LJAC 5BNVB 3WKJC 2ZY5A 4UUZB 3W98D 3KUYD 2RIQA 1ID3B 3C1CA 3REIC 3MGPA 2CV5C 4QLCA 3UT9C 1U35A 1P3GA 3TU4B 4H9SC 4J8WD 4CSRB 1P3KC 4Z66A 1H3OA 3KXBD 4H9QA 4AWLC 3X1VB 5BT1C 2Y2GA 5DNMC 2AROB 4Z5TD 3AV1B 1HQ3D 4XUJC 3AZFA 2F8NH 3P5JB 4YM6A 5GT0B 3AN2B 1P34B 3LJAA 3AFAB 1P3PB 3W96B 2Y2LA 2Y2QA 1T3UA 1BH8A 1W2EA 3MGRB 3NQJB 3REIA 3AZNB 2CV5A 3B6FD 5B0YD 3W97D 1P3IB 4H9SA 1P3MC 5AVBD 1KX5C 1P3KA 5B1LA 5GXQA 3EPLA 3AYWB 5B40A 2RVQD 3AZHD 4KUDB 3AV2C 3WA9B 3UTAD 5CP6C 4WU9C 5E5AB 2FFFB 2J8PA 3C1BC 3UTBD 4H9OA 5FUGB 4Z2MH 3B0BA 1P3FC 3MNNB 1ZLAC 4WU8B 3AZIC 4G92B 5B32G 3F6TA 4QLCD 1P3GD 1P3MA 2NQBC 5AV8B 4YS3B 3REHD 4ZUXC 2IO5C 5CP6A 3LELC 4YM6D 3W99D 3C1BA 4XZQC 3LJAD 3WKJD 3AZLB 1TAFB 3AZEB 2PYOA 1KX4C 5BNXA 1P3AB 2FJ7B 1S32C 1BH9B 3REJB 3REID 2BYMB 4J8VC 3AZGA 4R8PB 5F99B 2CV5D 3B6GA 3UT9D 3B0DC 3H0LC 5CPKB 3A6NC 2NQBA 1P3KD 5B24A 5JRGA 5BT1D 5DNMD 3KWQA 3AZJA 1AOIB 1F66C 4ZUXA 2HIOC 4KGCC 4WNNB 3NQUB 5DNNB 4XUJD 3VH6A 1P3BB 4UPKA 5GT3B 5B0ZB 4XZQA 2YFVB 5CPIA 1N1JB 4ZBJB 4J8XB 1TZYA 3X1SB 3MGSB 3LZ1A 1S32A 1P3LB 3O62A 5GSUC 5B2JA 1JFIA 4M6BA 5AV6C 2F8NA 1P3MD 1KX5D 2NZDC 3MGQB 5B1MC 5CPJC 2HIOA 4KGCA 2ZY2A 3AV2D 2Y2KA 4E45A 5CP6D 4WU9D 2Y2NA 4CAYA 4X23B 5AV9B 3C1BD 3AZKA 3WTPB 3REKA 1P3FD 1EQZB 3AZMB 1ZLAD 3AZID 1M19B 5B31A 3W98B 2F8NG 3C1CC 3MGPC 3KUYB 5AV6A 2G5IC 1U35C 3X1VC 2NQBD 3VH6W 2AROC 4Z66C 3A1KA 3AV1C 4ZUXD 5JA4B 4WZSB 3AN2C 2G5HC 3LELD 5BNVA 3AZFC 4XZQD 4UUZA 1HQ3B 2W8SA 1KX4D 1ID3A 1S32D 3AZNC 5BO0B 4J8VD 1P3IC 3TU4A 3MVDB 4CSRA 2F8ND 5C3IB 3AYWC 3EPHA 3A6ND 4DQYB 1B6WA 3X1VA 3WAAB 2AROA 4Z2MG 4LD9B 5B1LC 5GXQC 3AV1A 1F66D 5B0YB 3B6FB 2HIOD 3WA9C 4KGCD 5B40C 5AVBB 4H9NB 5E5AC 3AN2A 1P34A 5GT0A 2JCHA 5B33B 3AFAA 4G91B 3W96A 3X1UB 4HGAB 3MNNC 4WU8C 3UTAB 1M1AB 3MGRA 3NQJA 3AZNA 5GSUD 4EO5C 1P3IA 2HUEB 4WJ3C 5AV6D 4KHAB 3AYWA 2NZDD 5B1MD 5B2IB 5CPJD 4KUDA 3WA9A 5E5AA 1KX3C 4J8UB 2Y2JA 3REHB 5FUGA 3AZEC 3MNNA 4WU8A 1P3AC 2FJ7C 3X1TB 1P3OB 3W99B 3RELB 2PYOC 3WKJB 4R8PC 3C1CD 1KU5A 3AZGC 3MGPD 1M18B 3B6GC 5AV8A 1U35D 3X1VD 4H9RB 2AROD 4Z66D 2Y2PA 5B32B 3AV1D 5B24C 5JRGC 3UT9B 2BYKB 3KWQC 3AZJC 1P3BC 3LZ0B 3AN2D 2ZY4A 4NE5A 1KX3A 4AWLB 1A7WA 4NFTA 5DNMB 3AZFD 4JJNB 3AZLA 3VH6T 4ZBJC 1TAFA 3AZEA 4XUJB 1P3AA 2FJ7A 5CPIC 3KFUG 2CWEA 2DF4C 1BH9A 3EG5B 5CHLB 3REJA 1P3LC 1B67A 1TZYC 2BYMA 3LZ1C 3AZND 2ZY3A 5F99A 4R8PA 2F8NK 3O62C 1P3ID 5B2JC 5CPKA 3AYWD 5G49B 1AOIA 5B1LD 5GXQD 4WNNA 3NQUA 3WA9D 5DNNA 5B40D 1P3BA 1KX5B 5E5AD 5GT3A 5B0ZA 2YFVA 3A1IA 4WV4B 3AZKC 1N1JA 3MNND 3AV2B 4WU8D 4J8XA 3X1SA 3REKC 3MGSA 4WU9B 1M19C 1Z2CB 1P3LA 5B31C 5AY8B 1P3FB 1ZLAB 3AZIB 3MGQA 1KX3D 4X23A 5AV9A 2XD5A 5AVCB 3WTPA 5AV5B 3AZED 1EQZA 2IO5B 3AZMA 1P3AD 2FJ7D 3LELB 1M19A 2PYOD 1ID3C 3W98A 4R8PD 3MVDC 3KUYA 2ZM5A 5C3IC 1KX4B 3AZGD 1PZRA 3TU4C 3B6GD 3WAAC 4LD9C 3B0CW 4J8VB 3VH5W 4DRBA 5JA4A 5JRGD 3B0DB 5B24D 3KWQD 3AZJD 1P3BD 3A6NB 5B33C 4G91C 4J8WB 3V9RB 1P34C 5GT0C 3X1UC 3KXBB 1F66B 3AFAC 1P3PC 1HQ3A 3W96C 4Z5TB 1M1AC 5CPID 4H9PB 1F1EA 1P3LD 5B31G 5BO0A 1TZYD 3LZ1D 3MGRC 3MVDA 3O62D 5B2JD 5B2IC 3WAAA 4LD9A 5GSUB 3B6FA 5B0YA 4DRAA 5AVBA 4H9NA 1Q9CA 4J8UC 3W97B 4KUDC 5B33A 2NZDB 2YFWB 5B1MB 3X1UA 5CPJB 3R45B 3UTAA 5BS7A 3X1TC 3AZKD 1P3PA 5KDMB 1P3OC 1M1AA 3AZHB 3RELC 3REKD 1M19D 2Y2OA 4NE6A 4G92C 3UTBB 5B31D 1M18C 4KHAA 2DQNC 3KSYA 5B2IA 5B32C 5AV8C 4YS3C 3C1CB 3LZ0C 3MGPB 4QLCB 1U35B 1P3GB 4J8UA 3REHA 4JJNC 4Z66B 1H3OB 4H9QB 3X1TA 3AZLC 1P3OA 3W99A 3RELA 3WKJA 3AZFB 4YM6B 1ID3D 3REJC 3LJAB 3MVDD 2Y2IA 1M18A 5F99C 3AL0C 1BFMA 3TU4D 4H9RA 5CPKC 3EPJA 3WAAD 4LD9D 5B32A 3UT9A 1AOIC 2BYKA 4YS3A 1BH8B 3REIB 3LZ0A 2CV5B 5B33D 5DNNC 5DNMA 4JJNA 5B1LB 5GT3C 5GXQB 5B0ZC 3X1UD 5GT0D 1P34D 1P3KB 3AFAD 3B0CT 1P3PD 1HTAA 4XUJA 5B40B 3W96D 1M1AD 3VH5T 4J8XC 3X1SC 3MGSC 5AY8C 2UWXA 4H9OB 3MGRD 5G49A 5B2ID 3MGQC 4EO5B 1KX5A 4J8UD 4KUDD 5AVCC 1P3MB 1ULYA 5AV5C 4X23C 5AV9C 3AV2A 3VH5A 3X1TD 3WTPC 4WU9A 1P3OD 1KX3B 1EQZC 3RELD 3AZMC 5CP6B 3IP4C 5AY8A 3C1BB 1P3FA 1ZLAA 3W98C 1M18D 3AZIA 3KUYC 2F2AC 2PYOB 5BNXB 3FDDA 5B32D 5AV8D 4YS3D 3LZ0D 3AZGB 3B6GB 4J8WC
chains in the Genus database with same CATH topology
3KXBC 5AVCA 2NQBB 4JJND 5AV5A 1WWSA 4Z5TC 5B24B 5JRGB 3AZJB 3KWQB 4E44A 4ZUXB 1HQ3C 3LELA 3AZLD 2VQRA 3REJD 4XZQB 1KX4A 2LY8A 4NE3A 5F99D 5CPIB 2JSSA 2Y2MA 5CPKD 1TZYB 4J8VA 3LZ1B 1S32B 1AOID 3O62B 5B2JB 3B6FC 5B0YC 3W97C 3A6NA 5AVBC 4J8WA 3V9RA 1JFIB 2L5AA 2Y2HA 2F8NB 5DNND 3KXBA 1F66A 3EPKA 5GT3D 5B0ZD 2RVQC 4Z5TA 3AZHC 4HGAC 2HIOB 4H9PA 5BS7C 3UTAC 4KGCB 4J8XD 3UTBC 3X1SD 3MGSD 1WWIA 3H0MC 4CAYB 5AY8D 3AZKB 3REKB 2HUEC 5GSUA 3MGQD 5B31B 2BG1A 4QLCC 1P3GC 3W97A 3WTPE 2NZDA 2YFWA 5B1MA 1R4VA 5AV6B 5AVCD 5CPJA 5AV5D 3R45A 3REHC 3H0RC 5AV9D 4X23D 5KDMA 3AZHA 3WTPD 2XD1A 2JE5A 1EQZD 4YM6C 3AZMD 3W99C 3UTBA 3LJAC 5BNVB 3WKJC 2ZY5A 4UUZB 3W98D 3KUYD 2RIQA 1ID3B 3C1CA 3REIC 3MGPA 2CV5C 4QLCA 3UT9C 1U35A 1P3GA 3TU4B 4H9SC 4J8WD 4CSRB 1P3KC 4Z66A 1H3OA 3KXBD 4H9QA 4AWLC 3X1VB 5BT1C 2Y2GA 5DNMC 2AROB 4Z5TD 3AV1B 1HQ3D 4XUJC 3AZFA 2F8NH 3P5JB 4YM6A 5GT0B 3AN2B 1P34B 3LJAA 3AFAB 1P3PB 3W96B 2Y2LA 2Y2QA 1T3UA 1BH8A 1W2EA 3MGRB 3NQJB 3REIA 3AZNB 2CV5A 3B6FD 5B0YD 3W97D 1P3IB 4H9SA 1P3MC 5AVBD 1KX5C 1P3KA 5B1LA 5GXQA 3EPLA 3AYWB 5B40A 2RVQD 3AZHD 4KUDB 3AV2C 3WA9B 3UTAD 5CP6C 4WU9C 5E5AB 2FFFB 2J8PA 3C1BC 3UTBD 4H9OA 5FUGB 4Z2MH 3B0BA 1P3FC 3MNNB 1ZLAC 4WU8B 3AZIC 4G92B 5B32G 3F6TA 4QLCD 1P3GD 1P3MA 2NQBC 5AV8B 4YS3B 3REHD 4ZUXC 2IO5C 5CP6A 3LELC 4YM6D 3W99D 3C1BA 4XZQC 3LJAD 3WKJD 3AZLB 1TAFB 3AZEB 2PYOA 1KX4C 5BNXA 1P3AB 2FJ7B 1S32C 1BH9B 3REJB 3REID 2BYMB 4J8VC 3AZGA 4R8PB 5F99B 2CV5D 3B6GA 3UT9D 3B0DC 3H0LC 5CPKB 3A6NC 2NQBA 1P3KD 5B24A 5JRGA 5BT1D 5DNMD 3KWQA 3AZJA 1AOIB 1F66C 4ZUXA 2HIOC 4KGCC 4WNNB 3NQUB 5DNNB 4XUJD 3VH6A 1P3BB 4UPKA 5GT3B 5B0ZB 4XZQA 2YFVB 5CPIA 1N1JB 4ZBJB 4J8XB 1TZYA 3X1SB 3MGSB 3LZ1A 1S32A 1P3LB 3O62A 5GSUC 5B2JA 1JFIA 4M6BA 5AV6C 2F8NA 1P3MD 1KX5D 2NZDC 3MGQB 5B1MC 5CPJC 2HIOA 4KGCA 2ZY2A 3AV2D 2Y2KA 4E45A 5CP6D 4WU9D 2Y2NA 4CAYA 4X23B 5AV9B 3C1BD 3AZKA 3WTPB 3REKA 1P3FD 1EQZB 3AZMB 1ZLAD 3AZID 1M19B 5B31A 3W98B 2F8NG 3C1CC 3MGPC 3KUYB 5AV6A 2G5IC 1U35C 3X1VC 2NQBD 3VH6W 2AROC 4Z66C 3A1KA 3AV1C 4ZUXD 5JA4B 4WZSB 3AN2C 2G5HC 3LELD 5BNVA 3AZFC 4XZQD 4UUZA 1HQ3B 2W8SA 1KX4D 1ID3A 1S32D 3AZNC 5BO0B 4J8VD 1P3IC 3TU4A 3MVDB 4CSRA 2F8ND 5C3IB 3AYWC 3EPHA 3A6ND 4DQYB 1B6WA 3X1VA 3WAAB 2AROA 4Z2MG 4LD9B 5B1LC 5GXQC 3AV1A 1F66D 5B0YB 3B6FB 2HIOD 3WA9C 4KGCD 5B40C 5AVBB 4H9NB 5E5AC 3AN2A 1P34A 5GT0A 2JCHA 5B33B 3AFAA 4G91B 3W96A 3X1UB 4HGAB 3MNNC 4WU8C 3UTAB 1M1AB 3MGRA 3NQJA 3AZNA 5GSUD 4EO5C 1P3IA 2HUEB 4WJ3C 5AV6D 4KHAB 3AYWA 2NZDD 5B1MD 5B2IB 5CPJD 4KUDA 3WA9A 5E5AA 1KX3C 4J8UB 2Y2JA 3REHB 5FUGA 3AZEC 3MNNA 4WU8A 1P3AC 2FJ7C 3X1TB 1P3OB 3W99B 3RELB 2PYOC 3WKJB 4R8PC 3C1CD 1KU5A 3AZGC 3MGPD 1M18B 3B6GC 5AV8A 1U35D 3X1VD 4H9RB 2AROD 4Z66D 2Y2PA 5B32B 3AV1D 5B24C 5JRGC 3UT9B 2BYKB 3KWQC 3AZJC 1P3BC 3LZ0B 3AN2D 2ZY4A 4NE5A 1KX3A 4AWLB 1A7WA 4NFTA 5DNMB 3AZFD 4JJNB 3AZLA 3VH6T 4ZBJC 1TAFA 3AZEA 4XUJB 1P3AA 2FJ7A 5CPIC 3KFUG 2CWEA 2DF4C 1BH9A 3EG5B 5CHLB 3REJA 1P3LC 1B67A 1TZYC 2BYMA 3LZ1C 3AZND 2ZY3A 5F99A 4R8PA 2F8NK 3O62C 1P3ID 5B2JC 5CPKA 3AYWD 5G49B 1AOIA 5B1LD 5GXQD 4WNNA 3NQUA 3WA9D 5DNNA 5B40D 1P3BA 1KX5B 5E5AD 5GT3A 5B0ZA 2YFVA 3A1IA 4WV4B 3AZKC 1N1JA 3MNND 3AV2B 4WU8D 4J8XA 3X1SA 3REKC 3MGSA 4WU9B 1M19C 1Z2CB 1P3LA 5B31C 5AY8B 1P3FB 1ZLAB 3AZIB 3MGQA 1KX3D 4X23A 5AV9A 2XD5A 5AVCB 3WTPA 5AV5B 3AZED 1EQZA 2IO5B 3AZMA 1P3AD 2FJ7D 3LELB 1M19A 2PYOD 1ID3C 3W98A 4R8PD 3MVDC 3KUYA 2ZM5A 5C3IC 1KX4B 3AZGD 1PZRA 3TU4C 3B6GD 3WAAC 4LD9C 3B0CW 4J8VB 3VH5W 4DRBA 5JA4A 5JRGD 3B0DB 5B24D 3KWQD 3AZJD 1P3BD 3A6NB 5B33C 4G91C 4J8WB 3V9RB 1P34C 5GT0C 3X1UC 3KXBB 1F66B 3AFAC 1P3PC 1HQ3A 3W96C 4Z5TB 1M1AC 5CPID 4H9PB 1F1EA 1P3LD 5B31G 5BO0A 1TZYD 3LZ1D 3MGRC 3MVDA 3O62D 5B2JD 5B2IC 3WAAA 4LD9A 5GSUB 3B6FA 5B0YA 4DRAA 5AVBA 4H9NA 1Q9CA 4J8UC 3W97B 4KUDC 5B33A 2NZDB 2YFWB 5B1MB 3X1UA 5CPJB 3R45B 3UTAA 5BS7A 3X1TC 3AZKD 1P3PA 5KDMB 1P3OC 1M1AA 3AZHB 3RELC 3REKD 1M19D 2Y2OA 4NE6A 4G92C 3UTBB 5B31D 1M18C 4KHAA 2DQNC 3KSYA 5B2IA 5B32C 5AV8C 4YS3C 3C1CB 3LZ0C 3MGPB 4QLCB 1U35B 1P3GB 4J8UA 3REHA 4JJNC 4Z66B 1H3OB 4H9QB 3X1TA 3AZLC 1P3OA 3W99A 3RELA 3WKJA 3AZFB 4YM6B 1ID3D 3REJC 3LJAB 3MVDD 2Y2IA 1M18A 5F99C 3AL0C 1BFMA 3TU4D 4H9RA 5CPKC 3EPJA 3WAAD 4LD9D 5B32A 3UT9A 1AOIC 2BYKA 4YS3A 1BH8B 3REIB 3LZ0A 2CV5B 5B33D 5DNNC 5DNMA 4JJNA 5B1LB 5GT3C 5GXQB 5B0ZC 3X1UD 5GT0D 1P34D 1P3KB 3AFAD 3B0CT 1P3PD 1HTAA 4XUJA 5B40B 3W96D 1M1AD 3VH5T 4J8XC 3X1SC 3MGSC 5AY8C 2UWXA 4H9OB 3MGRD 5G49A 5B2ID 3MGQC 4EO5B 1KX5A 4J8UD 4KUDD 5AVCC 1P3MB 1ULYA 5AV5C 4X23C 5AV9C 3AV2A 3VH5A 3X1TD 3WTPC 4WU9A 1P3OD 1KX3B 1EQZC 3RELD 3AZMC 5CP6B 3IP4C 5AY8A 3C1BB 1P3FA 1ZLAA 3W98C 1M18D 3AZIA 3KUYC 2F2AC 2PYOB 5BNXB 3FDDA 5B32D 5AV8D 4YS3D 3LZ0D 3AZGB 3B6GB 4J8WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXB C;  5AVC A;  2NQB B;  4JJN D;  5AV5 A;  1WWS A;  4Z5T C;  5B24 B;  5JRG B;  3AZJ B;  3KWQ B;  4E44 A;  4ZUX B;  1HQ3 C;  3LEL A;  3AZL D;  3REJ D;  4XZQ B;  1KX4 A;  2LY8 A;  4NE3 A;  5F99 D;  5CPI B;  2JSS A;  5CPK D;  1TZY B;  4J8V A;  3LZ1 B;  1S32 B;  1AOI D;  3O62 B;  5B2J B;  3B6F C;  5B0Y C;  3W97 C;  3A6N A;  5AVB C;  4J8W A;  3V9R A;  1JFI B;  2L5A A;  2F8N B;  5DNN D;  3KXB A;  1F66 A;  5GT3 D;  5B0Z D;  2RVQ C;  4Z5T A;  3AZH C;  4HGA C;  2HIO B;  4H9P A;  5BS7 C;  3UTA C;  4KGC B;  4J8X D;  3UTB C;  3X1S D;  3MGS D;  1WWI A;  4CAY B;  5AY8 D;  3AZK B;  3REK B;  2HUE C;  5GSU A;  3MGQ D;  5B31 B;  4QLC C;  1P3G C;  3W97 A;  3WTP E;  2NZD A;  2YFW A;  5B1M A;  1R4V A;  5AV6 B;  5AVC D;  5CPJ A;  5AV5 D;  3R45 A;  3REH C;  4X23 D;  5AV9 D;  5KDM A;  3AZH A;  3WTP D;  1EQZ D;  4YM6 C;  3AZM D;  3W99 C;  3UTB A;  3LJA C;  5BNV B;  3WKJ C;  4UUZ B;  3W98 D;  3KUY D;  1ID3 B;  3C1C A;  3REI C;  3MGP A;  2CV5 C;  4QLC A;  3UT9 C;  1U35 A;  1P3G A;  3TU4 B;  4H9S C;  4J8W D;  4CSR B;  1P3K C;  4Z66 A;  1H3O A;  3KXB D;  4H9Q A;  4AWL C;  3X1V B;  5BT1 C;  5DNM C;  2ARO B;  4Z5T D;  3AV1 B;  1HQ3 D;  4XUJ C;  3AZF A;  2F8N H;  3AN2 B;  4YM6 A;  5GT0 B;  1P34 B;  3LJA A;  3AFA B;  1P3P B;  3W96 B;  1BH8 A;  3MGR B;  3REI A;  3NQJ B;  3AZN B;  2CV5 A;  3B6F D;  5B0Y D;  3W97 D;  1P3I B;  4H9S A;  1P3M C;  5AVB D;  1KX5 C;  1P3K A;  5B1L A;  5GXQ A;  3AYW B;  5B40 A;  2RVQ D;  3AZH D;  4KUD B;  3AV2 C;  3WA9 B;  3UTA D;  5CP6 C;  4WU9 C;  5E5A B;  3C1B C;  3UTB D;  4H9O A;  5FUG B;  4Z2M H;  3B0B A;  1P3F C;  3MNN B;  1ZLA C;  4WU8 B;  3AZI C;  4G92 B;  5B32 G;  4QLC D;  1P3G D;  1P3M A;  2NQB C;  5AV8 B;  4YS3 B;  3REH D;  4ZUX C;  2IO5 C;  5CP6 A;  3LEL C;  4YM6 D;  3W99 D;  3C1B A;  4XZQ C;  3LJA D;  3WKJ D;  3AZL B;  1TAF B;  3AZE B;  2PYO A;  1KX4 C;  5BNX A;  1P3A B;  2FJ7 B;  1S32 C;  1BH9 B;  3REJ B;  3REI D;  2BYM B;  4J8V C;  3AZG A;  4R8P B;  5F99 B;  2CV5 D;  3B6G A;  3UT9 D;  3B0D C;  5CPK B;  3A6N C;  2NQB A;  1P3K D;  5B24 A;  5JRG A;  5BT1 D;  5DNM D;  3KWQ A;  3AZJ A;  1AOI B;  1F66 C;  4ZUX A;  2HIO C;  4KGC C;  4WNN B;  3NQU B;  5DNN B;  4XUJ D;  3VH6 A;  1P3B B;  5GT3 B;  5B0Z B;  4XZQ A;  2YFV B;  5CPI A;  1N1J B;  4ZBJ B;  4J8X B;  1TZY A;  3X1S B;  3MGS B;  3LZ1 A;  1S32 A;  1P3L B;  3O62 A;  5GSU C;  5B2J A;  1JFI A;  4M6B A;  5AV6 C;  2F8N A;  1P3M D;  1KX5 D;  2NZD C;  3MGQ B;  5B1M C;  5CPJ C;  2HIO A;  4KGC A;  3AV2 D;  4E45 A;  5CP6 D;  4WU9 D;  4CAY A;  4X23 B;  5AV9 B;  3C1B D;  3AZK A;  3WTP B;  3REK A;  1P3F D;  1EQZ B;  3AZM B;  1ZLA D;  3AZI D;  1M19 B;  5B31 A;  3W98 B;  2F8N G;  3C1C C;  3MGP C;  3KUY B;  5AV6 A;  1U35 C;  3X1V C;  2NQB D;  3VH6 W;  2ARO C;  4Z66 C;  3AV1 C;  4ZUX D;  5JA4 B;  4WZS B;  3AN2 C;  3LEL D;  5BNV A;  3AZF C;  4XZQ D;  4UUZ A;  1HQ3 B;  1KX4 D;  1ID3 A;  1S32 D;  3AZN C;  5BO0 B;  4J8V D;  1P3I C;  3TU4 A;  3MVD B;  4CSR A;  2F8N D;  5C3I B;  3AYW C;  3A6N D;  3X1V A;  1B6W A;  3WAA B;  2ARO A;  4Z2M G;  4LD9 B;  5B1L C;  5GXQ C;  3AV1 A;  1F66 D;  5B0Y B;  3B6F B;  2HIO D;  3WA9 C;  4KGC D;  5B40 C;  5AVB B;  4H9N B;  5E5A C;  3AN2 A;  1P34 A;  5GT0 A;  5B33 B;  3AFA A;  4G91 B;  3W96 A;  3X1U B;  4HGA B;  3MNN C;  4WU8 C;  3UTA B;  1M1A B;  3MGR A;  3NQJ A;  3AZN A;  5GSU D;  4EO5 C;  1P3I A;  2HUE B;  5AV6 D;  4KHA B;  3AYW A;  2NZD D;  5B1M D;  5B2I B;  5CPJ D;  4KUD A;  3WA9 A;  5E5A A;  1KX3 C;  4J8U B;  3REH B;  5FUG A;  3AZE C;  3MNN A;  4WU8 A;  1P3A C;  2FJ7 C;  3X1T B;  1P3O B;  3W99 B;  3REL B;  2PYO C;  3WKJ B;  4R8P C;  3C1C D;  1KU5 A;  3AZG C;  3MGP D;  1M18 B;  3B6G C;  5AV8 A;  1U35 D;  3X1V D;  4H9R B;  2ARO D;  4Z66 D;  5B32 B;  3AV1 D;  5B24 C;  5JRG C;  3UT9 B;  2BYK B;  3KWQ C;  3AZJ C;  1P3B C;  3LZ0 B;  3AN2 D;  4NE5 A;  1KX3 A;  4AWL B;  1A7W A;  4NFT A;  5DNM B;  3AZF D;  4JJN B;  3AZL A;  3VH6 T;  4ZBJ C;  1TAF A;  3AZE A;  4XUJ B;  1P3A A;  2FJ7 A;  5CPI C;  2CWE A;  1BH9 A;  5CHL B;  3REJ A;  1P3L C;  1B67 A;  1TZY C;  2BYM A;  3LZ1 C;  3AZN D;  4R8P A;  5F99 A;  2F8N K;  3O62 C;  1P3I D;  5B2J C;  5CPK A;  3AYW D;  5G49 B;  1AOI A;  5B1L D;  5GXQ D;  4WNN A;  3NQU A;  3WA9 D;  5DNN A;  5B40 D;  1P3B A;  1KX5 B;  5E5A D;  5GT3 A;  5B0Z A;  2YFV A;  4WV4 B;  3AZK C;  1N1J A;  3MNN D;  3AV2 B;  4WU8 D;  4J8X A;  3X1S A;  3REK C;  3MGS A;  4WU9 B;  1M19 C;  1P3L A;  5B31 C;  5AY8 B;  1P3F B;  1ZLA B;  3AZI B;  3MGQ A;  1KX3 D;  4X23 A;  5AV9 A;  5AVC B;  3WTP A;  5AV5 B;  3AZE D;  1EQZ A;  2IO5 B;  3AZM A;  1P3A D;  2FJ7 D;  3LEL B;  1M19 A;  2PYO D;  1ID3 C;  3W98 A;  4R8P D;  3MVD C;  3KUY A;  5C3I C;  1KX4 B;  3AZG D;  3TU4 C;  3B6G D;  3WAA C;  4LD9 C;  3B0C W;  4J8V B;  3VH5 W;  4DRB A;  5B24 D;  5JA4 A;  3B0D B;  5JRG D;  3KWQ D;  3AZJ D;  1P3B D;  3A6N B;  5B33 C;  4G91 C;  4J8W B;  3V9R B;  1P34 C;  3X1U C;  5GT0 C;  3KXB B;  1F66 B;  3AFA C;  1P3P C;  1HQ3 A;  3W96 C;  4Z5T B;  1M1A C;  5CPI D;  4H9P B;  1F1E A;  1P3L D;  5B31 G;  5BO0 A;  1TZY D;  3LZ1 D;  3MGR C;  3MVD A;  3O62 D;  5B2J D;  5B2I C;  3WAA A;  4LD9 A;  5GSU B;  3B6F A;  5B0Y A;  4DRA A;  5AVB A;  4H9N A;  1Q9C A;  4J8U C;  3W97 B;  4KUD C;  5B33 A;  2NZD B;  2YFW B;  5B1M B;  3X1U A;  5CPJ B;  3R45 B;  3UTA A;  5BS7 A;  3X1T C;  3AZK D;  1P3P A;  5KDM B;  1P3O C;  1M1A A;  3AZH B;  3REL C;  3REK D;  1M19 D;  4NE6 A;  4G92 C;  3UTB B;  5B31 D;  1M18 C;  4KHA A;  3KSY A;  5B2I A;  5B32 C;  5AV8 C;  4YS3 C;  3C1C B;  3LZ0 C;  3MGP B;  4QLC B;  1U35 B;  1P3G B;  4J8U A;  3REH A;  4JJN C;  4Z66 B;  1H3O B;  4H9Q B;  3X1T A;  3AZL C;  1P3O A;  3W99 A;  3REL A;  3WKJ A;  3AZF B;  4YM6 B;  1ID3 D;  3REJ C;  3LJA B;  3MVD D;  1M18 A;  5F99 C;  1BFM A;  3TU4 D;  4H9R A;  5CPK C;  3WAA D;  4LD9 D;  5B32 A;  3UT9 A;  1AOI C;  2BYK A;  4YS3 A;  1BH8 B;  3REI B;  3LZ0 A;  2CV5 B;  5B33 D;  5DNN C;  5DNM A;  4JJN A;  5B1L B;  5GT3 C;  5GXQ B;  5B0Z C;  3X1U D;  5GT0 D;  1P34 D;  1P3K B;  3AFA D;  3B0C T;  1P3P D;  1HTA A;  4XUJ A;  5B40 B;  3W96 D;  1M1A D;  3VH5 T;  4J8X C;  3X1S C;  3MGS C;  5AY8 C;  4H9O B;  3MGR D;  5G49 A;  5B2I D;  3MGQ C;  4EO5 B;  1KX5 A;  4J8U D;  4KUD D;  5AVC C;  1P3M B;  1ULY A;  5AV5 C;  4X23 C;  5AV9 C;  3AV2 A;  3VH5 A;  3X1T D;  3WTP C;  4WU9 A;  1P3O D;  1KX3 B;  1EQZ C;  3REL D;  3AZM C;  5CP6 B;  5AY8 A;  3C1B B;  1P3F A;  1ZLA A;  3W98 C;  1M18 D;  3AZI A;  3KUY C;  2PYO B;  5BNX B;  5B32 D;  5AV8 D;  4YS3 D;  3LZ0 D;  3AZG B;  3B6G B;  4J8W C; 
#chains in the Genus database with same CATH topology
 3KXB C;  5AVC A;  2NQB B;  4JJN D;  5AV5 A;  1WWS A;  4Z5T C;  5B24 B;  5JRG B;  3AZJ B;  3KWQ B;  4E44 A;  4ZUX B;  1HQ3 C;  3LEL A;  3AZL D;  2VQR A;  3REJ D;  4XZQ B;  1KX4 A;  2LY8 A;  4NE3 A;  5F99 D;  5CPI B;  2JSS A;  2Y2M A;  5CPK D;  1TZY B;  4J8V A;  3LZ1 B;  1S32 B;  1AOI D;  3O62 B;  5B2J B;  3B6F C;  5B0Y C;  3W97 C;  3A6N A;  5AVB C;  4J8W A;  3V9R A;  1JFI B;  2L5A A;  2Y2H A;  2F8N B;  5DNN D;  3KXB A;  1F66 A;  3EPK A;  5GT3 D;  5B0Z D;  2RVQ C;  4Z5T A;  3AZH C;  4HGA C;  2HIO B;  4H9P A;  5BS7 C;  3UTA C;  4KGC B;  4J8X D;  3UTB C;  3X1S D;  3MGS D;  1WWI A;  3H0M C;  4CAY B;  5AY8 D;  3AZK B;  3REK B;  2HUE C;  5GSU A;  3MGQ D;  5B31 B;  2BG1 A;  4QLC C;  1P3G C;  3W97 A;  3WTP E;  2NZD A;  2YFW A;  5B1M A;  1R4V A;  5AV6 B;  5AVC D;  5CPJ A;  5AV5 D;  3R45 A;  3REH C;  3H0R C;  5AV9 D;  4X23 D;  5KDM A;  3AZH A;  3WTP D;  2XD1 A;  2JE5 A;  1EQZ D;  4YM6 C;  3AZM D;  3W99 C;  3UTB A;  3LJA C;  5BNV B;  3WKJ C;  2ZY5 A;  4UUZ B;  3W98 D;  3KUY D;  2RIQ A;  1ID3 B;  3C1C A;  3REI C;  3MGP A;  2CV5 C;  4QLC A;  3UT9 C;  1U35 A;  1P3G A;  3TU4 B;  4H9S C;  4J8W D;  4CSR B;  1P3K C;  4Z66 A;  1H3O A;  3KXB D;  4H9Q A;  4AWL C;  3X1V B;  5BT1 C;  2Y2G A;  5DNM C;  2ARO B;  4Z5T D;  3AV1 B;  1HQ3 D;  4XUJ C;  3AZF A;  2F8N H;  3P5J B;  4YM6 A;  5GT0 B;  3AN2 B;  1P34 B;  3LJA A;  3AFA B;  1P3P B;  3W96 B;  2Y2L A;  2Y2Q A;  1T3U A;  1BH8 A;  1W2E A;  3MGR B;  3NQJ B;  3REI A;  3AZN B;  2CV5 A;  3B6F D;  5B0Y D;  3W97 D;  1P3I B;  4H9S A;  1P3M C;  5AVB D;  1KX5 C;  1P3K A;  5B1L A;  5GXQ A;  3EPL A;  3AYW B;  5B40 A;  2RVQ D;  3AZH D;  4KUD B;  3AV2 C;  3WA9 B;  3UTA D;  5CP6 C;  4WU9 C;  5E5A B;  2FFF B;  2J8P A;  3C1B C;  3UTB D;  4H9O A;  5FUG B;  4Z2M H;  3B0B A;  1P3F C;  3MNN B;  1ZLA C;  4WU8 B;  3AZI C;  4G92 B;  5B32 G;  3F6T A;  4QLC D;  1P3G D;  1P3M A;  2NQB C;  5AV8 B;  4YS3 B;  3REH D;  4ZUX C;  2IO5 C;  5CP6 A;  3LEL C;  4YM6 D;  3W99 D;  3C1B A;  4XZQ C;  3LJA D;  3WKJ D;  3AZL B;  1TAF B;  3AZE B;  2PYO A;  1KX4 C;  5BNX A;  1P3A B;  2FJ7 B;  1S32 C;  1BH9 B;  3REJ B;  3REI D;  2BYM B;  4J8V C;  3AZG A;  4R8P B;  5F99 B;  2CV5 D;  3B6G A;  3UT9 D;  3B0D C;  3H0L C;  5CPK B;  3A6N C;  2NQB A;  1P3K D;  5B24 A;  5JRG A;  5BT1 D;  5DNM D;  3KWQ A;  3AZJ A;  1AOI B;  1F66 C;  4ZUX A;  2HIO C;  4KGC C;  4WNN B;  3NQU B;  5DNN B;  4XUJ D;  3VH6 A;  1P3B B;  4UPK A;  5GT3 B;  5B0Z B;  4XZQ A;  2YFV B;  5CPI A;  1N1J B;  4ZBJ B;  4J8X B;  1TZY A;  3X1S B;  3MGS B;  3LZ1 A;  1S32 A;  1P3L B;  3O62 A;  5GSU C;  5B2J A;  1JFI A;  4M6B A;  5AV6 C;  2F8N A;  1P3M D;  1KX5 D;  2NZD C;  3MGQ B;  5B1M C;  5CPJ C;  2HIO A;  4KGC A;  2ZY2 A;  3AV2 D;  2Y2K A;  4E45 A;  5CP6 D;  4WU9 D;  2Y2N A;  4CAY A;  4X23 B;  5AV9 B;  3C1B D;  3AZK A;  3WTP B;  3REK A;  1P3F D;  1EQZ B;  3AZM B;  1ZLA D;  3AZI D;  1M19 B;  5B31 A;  3W98 B;  2F8N G;  3C1C C;  3MGP C;  3KUY B;  5AV6 A;  2G5I C;  1U35 C;  3X1V C;  2NQB D;  3VH6 W;  2ARO C;  4Z66 C;  3A1K A;  3AV1 C;  4ZUX D;  5JA4 B;  4WZS B;  3AN2 C;  2G5H C;  3LEL D;  5BNV A;  3AZF C;  4XZQ D;  4UUZ A;  1HQ3 B;  2W8S A;  1KX4 D;  1ID3 A;  1S32 D;  3AZN C;  5BO0 B;  4J8V D;  1P3I C;  3TU4 A;  3MVD B;  4CSR A;  2F8N D;  5C3I B;  3AYW C;  3EPH A;  3A6N D;  4DQY B;  1B6W A;  3X1V A;  3WAA B;  2ARO A;  4Z2M G;  4LD9 B;  5B1L C;  5GXQ C;  3AV1 A;  1F66 D;  5B0Y B;  3B6F B;  2HIO D;  3WA9 C;  4KGC D;  5B40 C;  5AVB B;  4H9N B;  5E5A C;  3AN2 A;  1P34 A;  5GT0 A;  2JCH A;  5B33 B;  3AFA A;  4G91 B;  3W96 A;  3X1U B;  4HGA B;  3MNN C;  4WU8 C;  3UTA B;  1M1A B;  3MGR A;  3NQJ A;  3AZN A;  5GSU D;  4EO5 C;  1P3I A;  2HUE B;  4WJ3 C;  5AV6 D;  4KHA B;  3AYW A;  2NZD D;  5B1M D;  5B2I B;  5CPJ D;  4KUD A;  3WA9 A;  5E5A A;  1KX3 C;  4J8U B;  2Y2J A;  3REH B;  5FUG A;  3AZE C;  3MNN A;  4WU8 A;  1P3A C;  2FJ7 C;  3X1T B;  1P3O B;  3W99 B;  3REL B;  2PYO C;  3WKJ B;  4R8P C;  3C1C D;  1KU5 A;  3AZG C;  3MGP D;  1M18 B;  3B6G C;  5AV8 A;  1U35 D;  3X1V D;  4H9R B;  2ARO D;  4Z66 D;  2Y2P A;  5B32 B;  3AV1 D;  5B24 C;  5JRG C;  3UT9 B;  2BYK B;  3KWQ C;  3AZJ C;  1P3B C;  3LZ0 B;  3AN2 D;  2ZY4 A;  4NE5 A;  1KX3 A;  4AWL B;  1A7W A;  4NFT A;  5DNM B;  3AZF D;  4JJN B;  3AZL A;  3VH6 T;  4ZBJ C;  1TAF A;  3AZE A;  4XUJ B;  1P3A A;  2FJ7 A;  5CPI C;  3KFU G;  2CWE A;  2DF4 C;  1BH9 A;  3EG5 B;  5CHL B;  3REJ A;  1P3L C;  1B67 A;  1TZY C;  2BYM A;  3LZ1 C;  3AZN D;  2ZY3 A;  5F99 A;  4R8P A;  2F8N K;  3O62 C;  1P3I D;  5B2J C;  5CPK A;  3AYW D;  5G49 B;  1AOI A;  5B1L D;  5GXQ D;  4WNN A;  3NQU A;  3WA9 D;  5DNN A;  5B40 D;  1P3B A;  1KX5 B;  5E5A D;  5GT3 A;  5B0Z A;  2YFV A;  3A1I A;  4WV4 B;  3AZK C;  1N1J A;  3MNN D;  3AV2 B;  4WU8 D;  4J8X A;  3X1S A;  3REK C;  3MGS A;  4WU9 B;  1M19 C;  1Z2C B;  1P3L A;  5B31 C;  5AY8 B;  1P3F B;  1ZLA B;  3AZI B;  3MGQ A;  1KX3 D;  4X23 A;  5AV9 A;  2XD5 A;  5AVC B;  3WTP A;  5AV5 B;  3AZE D;  1EQZ A;  2IO5 B;  3AZM A;  1P3A D;  2FJ7 D;  3LEL B;  1M19 A;  2PYO D;  1ID3 C;  3W98 A;  4R8P D;  3MVD C;  3KUY A;  2ZM5 A;  5C3I C;  1KX4 B;  3AZG D;  1PZR A;  3TU4 C;  3B6G D;  3WAA C;  4LD9 C;  3B0C W;  4J8V B;  3VH5 W;  4DRB A;  5JA4 A;  5JRG D;  3B0D B;  5B24 D;  3KWQ D;  3AZJ D;  1P3B D;  3A6N B;  5B33 C;  4G91 C;  4J8W B;  3V9R B;  1P34 C;  5GT0 C;  3X1U C;  3KXB B;  1F66 B;  3AFA C;  1P3P C;  1HQ3 A;  3W96 C;  4Z5T B;  1M1A C;  5CPI D;  4H9P B;  1F1E A;  1P3L D;  5B31 G;  5BO0 A;  1TZY D;  3LZ1 D;  3MGR C;  3MVD A;  3O62 D;  5B2J D;  5B2I C;  3WAA A;  4LD9 A;  5GSU B;  3B6F A;  5B0Y A;  4DRA A;  5AVB A;  4H9N A;  1Q9C A;  4J8U C;  3W97 B;  4KUD C;  5B33 A;  2NZD B;  2YFW B;  5B1M B;  3X1U A;  5CPJ B;  3R45 B;  3UTA A;  5BS7 A;  3X1T C;  3AZK D;  1P3P A;  5KDM B;  1P3O C;  1M1A A;  3AZH B;  3REL C;  3REK D;  1M19 D;  2Y2O A;  4NE6 A;  4G92 C;  3UTB B;  5B31 D;  1M18 C;  4KHA A;  2DQN C;  3KSY A;  5B2I A;  5B32 C;  5AV8 C;  4YS3 C;  3C1C B;  3LZ0 C;  3MGP B;  4QLC B;  1U35 B;  1P3G B;  4J8U A;  3REH A;  4JJN C;  4Z66 B;  1H3O B;  4H9Q B;  3X1T A;  3AZL C;  1P3O A;  3W99 A;  3REL A;  3WKJ A;  3AZF B;  4YM6 B;  1ID3 D;  3REJ C;  3LJA B;  3MVD D;  2Y2I A;  1M18 A;  5F99 C;  3AL0 C;  1BFM A;  3TU4 D;  4H9R A;  5CPK C;  3EPJ A;  3WAA D;  4LD9 D;  5B32 A;  3UT9 A;  1AOI C;  2BYK A;  4YS3 A;  1BH8 B;  3REI B;  3LZ0 A;  2CV5 B;  5B33 D;  5DNN C;  5DNM A;  4JJN A;  5B1L B;  5GT3 C;  5GXQ B;  5B0Z C;  3X1U D;  5GT0 D;  1P34 D;  1P3K B;  3AFA D;  3B0C T;  1P3P D;  1HTA A;  4XUJ A;  5B40 B;  3W96 D;  1M1A D;  3VH5 T;  4J8X C;  3X1S C;  3MGS C;  5AY8 C;  2UWX A;  4H9O B;  3MGR D;  5G49 A;  5B2I D;  3MGQ C;  4EO5 B;  1KX5 A;  4J8U D;  4KUD D;  5AVC C;  1P3M B;  1ULY A;  5AV5 C;  4X23 C;  5AV9 C;  3AV2 A;  3VH5 A;  3X1T D;  3WTP C;  4WU9 A;  1P3O D;  1KX3 B;  1EQZ C;  3REL D;  3AZM C;  5CP6 B;  3IP4 C;  5AY8 A;  3C1B B;  1P3F A;  1ZLA A;  3W98 C;  1M18 D;  3AZI A;  3KUY C;  2F2A C;  2PYO B;  5BNX B;  3FDD A;  5B32 D;  5AV8 D;  4YS3 D;  3LZ0 D;  3AZG B;  3B6G B;  4J8W C; 
#chains in the Genus database with same CATH homology
 3KXB C;  5AVC A;  2NQB B;  4JJN D;  5AV5 A;  1WWS A;  4Z5T C;  5B24 B;  5JRG B;  3AZJ B;  3KWQ B;  4E44 A;  4ZUX B;  1HQ3 C;  3LEL A;  3AZL D;  2VQR A;  3REJ D;  4XZQ B;  1KX4 A;  2LY8 A;  4NE3 A;  5F99 D;  5CPI B;  2JSS A;  2Y2M A;  5CPK D;  1TZY B;  4J8V A;  3LZ1 B;  1S32 B;  1AOI D;  3O62 B;  5B2J B;  3B6F C;  5B0Y C;  3W97 C;  3A6N A;  5AVB C;  4J8W A;  3V9R A;  1JFI B;  2L5A A;  2Y2H A;  2F8N B;  5DNN D;  3KXB A;  1F66 A;  3EPK A;  5GT3 D;  5B0Z D;  2RVQ C;  4Z5T A;  3AZH C;  4HGA C;  2HIO B;  4H9P A;  5BS7 C;  3UTA C;  4KGC B;  4J8X D;  3UTB C;  3X1S D;  3MGS D;  1WWI A;  3H0M C;  4CAY B;  5AY8 D;  3AZK B;  3REK B;  2HUE C;  5GSU A;  3MGQ D;  5B31 B;  2BG1 A;  4QLC C;  1P3G C;  3W97 A;  3WTP E;  2NZD A;  2YFW A;  5B1M A;  1R4V A;  5AV6 B;  5AVC D;  5CPJ A;  5AV5 D;  3R45 A;  3REH C;  3H0R C;  5AV9 D;  4X23 D;  5KDM A;  3AZH A;  3WTP D;  2XD1 A;  2JE5 A;  1EQZ D;  4YM6 C;  3AZM D;  3W99 C;  3UTB A;  3LJA C;  5BNV B;  3WKJ C;  2ZY5 A;  4UUZ B;  3W98 D;  3KUY D;  2RIQ A;  1ID3 B;  3C1C A;  3REI C;  3MGP A;  2CV5 C;  4QLC A;  3UT9 C;  1U35 A;  1P3G A;  3TU4 B;  4H9S C;  4J8W D;  4CSR B;  1P3K C;  4Z66 A;  1H3O A;  3KXB D;  4H9Q A;  4AWL C;  3X1V B;  5BT1 C;  2Y2G A;  5DNM C;  2ARO B;  4Z5T D;  3AV1 B;  1HQ3 D;  4XUJ C;  3AZF A;  2F8N H;  3P5J B;  4YM6 A;  5GT0 B;  3AN2 B;  1P34 B;  3LJA A;  3AFA B;  1P3P B;  3W96 B;  2Y2L A;  2Y2Q A;  1T3U A;  1BH8 A;  1W2E A;  3MGR B;  3NQJ B;  3REI A;  3AZN B;  2CV5 A;  3B6F D;  5B0Y D;  3W97 D;  1P3I B;  4H9S A;  1P3M C;  5AVB D;  1KX5 C;  1P3K A;  5B1L A;  5GXQ A;  3EPL A;  3AYW B;  5B40 A;  2RVQ D;  3AZH D;  4KUD B;  3AV2 C;  3WA9 B;  3UTA D;  5CP6 C;  4WU9 C;  5E5A B;  2FFF B;  2J8P A;  3C1B C;  3UTB D;  4H9O A;  5FUG B;  4Z2M H;  3B0B A;  1P3F C;  3MNN B;  1ZLA C;  4WU8 B;  3AZI C;  4G92 B;  5B32 G;  3F6T A;  4QLC D;  1P3G D;  1P3M A;  2NQB C;  5AV8 B;  4YS3 B;  3REH D;  4ZUX C;  2IO5 C;  5CP6 A;  3LEL C;  4YM6 D;  3W99 D;  3C1B A;  4XZQ C;  3LJA D;  3WKJ D;  3AZL B;  1TAF B;  3AZE B;  2PYO A;  1KX4 C;  5BNX A;  1P3A B;  2FJ7 B;  1S32 C;  1BH9 B;  3REJ B;  3REI D;  2BYM B;  4J8V C;  3AZG A;  4R8P B;  5F99 B;  2CV5 D;  3B6G A;  3UT9 D;  3B0D C;  3H0L C;  5CPK B;  3A6N C;  2NQB A;  1P3K D;  5B24 A;  5JRG A;  5BT1 D;  5DNM D;  3KWQ A;  3AZJ A;  1AOI B;  1F66 C;  4ZUX A;  2HIO C;  4KGC C;  4WNN B;  3NQU B;  5DNN B;  4XUJ D;  3VH6 A;  1P3B B;  4UPK A;  5GT3 B;  5B0Z B;  4XZQ A;  2YFV B;  5CPI A;  1N1J B;  4ZBJ B;  4J8X B;  1TZY A;  3X1S B;  3MGS B;  3LZ1 A;  1S32 A;  1P3L B;  3O62 A;  5GSU C;  5B2J A;  1JFI A;  4M6B A;  5AV6 C;  2F8N A;  1P3M D;  1KX5 D;  2NZD C;  3MGQ B;  5B1M C;  5CPJ C;  2HIO A;  4KGC A;  2ZY2 A;  3AV2 D;  2Y2K A;  4E45 A;  5CP6 D;  4WU9 D;  2Y2N A;  4CAY A;  4X23 B;  5AV9 B;  3C1B D;  3AZK A;  3WTP B;  3REK A;  1P3F D;  1EQZ B;  3AZM B;  1ZLA D;  3AZI D;  1M19 B;  5B31 A;  3W98 B;  2F8N G;  3C1C C;  3MGP C;  3KUY B;  5AV6 A;  2G5I C;  1U35 C;  3X1V C;  2NQB D;  3VH6 W;  2ARO C;  4Z66 C;  3A1K A;  3AV1 C;  4ZUX D;  5JA4 B;  4WZS B;  3AN2 C;  2G5H C;  3LEL D;  5BNV A;  3AZF C;  4XZQ D;  4UUZ A;  1HQ3 B;  2W8S A;  1KX4 D;  1ID3 A;  1S32 D;  3AZN C;  5BO0 B;  4J8V D;  1P3I C;  3TU4 A;  3MVD B;  4CSR A;  2F8N D;  5C3I B;  3AYW C;  3EPH A;  3A6N D;  4DQY B;  1B6W A;  3X1V A;  3WAA B;  2ARO A;  4Z2M G;  4LD9 B;  5B1L C;  5GXQ C;  3AV1 A;  1F66 D;  5B0Y B;  3B6F B;  2HIO D;  3WA9 C;  4KGC D;  5B40 C;  5AVB B;  4H9N B;  5E5A C;  3AN2 A;  1P34 A;  5GT0 A;  2JCH A;  5B33 B;  3AFA A;  4G91 B;  3W96 A;  3X1U B;  4HGA B;  3MNN C;  4WU8 C;  3UTA B;  1M1A B;  3MGR A;  3NQJ A;  3AZN A;  5GSU D;  4EO5 C;  1P3I A;  2HUE B;  4WJ3 C;  5AV6 D;  4KHA B;  3AYW A;  2NZD D;  5B1M D;  5B2I B;  5CPJ D;  4KUD A;  3WA9 A;  5E5A A;  1KX3 C;  4J8U B;  2Y2J A;  3REH B;  5FUG A;  3AZE C;  3MNN A;  4WU8 A;  1P3A C;  2FJ7 C;  3X1T B;  1P3O B;  3W99 B;  3REL B;  2PYO C;  3WKJ B;  4R8P C;  3C1C D;  1KU5 A;  3AZG C;  3MGP D;  1M18 B;  3B6G C;  5AV8 A;  1U35 D;  3X1V D;  4H9R B;  2ARO D;  4Z66 D;  2Y2P A;  5B32 B;  3AV1 D;  5B24 C;  5JRG C;  3UT9 B;  2BYK B;  3KWQ C;  3AZJ C;  1P3B C;  3LZ0 B;  3AN2 D;  2ZY4 A;  4NE5 A;  1KX3 A;  4AWL B;  1A7W A;  4NFT A;  5DNM B;  3AZF D;  4JJN B;  3AZL A;  3VH6 T;  4ZBJ C;  1TAF A;  3AZE A;  4XUJ B;  1P3A A;  2FJ7 A;  5CPI C;  3KFU G;  2CWE A;  2DF4 C;  1BH9 A;  3EG5 B;  5CHL B;  3REJ A;  1P3L C;  1B67 A;  1TZY C;  2BYM A;  3LZ1 C;  3AZN D;  2ZY3 A;  5F99 A;  4R8P A;  2F8N K;  3O62 C;  1P3I D;  5B2J C;  5CPK A;  3AYW D;  5G49 B;  1AOI A;  5B1L D;  5GXQ D;  4WNN A;  3NQU A;  3WA9 D;  5DNN A;  5B40 D;  1P3B A;  1KX5 B;  5E5A D;  5GT3 A;  5B0Z A;  2YFV A;  3A1I A;  4WV4 B;  3AZK C;  1N1J A;  3MNN D;  3AV2 B;  4WU8 D;  4J8X A;  3X1S A;  3REK C;  3MGS A;  4WU9 B;  1M19 C;  1Z2C B;  1P3L A;  5B31 C;  5AY8 B;  1P3F B;  1ZLA B;  3AZI B;  3MGQ A;  1KX3 D;  4X23 A;  5AV9 A;  2XD5 A;  5AVC B;  3WTP A;  5AV5 B;  3AZE D;  1EQZ A;  2IO5 B;  3AZM A;  1P3A D;  2FJ7 D;  3LEL B;  1M19 A;  2PYO D;  1ID3 C;  3W98 A;  4R8P D;  3MVD C;  3KUY A;  2ZM5 A;  5C3I C;  1KX4 B;  3AZG D;  1PZR A;  3TU4 C;  3B6G D;  3WAA C;  4LD9 C;  3B0C W;  4J8V B;  3VH5 W;  4DRB A;  5JA4 A;  5JRG D;  3B0D B;  5B24 D;  3KWQ D;  3AZJ D;  1P3B D;  3A6N B;  5B33 C;  4G91 C;  4J8W B;  3V9R B;  1P34 C;  5GT0 C;  3X1U C;  3KXB B;  1F66 B;  3AFA C;  1P3P C;  1HQ3 A;  3W96 C;  4Z5T B;  1M1A C;  5CPI D;  4H9P B;  1F1E A;  1P3L D;  5B31 G;  5BO0 A;  1TZY D;  3LZ1 D;  3MGR C;  3MVD A;  3O62 D;  5B2J D;  5B2I C;  3WAA A;  4LD9 A;  5GSU B;  3B6F A;  5B0Y A;  4DRA A;  5AVB A;  4H9N A;  1Q9C A;  4J8U C;  3W97 B;  4KUD C;  5B33 A;  2NZD B;  2YFW B;  5B1M B;  3X1U A;  5CPJ B;  3R45 B;  3UTA A;  5BS7 A;  3X1T C;  3AZK D;  1P3P A;  5KDM B;  1P3O C;  1M1A A;  3AZH B;  3REL C;  3REK D;  1M19 D;  2Y2O A;  4NE6 A;  4G92 C;  3UTB B;  5B31 D;  1M18 C;  4KHA A;  2DQN C;  3KSY A;  5B2I A;  5B32 C;  5AV8 C;  4YS3 C;  3C1C B;  3LZ0 C;  3MGP B;  4QLC B;  1U35 B;  1P3G B;  4J8U A;  3REH A;  4JJN C;  4Z66 B;  1H3O B;  4H9Q B;  3X1T A;  3AZL C;  1P3O A;  3W99 A;  3REL A;  3WKJ A;  3AZF B;  4YM6 B;  1ID3 D;  3REJ C;  3LJA B;  3MVD D;  2Y2I A;  1M18 A;  5F99 C;  3AL0 C;  1BFM A;  3TU4 D;  4H9R A;  5CPK C;  3EPJ A;  3WAA D;  4LD9 D;  5B32 A;  3UT9 A;  1AOI C;  2BYK A;  4YS3 A;  1BH8 B;  3REI B;  3LZ0 A;  2CV5 B;  5B33 D;  5DNN C;  5DNM A;  4JJN A;  5B1L B;  5GT3 C;  5GXQ B;  5B0Z C;  3X1U D;  5GT0 D;  1P34 D;  1P3K B;  3AFA D;  3B0C T;  1P3P D;  1HTA A;  4XUJ A;  5B40 B;  3W96 D;  1M1A D;  3VH5 T;  4J8X C;  3X1S C;  3MGS C;  5AY8 C;  2UWX A;  4H9O B;  3MGR D;  5G49 A;  5B2I D;  3MGQ C;  4EO5 B;  1KX5 A;  4J8U D;  4KUD D;  5AVC C;  1P3M B;  1ULY A;  5AV5 C;  4X23 C;  5AV9 C;  3AV2 A;  3VH5 A;  3X1T D;  3WTP C;  4WU9 A;  1P3O D;  1KX3 B;  1EQZ C;  3REL D;  3AZM C;  5CP6 B;  3IP4 C;  5AY8 A;  3C1B B;  1P3F A;  1ZLA A;  3W98 C;  1M18 D;  3AZI A;  3KUY C;  2F2A C;  2PYO B;  5BNX B;  3FDD A;  5B32 D;  5AV8 D;  4YS3 D;  3LZ0 D;  3AZG B;  3B6G B;  4J8W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...