3AZLD

Crystal structure of human nucleosome core particle containing h4k77q mutation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Histone H3.1
total genus 37
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azlD00
3AZLA 3AZJB 3LELA 3KUYA 3UTBD 3WA9C 3X1TD 3MGSA 4H9NA 5FUGA 5B0ZC 1U35C 4LD9B 1P3MB 4KUDC 4J8WA 2HUEB 1TZYB 3X1TA 2HIOB 5DNNA 3X1UD 2NQBC 4XUJB 3AZNA 1AOIB 3AZMD 3VH5T 5GXQC 5KDMA 1P3BC 3MNND 5GT0B 2F8ND 3AV2B 5CPKC 5BT1D 3LZ1B 4R8PB 3MGQB 3B6FA 5B24B 4JJNA 3AZGD 2YFVB 3MNNA 5AV8C 4ZUXA 1P3LB 1EQZA 1M1AA 1P3GC 4J8VA 5B0YB 5B2IC 3AZGA 3UTAB 1JFIB 5F99C 2YFWB 3RELD 1P3KA 3W99B 4E45A 3W98C 5BNVA 5B0ZB 4LD9C 3KXBA 2FJ7A 5B40C 2PYOC 5AV6B 3AV2C 3AZFD 2JSSA 1ID3B 3X1SA 3W98B 5GXQB 3R45A 3LELB 3KUYB 3UTBC 1P3IB 3WKJC 5F99A 3AZGC 5AY8A 1N1JB 1HQ3B 2RVQD 2HIOA 2AROC 5AY8C 1M1AC 3AZID 4WU8D 2LY8A 4Z2MH 1U35B 4YM6C 4X23D 3C1CA 1M19C 1F66C 4JJNC 4Z5TD 1KX5A 5CP6B 1P3IC 1P3PB 1P3OD 3RELC 1WWSA 1ZLAB 4KGCC 5GSUA 5AVBA 3AZJC 3AV2A 5B40A 2PYOA 3KXBC 4R8PA 3MGQA 2FJ7C 5AV5B 3X1UB 5CPJA 1AOID 5GSUD 5CPIC 2YFVA 4ZUXB 1P34D 5B31B 3WA9D 5B40D 1S32D 2PYOD 3W96D 4ZBJB 1R4VA 5DNNB 4CSRA 4J8VC 5CPIB 2F8NA 3UTAA 1P3OC 4J8UC 5B33D 5KDMB 3W99A 3B6FD 4EO5B 3WA9A 1P3LD 5JRGA 1F66D 5BS7C 5G49B 5B2JB 3X1VB 3REKB 2NZDC 5E5AA 4EO5C 1P3PC 1P3LA 4WU9A 5GXQA 3VH5W 4YM6B 1KX3D 2CWEA 4KGCA 3VH6W 3KSYA 5B0ZD 3RELA 5AV6D 1TAFA 3C1CC 1P3KB 1M19A 3AZFB 5B0YC 1KX3A 4KGCD 3REHA 3B6GA 3KXBB 2FJ7B 3X1SD 3AYWD 5AV9A 4X23C 3AN2A 1M19D 3WAAD 1P3MC 1ID3A 5GT3B 1KX5B 2F8NH 2L5AA 2AROD 1HQ3D 4KHAB 3KWQB 3W96C 5AVBB 1S32C 5B2ID 3AZKC 3V9RA 3AN2D 3WAAA 3REJC 2NQBB 5AV8D 4NE6A 4H9QB 1P3PD 3AZND 3MVDB 3MVDC 4G92B 1TZYC 4NE3A 3C1BC 3B0DC 3X1TB 1P3PA 4LD9D 1ZLAA 1KX4A 3MGRD 5GSUB 5CPKB 1M1AD 3X1UC 1TZYD 2CV5B 5DNMA 1M18D 5B2JC 3X1VC 3AZEC 5CPID 3MGRA 4YS3D 3MGSB 3C1BB 5B33B 3O62B 3LZ0A 3AZMB 1F66B 3AN2C 4Z66C 1M18C 5CPIA 3MNNB 5AV9C 2F8NB 4NFTA 4ZBJC 3B0CT 3LZ1D 3AZFA 2F8NK 2F8NG 3WTPC 3NQJB 3REJB 2IO5B 5E5AD 4Z66B 4YM6D 3LJAA 3VH5A 2BYMA 2YFWA 3MGPA 5AV5C 5CHLB 4HGAC 5BNVB 5B0ZA 2BYKB 5B0YD 4YM6A 3LJAC 5B1MB 3AFAA 4XUJC 1P3AA 4J8XA 3RELB 2CV5C 4WNNA 4KUDD 3X1SB 1EQZB 3AZLC 1M19B 3REHD 3AZHB 5GT3D 1KX5D 2AROB 3W99C 3LZ0C 5BT1C 5B32G 1P3OA 1ID3D 5AVBD 5B2IB 1Q9CA 3AN2B 4CAYA 3LELD 3KUYD 1HQ3A 3WTPD 5BO0B 4Z2MG 5B33C 5DNMC 3A6NA 4G91C 3KWQA 4J8WD 4QLCD 3TU4D 3MVDD 5CPJC 3W98A 1KX4C 3R45B 1ZLAC 4R8PC 3MGQC 3KWQC 1H3OB 3A6NC 3AZIB 3W97A 5GT0C 1P3FA 5GSUC 5GT3C 2IO5C 3MVDA 4Z5TB 5AY8B 5CP6D 3AZLD 5JRGD 3LZ0B 3AZMA 1ZLAD 1F66A 2CV5D 4ZUXC 1P3FD 1M18B 4G92C 4YS3B 5DNMD 3MGSD 3C1CB 3AYWC 3C1BD 3NQJA 4CSRB 4WU9D 4JJND 3O62D 5CPKA 2CV5A 1P3BA 1P3FC 5C3IB 4H9RB 4ZUXD 3AFAC 1P34B 3MGPB 3WA9B 3REID 1S32B 3W96B 1P3LC 5AV5A 5C3IC 3AFAB 5CPJB 4J8XB 3REJD 5E5AB 4Z66D 3B0BA 3X1TC 3B0DB 5B31A 5B1LB 3B0CW 3REIC 3LJAD 1BH9A 3WKJB 4Z66A 3O62C 2BYMB 5B2IA 3LELC 3KUYC 4J8UD 1KX3B 4KUDB 1EQZD 3AZEB 2NZDA 1P3AD 3REHB 3UT9D 4H9OB 5BS7A 3MGRC 3LZ1C 3AZHD 5B2JA 3X1VA 5AV8A 5B32D 3REKA 5F99D 5JRGC 3AV1A 4J8UA 4WNNB 3REKC 4DRAA 1AOIC 1F1EA 4KHAA 3AZHA 3AZIA 4UUZA 3AYWB 3W97B 3V9RB 3WAAB 1KX4D 1TAFB 5BNXA 3WTPA 4J8WB 4AWLC 4QLCB 3TU4C 2NQBA 3A6ND 5DNNC 3KWQD 1M18A 3WTPE 3TU4A 5B31C 5AV9B 4DRBA 4H9PA 4QLCC 5AVBC 3AZJA 1P3MD 4XZQA 2NQBD 3AZNB 2RVQC 1AOIA 1P3BB 1KX5C 1P34C 5B1MC 5JA4A 3MGSC 1P3FB 1P3GD 1HTAA 4WU8A 1ID3C 1P3MA 5DNMB 3LZ1A 4X23A 3C1CD 5AV6C 5AVCA 4JJNB 3MGRB 3REHC 3C1BA 5CPKD 1M1AB 3O62A 5GT0D 4E44A 4H9SA 3AV2D 5AVCD 3UTBA 4R8PD 3MGQD 3REIA 3AFAD 3VH6T 4J8XD 4H9SC 5GT0A 3W97C 4WU9C 2NZDB 3REJA 3LJAB 5E5AC 3AZKA 5B24A 5AV6A 5AVCC 3UTAD 3AV1B 4NE5A 3W99D 5B33A 5B1LA 3B6GD 5B1MA 1B67A 3AZKD 1P3AB 4J8VB 3AYWA 5B32B 5F99B 3UT9A 1BH8A 4QLCA 3MNNC 5B1MD 3W98D 5B32C 3NQUB 4J8XC 1P3AC 4XZQB 5CP6A 2BYKA 5BO0A 4HGAB 3AZNC 3A6NB 3AZIC 4WV4B 4UUZB 1P3IA 3MGPC 1A7WA 4WU8B 5AV9D 1U35D 3WTPB 5BNXB 4X23B 1N1JA 1H3OA 1ULYA 1HQ3C 2AROA 3UTAC 1P3OB 1P3BD 5FUGB 4J8WC 4AWLB 3TU4B 3AZJD 1U35A 1P3GB 4H9PB 5B1LC 4CAYB 3UTBB 2HUEC 5AV5D 4WZSB 1WWIA 5B24C 5JA4B 5AY8D 3AZLB 5JRGB 3LZ0D 3X1SC 5B31D 4XUJA 5B40B 2PYOB 2HIOD 1BFMA 5DNND 3X1UA 5AVCB 3VH6A 4H9NB 4LD9A 4G91B 4WU9B 4Z5TA 4XUJD 3B6FB 5CP6C 2NZDD 1TZYA 3MGPD 2HIOC 1B6WA 3AZFC 3REIB 5B2JD 3X1VD 5B32A 3REKD 4YS3A 1BH8B 3AV1D 5B24D 5CPJD 4WU8C 3WKJA 3UT9C 3AZGB 3B6GB 3AZKB 4J8VD 5G49A 3AZMC 4H9RA 1P34A 3WAAC 3B6FC 5B1LD 3W96A 1S32A 3AZEA 4XZQC 5GT3A 1P3KD 3WKJD 4KGCB 4M6BA 3KXBD 4J8UB 2FJ7D 4YS3C 3AZED 3UT9B 3B6GC 1BH9B 4XZQD 1P3KC 5B0YA 1KX3C 4H9QA 1JFIA 4Z5TC 3AZHC 1KU5A 5GXQD 1P3GA 3NQUA 4KUDA 1EQZC 4H9OA 3W97D 3AV1C 1P3ID 5AV8B 1KX4B 5B31G
chains in the Genus database with same CATH superfamily
3AZLA 3AZJB 3LELA 3KUYA 3EPJA 3UTBD 2Y2KA 3WA9C 3X1TD 3MGSA 4H9NA 5FUGA 5B0ZC 1U35C 4LD9B 1P3MB 4KUDC 4J8WA 2HUEB 2Y2MA 1TZYB 3X1TA 2HIOB 2ZY2A 5DNNA 3X1UD 2NQBC 4XUJB 3AZNA 1AOIB 3AZMD 3VH5T 5GXQC 5KDMA 1P3BC 3MNND 5GT0B 2F8ND 3AV2B 5CPKC 5BT1D 3LZ1B 4R8PB 3MGQB 3B6FA 5B24B 4JJNA 3AZGD 2YFVB 3MNNA 5AV8C 4ZUXA 1P3LB 1EQZA 1M1AA 1P3GC 4J8VA 5B0YB 5B2IC 3AZGA 3UTAB 1JFIB 5F99C 2YFWB 3RELD 1P3KA 3W99B 4E45A 3W98C 5BNVA 5B0ZB 4LD9C 3KXBA 2FJ7A 5B40C 2PYOC 5AV6B 3AV2C 3AZFD 2JSSA 1ID3B 3X1SA 3W98B 5GXQB 3R45A 3LELB 3KUYB 3UTBC 1P3IB 3WKJC 5F99A 3AZGC 5AY8A 1W2EA 1N1JB 1HQ3B 2RVQD 2HIOA 2AROC 5AY8C 1M1AC 3AZID 4WU8D 2LY8A 4Z2MH 1U35B 4YM6C 4X23D 3C1CA 1M19C 1F66C 4JJNC 4Z5TD 1KX5A 5CP6B 1P3IC 1P3PB 1P3OD 3RELC 1WWSA 1ZLAB 4KGCC 5GSUA 5AVBA 3AZJC 3AV2A 5B40A 2PYOA 3KXBC 4R8PA 3MGQA 2FJ7C 5AV5B 3X1UB 5CPJA 1AOID 5GSUD 5CPIC 2YFVA 4ZUXB 1P34D 5B31B 3WA9D 5B40D 1S32D 2PYOD 3W96D 4ZBJB 1R4VA 5DNNB 4CSRA 4J8VC 2DQNC 5CPIB 2F8NA 3UTAA 1P3OC 4J8UC 5B33D 5KDMB 3W99A 3B6FD 4EO5B 3WA9A 1P3LD 5JRGA 1F66D 5BS7C 5G49B 5B2JB 3X1VB 3REKB 2NZDC 5E5AA 4EO5C 1P3PC 1P3LA 4WU9A 5GXQA 3VH5W 4YM6B 1KX3D 2CWEA 4KGCA 3VH6W 3KSYA 5B0ZD 3RELA 5AV6D 1TAFA 3C1CC 1P3KB 1M19A 3AZFB 5B0YC 1KX3A 4KGCD 3REHA 3B6GA 3P5JB 2J8PA 3KXBB 2FJ7B 3X1SD 3AYWD 5AV9A 4X23C 3AN2A 1M19D 3WAAD 1P3MC 1ID3A 5GT3B 1KX5B 2F8NH 2L5AA 2AROD 1HQ3D 4KHAB 3KWQB 3W96C 5AVBB 1S32C 5B2ID 3AZKC 3V9RA 3AN2D 3WAAA 3REJC 2NQBB 5AV8D 4NE6A 4H9QB 1P3PD 3AZND 3MVDB 3H0LC 3MVDC 4G92B 3H0MC 1TZYC 4NE3A 3C1BC 3B0DC 3X1TB 1P3PA 4LD9D 1ZLAA 1KX4A 2F2AC 3MGRD 5GSUB 5CPKB 1M1AD 3X1UC 3H0RC 1TZYD 2CV5B 5DNMA 1M18D 2ZY4A 5B2JC 3X1VC 3AZEC 5CPID 3MGRA 4YS3D 3MGSB 3C1BB 3IP4C 5B33B 3O62B 3LZ0A 3AZMB 1F66B 3AN2C 4Z66C 1M18C 5CPIA 3MNNB 5AV9C 2F8NB 4NFTA 4ZBJC 3B0CT 3LZ1D 3AZFA 2F8NK 2F8NG 3FDDA 3WTPC 3NQJB 3EPHA 3REJB 2IO5B 5E5AD 4Z66B 4YM6D 3LJAA 3VH5A 2BYMA 2YFWA 3MGPA 5AV5C 5CHLB 4HGAC 5BNVB 5B0ZA 2BYKB 5B0YD 4YM6A 2FFFB 5B1MB 3LJAC 3AFAA 4XUJC 1P3AA 4J8XA 3RELB 2CV5C 4WNNA 4KUDD 3X1SB 1EQZB 3AZLC 1M19B 3REHD 3AZHB 5GT3D 1KX5D 2AROB 3W99C 3LZ0C 5BT1C 5B32G 1P3OA 2BG1A 1ID3D 5AVBD 5B2IB 1Q9CA 3AN2B 4CAYA 3LELD 3KUYD 1HQ3A 3WTPD 5BO0B 4Z2MG 5B33C 5DNMC 3A6NA 4G91C 3KWQA 4J8WD 4QLCD 3TU4D 3MVDD 5CPJC 3W98A 1KX4C 3R45B 1ZLAC 4R8PC 3MGQC 3KWQC 1H3OB 3A6NC 3AZIB 3W97A 5GT0C 1P3FA 4UPKA 5GSUC 5GT3C 2IO5C 3MVDA 4Z5TB 5AY8B 5CP6D 3AZLD 5JRGD 3LZ0B 3AZMA 1ZLAD 1F66A 2DF4C 4ZUXC 2CV5D 1P3FD 1M18B 4G92C 4DQYB 4YS3B 5DNMD 3MGSD 3C1CB 3AYWC 3C1BD 1T3UA 3NQJA 4CSRB 4WU9D 3O62D 4JJND 5CPKA 2CV5A 1P3BA 1P3FC 5C3IB 4H9RB 4ZUXD 3AFAC 1P34B 3MGPB 3WA9B 3REID 1S32B 3W96B 2UWXA 1P3LC 5AV5A 3EPLA 5C3IC 3AFAB 5CPJB 4J8XB 3REJD 5E5AB 4Z66D 3B0BA 3X1TC 3B0DB 5B31A 5B1LB 3B0CW 3REIC 3LJAD 1BH9A 4WJ3C 3WKJB 4Z66A 3O62C 2BYMB 5B2IA 3LELC 3KUYC 4J8UD 1KX3B 4KUDB 1EQZD 3AZEB 2NZDA 1P3AD 3REHB 2Y2PA 4H9OB 5BS7A 3MGRC 3UT9D 3LZ1C 2XD5A 3AZHD 5B2JA 3X1VA 5AV8A 5B32D 3REKA 5F99D 5JRGC 3AV1A 4J8UA 2Y2OA 4WNNB 3REKC 4DRAA 1AOIC 1F1EA 2G5HC 4KHAA 3AZHA 3AZIA 4UUZA 3AYWB 3W97B 3V9RB 2VQRA 3WAAB 1KX4D 1TAFB 5BNXA 3WTPA 4J8WB 4AWLC 4QLCB 3TU4C 2NQBA 3A6ND 5DNNC 3KWQD 1M18A 3WTPE 3TU4A 5B31C 5AV9B 4DRBA 4H9PA 4QLCC 5AVBC 3AZJA 1P3MD 4XZQA 2NQBD 1PZRA 3AZNB 2RVQC 1AOIA 1P3BB 1KX5C 1P34C 5B1MC 5JA4A 3MGSC 1P3FB 1P3GD 1HTAA 2Y2IA 4WU8A 2Y2QA 1ID3C 1P3MA 5DNMB 3LZ1A 4X23A 3C1CD 5AV6C 5AVCA 4JJNB 3MGRB 3REHC 2Y2HA 3C1BA 5CPKD 1M1AB 3O62A 5GT0D 4E44A 4H9SA 3AV2D 5AVCD 3UTBA 4R8PD 3MGQD 3REIA 3AFAD 3VH6T 4J8XD 4H9SC 5GT0A 3W97C 4WU9C 2NZDB 3REJA 3LJAB 5E5AC 3AZKA 5B24A 5AV6A 5AVCC 3UTAD 3AV1B 4NE5A 3W99D 5B33A 5B1LA 3F6TA 3B6GD 5B1MA 1B67A 3AZKD 1P3AB 4J8VB 3AYWA 5B32B 5F99B 3UT9A 1BH8A 4QLCA 3MNNC 5B1MD 3W98D 3A1KA 5B32C 2W8SA 3NQUB 4J8XC 1P3AC 4XZQB 5CP6A 2BYKA 5BO0A 4HGAB 3AZNC 3A6NB 3AZIC 4WV4B 4UUZB 1P3IA 3MGPC 1A7WA 4WU8B 5AV9D 1U35D 3WTPB 5BNXB 4X23B 1N1JA 1H3OA 1ULYA 1HQ3C 2AROA 3UTAC 1P3OB 1P3BD 5FUGB 4J8WC 4AWLB 3TU4B 3AZJD 1U35A 1P3GB 4H9PB 5B1LC 4CAYB 3KFUG 3UTBB 2HUEC 5AV5D 4WZSB 1WWIA 5B24C 5JA4B 5AY8D 3AZLB 5JRGB 3LZ0D 3X1SC 5B31D 4XUJA 2Y2JA 5B40B 2PYOB 2HIOD 1BFMA 3X1UA 5DNND 5AVCB 3VH6A 4H9NB 4LD9A 4G91B 4WU9B 4Z5TA 4XUJD 3B6FB 2G5IC 5CP6C 2NZDD 1TZYA 3AL0C 2RIQA 3MGPD 2Y2NA 2HIOC 1B6WA 3AZFC 3REIB 5B2JD 3X1VD 3EG5B 5B32A 3REKD 4YS3A 2Y2LA 1BH8B 3AV1D 5B24D 5CPJD 4WU8C 3WKJA 3A1IA 3UT9C 3AZGB 3B6GB 3AZKB 4J8VD 5G49A 3AZMC 4H9RA 1P34A 3WAAC 3B6FC 5B1LD 3W96A 2Y2GA 1S32A 3AZEA 2ZY5A 4XZQC 5GT3A 1P3KD 1Z2CB 2ZY3A 3WKJD 4KGCB 2JE5A 4M6BA 3KXBD 4J8UB 2FJ7D 4YS3C 3AZED 3UT9B 3B6GC 1BH9B 2XD1A 4XZQD 1P3KC 5B0YA 1KX3C 4H9QA 2JCHA 1JFIA 3EPKA 4Z5TC 2ZM5A 3AZHC 1KU5A 5GXQD 1P3GA 3NQUA 4KUDA 1EQZC 4H9OA 3W97D 3AV1C 1P3ID 5AV8B 1KX4B 5B31G
chains in the Genus database with same CATH topology
3AZLA 3AZJB 3LELA 3KUYA 3EPJA 3UTBD 2Y2KA 3WA9C 3X1TD 3MGSA 4H9NA 5FUGA 5B0ZC 1U35C 4LD9B 1P3MB 4KUDC 4J8WA 2HUEB 2Y2MA 1TZYB 3X1TA 2HIOB 2ZY2A 5DNNA 3X1UD 2NQBC 4XUJB 3AZNA 1AOIB 3AZMD 3VH5T 5GXQC 5KDMA 1P3BC 3MNND 5GT0B 2F8ND 3AV2B 5CPKC 5BT1D 3LZ1B 4R8PB 3MGQB 3B6FA 5B24B 4JJNA 3AZGD 2YFVB 3MNNA 5AV8C 4ZUXA 1P3LB 1EQZA 1M1AA 1P3GC 4J8VA 5B0YB 5B2IC 3AZGA 3UTAB 1JFIB 5F99C 2YFWB 3RELD 1P3KA 3W99B 4E45A 3W98C 5BNVA 5B0ZB 4LD9C 3KXBA 2FJ7A 5B40C 2PYOC 5AV6B 3AV2C 3AZFD 2JSSA 1ID3B 3X1SA 3W98B 5GXQB 3R45A 3LELB 3KUYB 3UTBC 1P3IB 3WKJC 5F99A 3AZGC 5AY8A 1W2EA 1N1JB 1HQ3B 2RVQD 2HIOA 2AROC 5AY8C 1M1AC 3AZID 4WU8D 2LY8A 4Z2MH 1U35B 4YM6C 4X23D 3C1CA 1M19C 1F66C 4JJNC 4Z5TD 1KX5A 5CP6B 1P3IC 1P3PB 1P3OD 3RELC 1WWSA 1ZLAB 4KGCC 5GSUA 5AVBA 3AZJC 3AV2A 5B40A 2PYOA 3KXBC 4R8PA 3MGQA 2FJ7C 5AV5B 3X1UB 5CPJA 1AOID 5GSUD 5CPIC 2YFVA 4ZUXB 1P34D 5B31B 3WA9D 5B40D 1S32D 2PYOD 3W96D 4ZBJB 1R4VA 5DNNB 4CSRA 4J8VC 2DQNC 5CPIB 2F8NA 3UTAA 1P3OC 4J8UC 5B33D 5KDMB 3W99A 3B6FD 4EO5B 3WA9A 1P3LD 5JRGA 1F66D 5BS7C 5G49B 5B2JB 3X1VB 3REKB 2NZDC 5E5AA 4EO5C 1P3PC 1P3LA 4WU9A 5GXQA 3VH5W 4YM6B 1KX3D 2CWEA 4KGCA 3VH6W 3KSYA 5B0ZD 3RELA 5AV6D 1TAFA 3C1CC 1P3KB 1M19A 3AZFB 5B0YC 1KX3A 4KGCD 3REHA 3B6GA 3P5JB 2J8PA 3KXBB 2FJ7B 3X1SD 3AYWD 5AV9A 4X23C 3AN2A 1M19D 3WAAD 1P3MC 1ID3A 5GT3B 1KX5B 2F8NH 2L5AA 2AROD 1HQ3D 4KHAB 3KWQB 3W96C 5AVBB 1S32C 5B2ID 3AZKC 3V9RA 3AN2D 3WAAA 3REJC 2NQBB 5AV8D 4NE6A 4H9QB 1P3PD 3AZND 3MVDB 3H0LC 3MVDC 4G92B 3H0MC 1TZYC 4NE3A 3C1BC 3B0DC 3X1TB 1P3PA 4LD9D 1ZLAA 1KX4A 2F2AC 3MGRD 5GSUB 5CPKB 1M1AD 3X1UC 3H0RC 1TZYD 2CV5B 5DNMA 1M18D 2ZY4A 5B2JC 3X1VC 3AZEC 5CPID 3MGRA 4YS3D 3MGSB 3C1BB 3IP4C 5B33B 3O62B 3LZ0A 3AZMB 1F66B 3AN2C 4Z66C 1M18C 5CPIA 3MNNB 5AV9C 2F8NB 4NFTA 4ZBJC 3B0CT 3LZ1D 3AZFA 2F8NK 2F8NG 3FDDA 3WTPC 3NQJB 3EPHA 3REJB 2IO5B 5E5AD 4Z66B 4YM6D 3LJAA 3VH5A 2BYMA 2YFWA 3MGPA 5AV5C 5CHLB 4HGAC 5BNVB 5B0ZA 2BYKB 5B0YD 4YM6A 2FFFB 5B1MB 3LJAC 3AFAA 4XUJC 1P3AA 4J8XA 3RELB 2CV5C 4WNNA 4KUDD 3X1SB 1EQZB 3AZLC 1M19B 3REHD 3AZHB 5GT3D 1KX5D 2AROB 3W99C 3LZ0C 5BT1C 5B32G 1P3OA 2BG1A 1ID3D 5AVBD 5B2IB 1Q9CA 3AN2B 4CAYA 3LELD 3KUYD 1HQ3A 3WTPD 5BO0B 4Z2MG 5B33C 5DNMC 3A6NA 4G91C 3KWQA 4J8WD 4QLCD 3TU4D 3MVDD 5CPJC 3W98A 1KX4C 3R45B 1ZLAC 4R8PC 3MGQC 3KWQC 1H3OB 3A6NC 3AZIB 3W97A 5GT0C 1P3FA 4UPKA 5GSUC 5GT3C 2IO5C 3MVDA 4Z5TB 5AY8B 5CP6D 3AZLD 5JRGD 3LZ0B 3AZMA 1ZLAD 1F66A 2DF4C 4ZUXC 2CV5D 1P3FD 1M18B 4G92C 4DQYB 4YS3B 5DNMD 3MGSD 3C1CB 3AYWC 3C1BD 1T3UA 3NQJA 4CSRB 4WU9D 3O62D 4JJND 5CPKA 2CV5A 1P3BA 1P3FC 5C3IB 4H9RB 4ZUXD 3AFAC 1P34B 3MGPB 3WA9B 3REID 1S32B 3W96B 2UWXA 1P3LC 5AV5A 3EPLA 5C3IC 3AFAB 5CPJB 4J8XB 3REJD 5E5AB 4Z66D 3B0BA 3X1TC 3B0DB 5B31A 5B1LB 3B0CW 3REIC 3LJAD 1BH9A 4WJ3C 3WKJB 4Z66A 3O62C 2BYMB 5B2IA 3LELC 3KUYC 4J8UD 1KX3B 4KUDB 1EQZD 3AZEB 2NZDA 1P3AD 3REHB 2Y2PA 4H9OB 5BS7A 3MGRC 3UT9D 3LZ1C 2XD5A 3AZHD 5B2JA 3X1VA 5AV8A 5B32D 3REKA 5F99D 5JRGC 3AV1A 4J8UA 2Y2OA 4WNNB 3REKC 4DRAA 1AOIC 1F1EA 2G5HC 4KHAA 3AZHA 3AZIA 4UUZA 3AYWB 3W97B 3V9RB 2VQRA 3WAAB 1KX4D 1TAFB 5BNXA 3WTPA 4J8WB 4AWLC 4QLCB 3TU4C 2NQBA 3A6ND 5DNNC 3KWQD 1M18A 3WTPE 3TU4A 5B31C 5AV9B 4DRBA 4H9PA 4QLCC 5AVBC 3AZJA 1P3MD 4XZQA 2NQBD 1PZRA 3AZNB 2RVQC 1AOIA 1P3BB 1KX5C 1P34C 5B1MC 5JA4A 3MGSC 1P3FB 1P3GD 1HTAA 2Y2IA 4WU8A 2Y2QA 1ID3C 1P3MA 5DNMB 3LZ1A 4X23A 3C1CD 5AV6C 5AVCA 4JJNB 3MGRB 3REHC 2Y2HA 3C1BA 5CPKD 1M1AB 3O62A 5GT0D 4E44A 4H9SA 3AV2D 5AVCD 3UTBA 4R8PD 3MGQD 3REIA 3AFAD 3VH6T 4J8XD 4H9SC 5GT0A 3W97C 4WU9C 2NZDB 3REJA 3LJAB 5E5AC 3AZKA 5B24A 5AV6A 5AVCC 3UTAD 3AV1B 4NE5A 3W99D 5B33A 5B1LA 3F6TA 3B6GD 5B1MA 1B67A 3AZKD 1P3AB 4J8VB 3AYWA 5B32B 5F99B 3UT9A 1BH8A 4QLCA 3MNNC 5B1MD 3W98D 3A1KA 5B32C 2W8SA 3NQUB 4J8XC 1P3AC 4XZQB 5CP6A 2BYKA 5BO0A 4HGAB 3AZNC 3A6NB 3AZIC 4WV4B 4UUZB 1P3IA 3MGPC 1A7WA 4WU8B 5AV9D 1U35D 3WTPB 5BNXB 4X23B 1N1JA 1H3OA 1ULYA 1HQ3C 2AROA 3UTAC 1P3OB 1P3BD 5FUGB 4J8WC 4AWLB 3TU4B 3AZJD 1U35A 1P3GB 4H9PB 5B1LC 4CAYB 3KFUG 3UTBB 2HUEC 5AV5D 4WZSB 1WWIA 5B24C 5JA4B 5AY8D 3AZLB 5JRGB 3LZ0D 3X1SC 5B31D 4XUJA 2Y2JA 5B40B 2PYOB 2HIOD 1BFMA 3X1UA 5DNND 5AVCB 3VH6A 4H9NB 4LD9A 4G91B 4WU9B 4Z5TA 4XUJD 3B6FB 2G5IC 5CP6C 2NZDD 1TZYA 3AL0C 2RIQA 3MGPD 2Y2NA 2HIOC 1B6WA 3AZFC 3REIB 5B2JD 3X1VD 3EG5B 5B32A 3REKD 4YS3A 2Y2LA 1BH8B 3AV1D 5B24D 5CPJD 4WU8C 3WKJA 3A1IA 3UT9C 3AZGB 3B6GB 3AZKB 4J8VD 5G49A 3AZMC 4H9RA 1P34A 3WAAC 3B6FC 5B1LD 3W96A 2Y2GA 1S32A 3AZEA 2ZY5A 4XZQC 5GT3A 1P3KD 1Z2CB 2ZY3A 3WKJD 4KGCB 2JE5A 4M6BA 3KXBD 4J8UB 2FJ7D 4YS3C 3AZED 3UT9B 3B6GC 1BH9B 2XD1A 4XZQD 1P3KC 5B0YA 1KX3C 4H9QA 2JCHA 1JFIA 3EPKA 4Z5TC 2ZM5A 3AZHC 1KU5A 5GXQD 1P3GA 3NQUA 4KUDA 1EQZC 4H9OA 3W97D 3AV1C 1P3ID 5AV8B 1KX4B 5B31G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZL A;  3AZJ B;  3LEL A;  3KUY A;  3UTB D;  3WA9 C;  3X1T D;  3MGS A;  4H9N A;  5FUG A;  5B0Z C;  1U35 C;  4LD9 B;  1P3M B;  4KUD C;  4J8W A;  2HUE B;  1TZY B;  3X1T A;  2HIO B;  5DNN A;  3X1U D;  2NQB C;  4XUJ B;  3AZN A;  1AOI B;  3AZM D;  3VH5 T;  5GXQ C;  5KDM A;  1P3B C;  3MNN D;  5GT0 B;  2F8N D;  3AV2 B;  5CPK C;  5BT1 D;  3LZ1 B;  4R8P B;  3MGQ B;  3B6F A;  5B24 B;  4JJN A;  3AZG D;  2YFV B;  3MNN A;  5AV8 C;  4ZUX A;  1P3L B;  1EQZ A;  1M1A A;  1P3G C;  4J8V A;  5B0Y B;  5B2I C;  3AZG A;  3UTA B;  1JFI B;  5F99 C;  2YFW B;  3REL D;  1P3K A;  3W99 B;  4E45 A;  3W98 C;  5BNV A;  5B0Z B;  4LD9 C;  3KXB A;  2FJ7 A;  5B40 C;  2PYO C;  5AV6 B;  3AV2 C;  3AZF D;  2JSS A;  1ID3 B;  3X1S A;  3W98 B;  5GXQ B;  3R45 A;  3LEL B;  3KUY B;  3UTB C;  1P3I B;  3WKJ C;  5F99 A;  3AZG C;  5AY8 A;  1N1J B;  1HQ3 B;  2RVQ D;  2HIO A;  2ARO C;  5AY8 C;  1M1A C;  3AZI D;  4WU8 D;  2LY8 A;  4Z2M H;  1U35 B;  4YM6 C;  4X23 D;  3C1C A;  1M19 C;  1F66 C;  4JJN C;  4Z5T D;  1KX5 A;  5CP6 B;  1P3I C;  1P3P B;  1P3O D;  3REL C;  1WWS A;  1ZLA B;  4KGC C;  5GSU A;  5AVB A;  3AZJ C;  3AV2 A;  5B40 A;  2PYO A;  3KXB C;  4R8P A;  3MGQ A;  2FJ7 C;  5AV5 B;  3X1U B;  5CPJ A;  1AOI D;  5GSU D;  5CPI C;  2YFV A;  4ZUX B;  1P34 D;  5B31 B;  3WA9 D;  5B40 D;  1S32 D;  2PYO D;  3W96 D;  4ZBJ B;  1R4V A;  5DNN B;  4CSR A;  4J8V C;  5CPI B;  2F8N A;  3UTA A;  1P3O C;  4J8U C;  5B33 D;  5KDM B;  3W99 A;  3B6F D;  4EO5 B;  3WA9 A;  1P3L D;  5JRG A;  1F66 D;  5BS7 C;  5G49 B;  5B2J B;  3X1V B;  3REK B;  2NZD C;  5E5A A;  4EO5 C;  1P3P C;  1P3L A;  4WU9 A;  5GXQ A;  3VH5 W;  4YM6 B;  1KX3 D;  2CWE A;  4KGC A;  3VH6 W;  3KSY A;  5B0Z D;  3REL A;  5AV6 D;  1TAF A;  3C1C C;  1P3K B;  1M19 A;  3AZF B;  5B0Y C;  1KX3 A;  4KGC D;  3REH A;  3B6G A;  3KXB B;  2FJ7 B;  3X1S D;  3AYW D;  5AV9 A;  4X23 C;  3AN2 A;  1M19 D;  3WAA D;  1P3M C;  1ID3 A;  5GT3 B;  1KX5 B;  2F8N H;  2L5A A;  2ARO D;  1HQ3 D;  4KHA B;  3KWQ B;  3W96 C;  5AVB B;  1S32 C;  5B2I D;  3AZK C;  3V9R A;  3AN2 D;  3WAA A;  3REJ C;  2NQB B;  5AV8 D;  4NE6 A;  4H9Q B;  1P3P D;  3AZN D;  3MVD B;  3MVD C;  4G92 B;  1TZY C;  4NE3 A;  3C1B C;  3B0D C;  3X1T B;  1P3P A;  4LD9 D;  1ZLA A;  1KX4 A;  3MGR D;  5GSU B;  5CPK B;  1M1A D;  3X1U C;  1TZY D;  2CV5 B;  5DNM A;  1M18 D;  5B2J C;  3X1V C;  3AZE C;  5CPI D;  3MGR A;  4YS3 D;  3MGS B;  3C1B B;  5B33 B;  3O62 B;  3LZ0 A;  3AZM B;  1F66 B;  3AN2 C;  4Z66 C;  1M18 C;  5CPI A;  3MNN B;  5AV9 C;  2F8N B;  4NFT A;  4ZBJ C;  3B0C T;  3LZ1 D;  3AZF A;  2F8N K;  2F8N G;  3WTP C;  3NQJ B;  3REJ B;  2IO5 B;  5E5A D;  4Z66 B;  4YM6 D;  3LJA A;  3VH5 A;  2BYM A;  2YFW A;  3MGP A;  5AV5 C;  5CHL B;  4HGA C;  5BNV B;  5B0Z A;  2BYK B;  5B0Y D;  4YM6 A;  3LJA C;  5B1M B;  3AFA A;  4XUJ C;  1P3A A;  4J8X A;  3REL B;  2CV5 C;  4WNN A;  4KUD D;  3X1S B;  1EQZ B;  3AZL C;  1M19 B;  3REH D;  3AZH B;  5GT3 D;  1KX5 D;  2ARO B;  3W99 C;  3LZ0 C;  5BT1 C;  5B32 G;  1P3O A;  1ID3 D;  5AVB D;  5B2I B;  1Q9C A;  3AN2 B;  4CAY A;  3LEL D;  3KUY D;  1HQ3 A;  3WTP D;  5BO0 B;  4Z2M G;  5B33 C;  5DNM C;  3A6N A;  4G91 C;  3KWQ A;  4J8W D;  4QLC D;  3TU4 D;  3MVD D;  5CPJ C;  3W98 A;  1KX4 C;  3R45 B;  1ZLA C;  4R8P C;  3MGQ C;  3KWQ C;  1H3O B;  3A6N C;  3AZI B;  3W97 A;  5GT0 C;  1P3F A;  5GSU C;  5GT3 C;  2IO5 C;  3MVD A;  4Z5T B;  5AY8 B;  5CP6 D;  3AZL D;  5JRG D;  3LZ0 B;  3AZM A;  1ZLA D;  1F66 A;  2CV5 D;  4ZUX C;  1P3F D;  1M18 B;  4G92 C;  4YS3 B;  5DNM D;  3MGS D;  3C1C B;  3AYW C;  3C1B D;  3NQJ A;  4CSR B;  4WU9 D;  4JJN D;  3O62 D;  5CPK A;  2CV5 A;  1P3B A;  1P3F C;  5C3I B;  4H9R B;  4ZUX D;  3AFA C;  1P34 B;  3MGP B;  3WA9 B;  3REI D;  1S32 B;  3W96 B;  1P3L C;  5AV5 A;  5C3I C;  3AFA B;  5CPJ B;  4J8X B;  3REJ D;  5E5A B;  4Z66 D;  3B0B A;  3X1T C;  3B0D B;  5B31 A;  5B1L B;  3B0C W;  3REI C;  3LJA D;  1BH9 A;  3WKJ B;  4Z66 A;  3O62 C;  2BYM B;  5B2I A;  3LEL C;  3KUY C;  4J8U D;  1KX3 B;  4KUD B;  1EQZ D;  3AZE B;  2NZD A;  1P3A D;  3REH B;  3UT9 D;  4H9O B;  5BS7 A;  3MGR C;  3LZ1 C;  3AZH D;  5B2J A;  3X1V A;  5AV8 A;  5B32 D;  3REK A;  5F99 D;  5JRG C;  3AV1 A;  4J8U A;  4WNN B;  3REK C;  4DRA A;  1AOI C;  1F1E A;  4KHA A;  3AZH A;  3AZI A;  4UUZ A;  3AYW B;  3W97 B;  3V9R B;  3WAA B;  1KX4 D;  1TAF B;  5BNX A;  3WTP A;  4J8W B;  4AWL C;  4QLC B;  3TU4 C;  2NQB A;  3A6N D;  5DNN C;  3KWQ D;  1M18 A;  3WTP E;  3TU4 A;  5B31 C;  5AV9 B;  4DRB A;  4H9P A;  4QLC C;  5AVB C;  3AZJ A;  1P3M D;  4XZQ A;  2NQB D;  3AZN B;  2RVQ C;  1AOI A;  1P3B B;  1KX5 C;  1P34 C;  5B1M C;  5JA4 A;  3MGS C;  1P3F B;  1P3G D;  1HTA A;  4WU8 A;  1ID3 C;  1P3M A;  5DNM B;  3LZ1 A;  4X23 A;  3C1C D;  5AV6 C;  5AVC A;  4JJN B;  3MGR B;  3REH C;  3C1B A;  5CPK D;  1M1A B;  3O62 A;  5GT0 D;  4E44 A;  4H9S A;  3AV2 D;  5AVC D;  3UTB A;  4R8P D;  3MGQ D;  3REI A;  3AFA D;  3VH6 T;  4J8X D;  4H9S C;  5GT0 A;  3W97 C;  4WU9 C;  2NZD B;  3REJ A;  3LJA B;  5E5A C;  3AZK A;  5B24 A;  5AV6 A;  5AVC C;  3UTA D;  3AV1 B;  4NE5 A;  3W99 D;  5B33 A;  5B1L A;  3B6G D;  5B1M A;  1B67 A;  3AZK D;  1P3A B;  4J8V B;  3AYW A;  5B32 B;  5F99 B;  3UT9 A;  1BH8 A;  4QLC A;  3MNN C;  5B1M D;  3W98 D;  5B32 C;  3NQU B;  4J8X C;  1P3A C;  4XZQ B;  5CP6 A;  2BYK A;  5BO0 A;  4HGA B;  3AZN C;  3A6N B;  3AZI C;  4WV4 B;  4UUZ B;  1P3I A;  3MGP C;  1A7W A;  4WU8 B;  5AV9 D;  1U35 D;  3WTP B;  5BNX B;  4X23 B;  1N1J A;  1H3O A;  1ULY A;  1HQ3 C;  2ARO A;  3UTA C;  1P3O B;  1P3B D;  5FUG B;  4J8W C;  4AWL B;  3TU4 B;  3AZJ D;  1U35 A;  1P3G B;  4H9P B;  5B1L C;  4CAY B;  3UTB B;  2HUE C;  5AV5 D;  4WZS B;  1WWI A;  5B24 C;  5JA4 B;  5AY8 D;  3AZL B;  5JRG B;  3LZ0 D;  3X1S C;  5B31 D;  4XUJ A;  5B40 B;  2PYO B;  2HIO D;  1BFM A;  5DNN D;  3X1U A;  5AVC B;  3VH6 A;  4H9N B;  4LD9 A;  4G91 B;  4WU9 B;  4Z5T A;  4XUJ D;  3B6F B;  5CP6 C;  2NZD D;  1TZY A;  3MGP D;  2HIO C;  1B6W A;  3AZF C;  3REI B;  5B2J D;  3X1V D;  5B32 A;  3REK D;  4YS3 A;  1BH8 B;  3AV1 D;  5B24 D;  5CPJ D;  4WU8 C;  3WKJ A;  3UT9 C;  3AZG B;  3B6G B;  3AZK B;  4J8V D;  5G49 A;  3AZM C;  4H9R A;  1P34 A;  3WAA C;  3B6F C;  5B1L D;  3W96 A;  1S32 A;  3AZE A;  4XZQ C;  5GT3 A;  1P3K D;  3WKJ D;  4KGC B;  4M6B A;  3KXB D;  4J8U B;  2FJ7 D;  4YS3 C;  3AZE D;  3UT9 B;  3B6G C;  1BH9 B;  4XZQ D;  1P3K C;  5B0Y A;  1KX3 C;  4H9Q A;  1JFI A;  4Z5T C;  3AZH C;  1KU5 A;  5GXQ D;  1P3G A;  3NQU A;  4KUD A;  1EQZ C;  4H9O A;  3W97 D;  3AV1 C;  1P3I D;  5AV8 B;  1KX4 B;  5B31 G; 
#chains in the Genus database with same CATH topology
 3AZL A;  3AZJ B;  3LEL A;  3KUY A;  3EPJ A;  3UTB D;  2Y2K A;  3WA9 C;  3X1T D;  3MGS A;  4H9N A;  5FUG A;  5B0Z C;  1U35 C;  4LD9 B;  1P3M B;  4KUD C;  4J8W A;  2HUE B;  2Y2M A;  1TZY B;  3X1T A;  2HIO B;  2ZY2 A;  5DNN A;  3X1U D;  2NQB C;  4XUJ B;  3AZN A;  1AOI B;  3AZM D;  3VH5 T;  5GXQ C;  5KDM A;  1P3B C;  3MNN D;  5GT0 B;  2F8N D;  3AV2 B;  5CPK C;  5BT1 D;  3LZ1 B;  4R8P B;  3MGQ B;  3B6F A;  5B24 B;  4JJN A;  3AZG D;  2YFV B;  3MNN A;  5AV8 C;  4ZUX A;  1P3L B;  1EQZ A;  1M1A A;  1P3G C;  4J8V A;  5B0Y B;  5B2I C;  3AZG A;  3UTA B;  1JFI B;  5F99 C;  2YFW B;  3REL D;  1P3K A;  3W99 B;  4E45 A;  3W98 C;  5BNV A;  5B0Z B;  4LD9 C;  3KXB A;  2FJ7 A;  5B40 C;  2PYO C;  5AV6 B;  3AV2 C;  3AZF D;  2JSS A;  1ID3 B;  3X1S A;  3W98 B;  5GXQ B;  3R45 A;  3LEL B;  3KUY B;  3UTB C;  1P3I B;  3WKJ C;  5F99 A;  3AZG C;  5AY8 A;  1W2E A;  1N1J B;  1HQ3 B;  2RVQ D;  2HIO A;  2ARO C;  5AY8 C;  1M1A C;  3AZI D;  4WU8 D;  2LY8 A;  4Z2M H;  1U35 B;  4YM6 C;  4X23 D;  3C1C A;  1M19 C;  1F66 C;  4JJN C;  4Z5T D;  1KX5 A;  5CP6 B;  1P3I C;  1P3P B;  1P3O D;  3REL C;  1WWS A;  1ZLA B;  4KGC C;  5GSU A;  5AVB A;  3AZJ C;  3AV2 A;  5B40 A;  2PYO A;  3KXB C;  4R8P A;  3MGQ A;  2FJ7 C;  5AV5 B;  3X1U B;  5CPJ A;  1AOI D;  5GSU D;  5CPI C;  2YFV A;  4ZUX B;  1P34 D;  5B31 B;  3WA9 D;  5B40 D;  1S32 D;  2PYO D;  3W96 D;  4ZBJ B;  1R4V A;  5DNN B;  4CSR A;  4J8V C;  2DQN C;  5CPI B;  2F8N A;  3UTA A;  1P3O C;  4J8U C;  5B33 D;  5KDM B;  3W99 A;  3B6F D;  4EO5 B;  3WA9 A;  1P3L D;  5JRG A;  1F66 D;  5BS7 C;  5G49 B;  5B2J B;  3X1V B;  3REK B;  2NZD C;  5E5A A;  4EO5 C;  1P3P C;  1P3L A;  4WU9 A;  5GXQ A;  3VH5 W;  4YM6 B;  1KX3 D;  2CWE A;  4KGC A;  3VH6 W;  3KSY A;  5B0Z D;  3REL A;  5AV6 D;  1TAF A;  3C1C C;  1P3K B;  1M19 A;  3AZF B;  5B0Y C;  1KX3 A;  4KGC D;  3REH A;  3B6G A;  3P5J B;  2J8P A;  3KXB B;  2FJ7 B;  3X1S D;  3AYW D;  5AV9 A;  4X23 C;  3AN2 A;  1M19 D;  3WAA D;  1P3M C;  1ID3 A;  5GT3 B;  1KX5 B;  2F8N H;  2L5A A;  2ARO D;  1HQ3 D;  4KHA B;  3KWQ B;  3W96 C;  5AVB B;  1S32 C;  5B2I D;  3AZK C;  3V9R A;  3AN2 D;  3WAA A;  3REJ C;  2NQB B;  5AV8 D;  4NE6 A;  4H9Q B;  1P3P D;  3AZN D;  3MVD B;  3H0L C;  3MVD C;  4G92 B;  3H0M C;  1TZY C;  4NE3 A;  3C1B C;  3B0D C;  3X1T B;  1P3P A;  4LD9 D;  1ZLA A;  1KX4 A;  2F2A C;  3MGR D;  5GSU B;  5CPK B;  1M1A D;  3X1U C;  3H0R C;  1TZY D;  2CV5 B;  5DNM A;  1M18 D;  2ZY4 A;  5B2J C;  3X1V C;  3AZE C;  5CPI D;  3MGR A;  4YS3 D;  3MGS B;  3C1B B;  3IP4 C;  5B33 B;  3O62 B;  3LZ0 A;  3AZM B;  1F66 B;  3AN2 C;  4Z66 C;  1M18 C;  5CPI A;  3MNN B;  5AV9 C;  2F8N B;  4NFT A;  4ZBJ C;  3B0C T;  3LZ1 D;  3AZF A;  2F8N K;  2F8N G;  3FDD A;  3WTP C;  3NQJ B;  3EPH A;  3REJ B;  2IO5 B;  5E5A D;  4Z66 B;  4YM6 D;  3LJA A;  3VH5 A;  2BYM A;  2YFW A;  3MGP A;  5AV5 C;  5CHL B;  4HGA C;  5BNV B;  5B0Z A;  2BYK B;  5B0Y D;  4YM6 A;  2FFF B;  5B1M B;  3LJA C;  3AFA A;  4XUJ C;  1P3A A;  4J8X A;  3REL B;  2CV5 C;  4WNN A;  4KUD D;  3X1S B;  1EQZ B;  3AZL C;  1M19 B;  3REH D;  3AZH B;  5GT3 D;  1KX5 D;  2ARO B;  3W99 C;  3LZ0 C;  5BT1 C;  5B32 G;  1P3O A;  2BG1 A;  1ID3 D;  5AVB D;  5B2I B;  1Q9C A;  3AN2 B;  4CAY A;  3LEL D;  3KUY D;  1HQ3 A;  3WTP D;  5BO0 B;  4Z2M G;  5B33 C;  5DNM C;  3A6N A;  4G91 C;  3KWQ A;  4J8W D;  4QLC D;  3TU4 D;  3MVD D;  5CPJ C;  3W98 A;  1KX4 C;  3R45 B;  1ZLA C;  4R8P C;  3MGQ C;  3KWQ C;  1H3O B;  3A6N C;  3AZI B;  3W97 A;  5GT0 C;  1P3F A;  4UPK A;  5GSU C;  5GT3 C;  2IO5 C;  3MVD A;  4Z5T B;  5AY8 B;  5CP6 D;  3AZL D;  5JRG D;  3LZ0 B;  3AZM A;  1ZLA D;  1F66 A;  2DF4 C;  4ZUX C;  2CV5 D;  1P3F D;  1M18 B;  4G92 C;  4DQY B;  4YS3 B;  5DNM D;  3MGS D;  3C1C B;  3AYW C;  3C1B D;  1T3U A;  3NQJ A;  4CSR B;  4WU9 D;  3O62 D;  4JJN D;  5CPK A;  2CV5 A;  1P3B A;  1P3F C;  5C3I B;  4H9R B;  4ZUX D;  3AFA C;  1P34 B;  3MGP B;  3WA9 B;  3REI D;  1S32 B;  3W96 B;  2UWX A;  1P3L C;  5AV5 A;  3EPL A;  5C3I C;  3AFA B;  5CPJ B;  4J8X B;  3REJ D;  5E5A B;  4Z66 D;  3B0B A;  3X1T C;  3B0D B;  5B31 A;  5B1L B;  3B0C W;  3REI C;  3LJA D;  1BH9 A;  4WJ3 C;  3WKJ B;  4Z66 A;  3O62 C;  2BYM B;  5B2I A;  3LEL C;  3KUY C;  4J8U D;  1KX3 B;  4KUD B;  1EQZ D;  3AZE B;  2NZD A;  1P3A D;  3REH B;  2Y2P A;  4H9O B;  5BS7 A;  3MGR C;  3UT9 D;  3LZ1 C;  2XD5 A;  3AZH D;  5B2J A;  3X1V A;  5AV8 A;  5B32 D;  3REK A;  5F99 D;  5JRG C;  3AV1 A;  4J8U A;  2Y2O A;  4WNN B;  3REK C;  4DRA A;  1AOI C;  1F1E A;  2G5H C;  4KHA A;  3AZH A;  3AZI A;  4UUZ A;  3AYW B;  3W97 B;  3V9R B;  2VQR A;  3WAA B;  1KX4 D;  1TAF B;  5BNX A;  3WTP A;  4J8W B;  4AWL C;  4QLC B;  3TU4 C;  2NQB A;  3A6N D;  5DNN C;  3KWQ D;  1M18 A;  3WTP E;  3TU4 A;  5B31 C;  5AV9 B;  4DRB A;  4H9P A;  4QLC C;  5AVB C;  3AZJ A;  1P3M D;  4XZQ A;  2NQB D;  1PZR A;  3AZN B;  2RVQ C;  1AOI A;  1P3B B;  1KX5 C;  1P34 C;  5B1M C;  5JA4 A;  3MGS C;  1P3F B;  1P3G D;  1HTA A;  2Y2I A;  4WU8 A;  2Y2Q A;  1ID3 C;  1P3M A;  5DNM B;  3LZ1 A;  4X23 A;  3C1C D;  5AV6 C;  5AVC A;  4JJN B;  3MGR B;  3REH C;  2Y2H A;  3C1B A;  5CPK D;  1M1A B;  3O62 A;  5GT0 D;  4E44 A;  4H9S A;  3AV2 D;  5AVC D;  3UTB A;  4R8P D;  3MGQ D;  3REI A;  3AFA D;  3VH6 T;  4J8X D;  4H9S C;  5GT0 A;  3W97 C;  4WU9 C;  2NZD B;  3REJ A;  3LJA B;  5E5A C;  3AZK A;  5B24 A;  5AV6 A;  5AVC C;  3UTA D;  3AV1 B;  4NE5 A;  3W99 D;  5B33 A;  5B1L A;  3F6T A;  3B6G D;  5B1M A;  1B67 A;  3AZK D;  1P3A B;  4J8V B;  3AYW A;  5B32 B;  5F99 B;  3UT9 A;  1BH8 A;  4QLC A;  3MNN C;  5B1M D;  3W98 D;  3A1K A;  5B32 C;  2W8S A;  3NQU B;  4J8X C;  1P3A C;  4XZQ B;  5CP6 A;  2BYK A;  5BO0 A;  4HGA B;  3AZN C;  3A6N B;  3AZI C;  4WV4 B;  4UUZ B;  1P3I A;  3MGP C;  1A7W A;  4WU8 B;  5AV9 D;  1U35 D;  3WTP B;  5BNX B;  4X23 B;  1N1J A;  1H3O A;  1ULY A;  1HQ3 C;  2ARO A;  3UTA C;  1P3O B;  1P3B D;  5FUG B;  4J8W C;  4AWL B;  3TU4 B;  3AZJ D;  1U35 A;  1P3G B;  4H9P B;  5B1L C;  4CAY B;  3KFU G;  3UTB B;  2HUE C;  5AV5 D;  4WZS B;  1WWI A;  5B24 C;  5JA4 B;  5AY8 D;  3AZL B;  5JRG B;  3LZ0 D;  3X1S C;  5B31 D;  4XUJ A;  2Y2J A;  5B40 B;  2PYO B;  2HIO D;  1BFM A;  3X1U A;  5DNN D;  5AVC B;  3VH6 A;  4H9N B;  4LD9 A;  4G91 B;  4WU9 B;  4Z5T A;  4XUJ D;  3B6F B;  2G5I C;  5CP6 C;  2NZD D;  1TZY A;  3AL0 C;  2RIQ A;  3MGP D;  2Y2N A;  2HIO C;  1B6W A;  3AZF C;  3REI B;  5B2J D;  3X1V D;  3EG5 B;  5B32 A;  3REK D;  4YS3 A;  2Y2L A;  1BH8 B;  3AV1 D;  5B24 D;  5CPJ D;  4WU8 C;  3WKJ A;  3A1I A;  3UT9 C;  3AZG B;  3B6G B;  3AZK B;  4J8V D;  5G49 A;  3AZM C;  4H9R A;  1P34 A;  3WAA C;  3B6F C;  5B1L D;  3W96 A;  2Y2G A;  1S32 A;  3AZE A;  2ZY5 A;  4XZQ C;  5GT3 A;  1P3K D;  1Z2C B;  2ZY3 A;  3WKJ D;  4KGC B;  2JE5 A;  4M6B A;  3KXB D;  4J8U B;  2FJ7 D;  4YS3 C;  3AZE D;  3UT9 B;  3B6G C;  1BH9 B;  2XD1 A;  4XZQ D;  1P3K C;  5B0Y A;  1KX3 C;  4H9Q A;  2JCH A;  1JFI A;  3EPK A;  4Z5T C;  2ZM5 A;  3AZH C;  1KU5 A;  5GXQ D;  1P3G A;  3NQU A;  4KUD A;  1EQZ C;  4H9O A;  3W97 D;  3AV1 C;  1P3I D;  5AV8 B;  1KX4 B;  5B31 G; 
#chains in the Genus database with same CATH homology
 3AZL A;  3AZJ B;  3LEL A;  3KUY A;  3EPJ A;  3UTB D;  2Y2K A;  3WA9 C;  3X1T D;  3MGS A;  4H9N A;  5FUG A;  5B0Z C;  1U35 C;  4LD9 B;  1P3M B;  4KUD C;  4J8W A;  2HUE B;  2Y2M A;  1TZY B;  3X1T A;  2HIO B;  2ZY2 A;  5DNN A;  3X1U D;  2NQB C;  4XUJ B;  3AZN A;  1AOI B;  3AZM D;  3VH5 T;  5GXQ C;  5KDM A;  1P3B C;  3MNN D;  5GT0 B;  2F8N D;  3AV2 B;  5CPK C;  5BT1 D;  3LZ1 B;  4R8P B;  3MGQ B;  3B6F A;  5B24 B;  4JJN A;  3AZG D;  2YFV B;  3MNN A;  5AV8 C;  4ZUX A;  1P3L B;  1EQZ A;  1M1A A;  1P3G C;  4J8V A;  5B0Y B;  5B2I C;  3AZG A;  3UTA B;  1JFI B;  5F99 C;  2YFW B;  3REL D;  1P3K A;  3W99 B;  4E45 A;  3W98 C;  5BNV A;  5B0Z B;  4LD9 C;  3KXB A;  2FJ7 A;  5B40 C;  2PYO C;  5AV6 B;  3AV2 C;  3AZF D;  2JSS A;  1ID3 B;  3X1S A;  3W98 B;  5GXQ B;  3R45 A;  3LEL B;  3KUY B;  3UTB C;  1P3I B;  3WKJ C;  5F99 A;  3AZG C;  5AY8 A;  1W2E A;  1N1J B;  1HQ3 B;  2RVQ D;  2HIO A;  2ARO C;  5AY8 C;  1M1A C;  3AZI D;  4WU8 D;  2LY8 A;  4Z2M H;  1U35 B;  4YM6 C;  4X23 D;  3C1C A;  1M19 C;  1F66 C;  4JJN C;  4Z5T D;  1KX5 A;  5CP6 B;  1P3I C;  1P3P B;  1P3O D;  3REL C;  1WWS A;  1ZLA B;  4KGC C;  5GSU A;  5AVB A;  3AZJ C;  3AV2 A;  5B40 A;  2PYO A;  3KXB C;  4R8P A;  3MGQ A;  2FJ7 C;  5AV5 B;  3X1U B;  5CPJ A;  1AOI D;  5GSU D;  5CPI C;  2YFV A;  4ZUX B;  1P34 D;  5B31 B;  3WA9 D;  5B40 D;  1S32 D;  2PYO D;  3W96 D;  4ZBJ B;  1R4V A;  5DNN B;  4CSR A;  4J8V C;  2DQN C;  5CPI B;  2F8N A;  3UTA A;  1P3O C;  4J8U C;  5B33 D;  5KDM B;  3W99 A;  3B6F D;  4EO5 B;  3WA9 A;  1P3L D;  5JRG A;  1F66 D;  5BS7 C;  5G49 B;  5B2J B;  3X1V B;  3REK B;  2NZD C;  5E5A A;  4EO5 C;  1P3P C;  1P3L A;  4WU9 A;  5GXQ A;  3VH5 W;  4YM6 B;  1KX3 D;  2CWE A;  4KGC A;  3VH6 W;  3KSY A;  5B0Z D;  3REL A;  5AV6 D;  1TAF A;  3C1C C;  1P3K B;  1M19 A;  3AZF B;  5B0Y C;  1KX3 A;  4KGC D;  3REH A;  3B6G A;  3P5J B;  2J8P A;  3KXB B;  2FJ7 B;  3X1S D;  3AYW D;  5AV9 A;  4X23 C;  3AN2 A;  1M19 D;  3WAA D;  1P3M C;  1ID3 A;  5GT3 B;  1KX5 B;  2F8N H;  2L5A A;  2ARO D;  1HQ3 D;  4KHA B;  3KWQ B;  3W96 C;  5AVB B;  1S32 C;  5B2I D;  3AZK C;  3V9R A;  3AN2 D;  3WAA A;  3REJ C;  2NQB B;  5AV8 D;  4NE6 A;  4H9Q B;  1P3P D;  3AZN D;  3MVD B;  3H0L C;  3MVD C;  4G92 B;  3H0M C;  1TZY C;  4NE3 A;  3C1B C;  3B0D C;  3X1T B;  1P3P A;  4LD9 D;  1ZLA A;  1KX4 A;  2F2A C;  3MGR D;  5GSU B;  5CPK B;  1M1A D;  3X1U C;  3H0R C;  1TZY D;  2CV5 B;  5DNM A;  1M18 D;  2ZY4 A;  5B2J C;  3X1V C;  3AZE C;  5CPI D;  3MGR A;  4YS3 D;  3MGS B;  3C1B B;  3IP4 C;  5B33 B;  3O62 B;  3LZ0 A;  3AZM B;  1F66 B;  3AN2 C;  4Z66 C;  1M18 C;  5CPI A;  3MNN B;  5AV9 C;  2F8N B;  4NFT A;  4ZBJ C;  3B0C T;  3LZ1 D;  3AZF A;  2F8N K;  2F8N G;  3FDD A;  3WTP C;  3NQJ B;  3EPH A;  3REJ B;  2IO5 B;  5E5A D;  4Z66 B;  4YM6 D;  3LJA A;  3VH5 A;  2BYM A;  2YFW A;  3MGP A;  5AV5 C;  5CHL B;  4HGA C;  5BNV B;  5B0Z A;  2BYK B;  5B0Y D;  4YM6 A;  2FFF B;  5B1M B;  3LJA C;  3AFA A;  4XUJ C;  1P3A A;  4J8X A;  3REL B;  2CV5 C;  4WNN A;  4KUD D;  3X1S B;  1EQZ B;  3AZL C;  1M19 B;  3REH D;  3AZH B;  5GT3 D;  1KX5 D;  2ARO B;  3W99 C;  3LZ0 C;  5BT1 C;  5B32 G;  1P3O A;  2BG1 A;  1ID3 D;  5AVB D;  5B2I B;  1Q9C A;  3AN2 B;  4CAY A;  3LEL D;  3KUY D;  1HQ3 A;  3WTP D;  5BO0 B;  4Z2M G;  5B33 C;  5DNM C;  3A6N A;  4G91 C;  3KWQ A;  4J8W D;  4QLC D;  3TU4 D;  3MVD D;  5CPJ C;  3W98 A;  1KX4 C;  3R45 B;  1ZLA C;  4R8P C;  3MGQ C;  3KWQ C;  1H3O B;  3A6N C;  3AZI B;  3W97 A;  5GT0 C;  1P3F A;  4UPK A;  5GSU C;  5GT3 C;  2IO5 C;  3MVD A;  4Z5T B;  5AY8 B;  5CP6 D;  3AZL D;  5JRG D;  3LZ0 B;  3AZM A;  1ZLA D;  1F66 A;  2DF4 C;  4ZUX C;  2CV5 D;  1P3F D;  1M18 B;  4G92 C;  4DQY B;  4YS3 B;  5DNM D;  3MGS D;  3C1C B;  3AYW C;  3C1B D;  1T3U A;  3NQJ A;  4CSR B;  4WU9 D;  3O62 D;  4JJN D;  5CPK A;  2CV5 A;  1P3B A;  1P3F C;  5C3I B;  4H9R B;  4ZUX D;  3AFA C;  1P34 B;  3MGP B;  3WA9 B;  3REI D;  1S32 B;  3W96 B;  2UWX A;  1P3L C;  5AV5 A;  3EPL A;  5C3I C;  3AFA B;  5CPJ B;  4J8X B;  3REJ D;  5E5A B;  4Z66 D;  3B0B A;  3X1T C;  3B0D B;  5B31 A;  5B1L B;  3B0C W;  3REI C;  3LJA D;  1BH9 A;  4WJ3 C;  3WKJ B;  4Z66 A;  3O62 C;  2BYM B;  5B2I A;  3LEL C;  3KUY C;  4J8U D;  1KX3 B;  4KUD B;  1EQZ D;  3AZE B;  2NZD A;  1P3A D;  3REH B;  2Y2P A;  4H9O B;  5BS7 A;  3MGR C;  3UT9 D;  3LZ1 C;  2XD5 A;  3AZH D;  5B2J A;  3X1V A;  5AV8 A;  5B32 D;  3REK A;  5F99 D;  5JRG C;  3AV1 A;  4J8U A;  2Y2O A;  4WNN B;  3REK C;  4DRA A;  1AOI C;  1F1E A;  2G5H C;  4KHA A;  3AZH A;  3AZI A;  4UUZ A;  3AYW B;  3W97 B;  3V9R B;  2VQR A;  3WAA B;  1KX4 D;  1TAF B;  5BNX A;  3WTP A;  4J8W B;  4AWL C;  4QLC B;  3TU4 C;  2NQB A;  3A6N D;  5DNN C;  3KWQ D;  1M18 A;  3WTP E;  3TU4 A;  5B31 C;  5AV9 B;  4DRB A;  4H9P A;  4QLC C;  5AVB C;  3AZJ A;  1P3M D;  4XZQ A;  2NQB D;  1PZR A;  3AZN B;  2RVQ C;  1AOI A;  1P3B B;  1KX5 C;  1P34 C;  5B1M C;  5JA4 A;  3MGS C;  1P3F B;  1P3G D;  1HTA A;  2Y2I A;  4WU8 A;  2Y2Q A;  1ID3 C;  1P3M A;  5DNM B;  3LZ1 A;  4X23 A;  3C1C D;  5AV6 C;  5AVC A;  4JJN B;  3MGR B;  3REH C;  2Y2H A;  3C1B A;  5CPK D;  1M1A B;  3O62 A;  5GT0 D;  4E44 A;  4H9S A;  3AV2 D;  5AVC D;  3UTB A;  4R8P D;  3MGQ D;  3REI A;  3AFA D;  3VH6 T;  4J8X D;  4H9S C;  5GT0 A;  3W97 C;  4WU9 C;  2NZD B;  3REJ A;  3LJA B;  5E5A C;  3AZK A;  5B24 A;  5AV6 A;  5AVC C;  3UTA D;  3AV1 B;  4NE5 A;  3W99 D;  5B33 A;  5B1L A;  3F6T A;  3B6G D;  5B1M A;  1B67 A;  3AZK D;  1P3A B;  4J8V B;  3AYW A;  5B32 B;  5F99 B;  3UT9 A;  1BH8 A;  4QLC A;  3MNN C;  5B1M D;  3W98 D;  3A1K A;  5B32 C;  2W8S A;  3NQU B;  4J8X C;  1P3A C;  4XZQ B;  5CP6 A;  2BYK A;  5BO0 A;  4HGA B;  3AZN C;  3A6N B;  3AZI C;  4WV4 B;  4UUZ B;  1P3I A;  3MGP C;  1A7W A;  4WU8 B;  5AV9 D;  1U35 D;  3WTP B;  5BNX B;  4X23 B;  1N1J A;  1H3O A;  1ULY A;  1HQ3 C;  2ARO A;  3UTA C;  1P3O B;  1P3B D;  5FUG B;  4J8W C;  4AWL B;  3TU4 B;  3AZJ D;  1U35 A;  1P3G B;  4H9P B;  5B1L C;  4CAY B;  3KFU G;  3UTB B;  2HUE C;  5AV5 D;  4WZS B;  1WWI A;  5B24 C;  5JA4 B;  5AY8 D;  3AZL B;  5JRG B;  3LZ0 D;  3X1S C;  5B31 D;  4XUJ A;  2Y2J A;  5B40 B;  2PYO B;  2HIO D;  1BFM A;  3X1U A;  5DNN D;  5AVC B;  3VH6 A;  4H9N B;  4LD9 A;  4G91 B;  4WU9 B;  4Z5T A;  4XUJ D;  3B6F B;  2G5I C;  5CP6 C;  2NZD D;  1TZY A;  3AL0 C;  2RIQ A;  3MGP D;  2Y2N A;  2HIO C;  1B6W A;  3AZF C;  3REI B;  5B2J D;  3X1V D;  3EG5 B;  5B32 A;  3REK D;  4YS3 A;  2Y2L A;  1BH8 B;  3AV1 D;  5B24 D;  5CPJ D;  4WU8 C;  3WKJ A;  3A1I A;  3UT9 C;  3AZG B;  3B6G B;  3AZK B;  4J8V D;  5G49 A;  3AZM C;  4H9R A;  1P34 A;  3WAA C;  3B6F C;  5B1L D;  3W96 A;  2Y2G A;  1S32 A;  3AZE A;  2ZY5 A;  4XZQ C;  5GT3 A;  1P3K D;  1Z2C B;  2ZY3 A;  3WKJ D;  4KGC B;  2JE5 A;  4M6B A;  3KXB D;  4J8U B;  2FJ7 D;  4YS3 C;  3AZE D;  3UT9 B;  3B6G C;  1BH9 B;  2XD1 A;  4XZQ D;  1P3K C;  5B0Y A;  1KX3 C;  4H9Q A;  2JCH A;  1JFI A;  3EPK A;  4Z5T C;  2ZM5 A;  3AZH C;  1KU5 A;  5GXQ D;  1P3G A;  3NQU A;  4KUD A;  1EQZ C;  4H9O A;  3W97 D;  3AV1 C;  1P3I D;  5AV8 B;  1KX4 B;  5B31 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...