3AZLD

Crystal structure of human nucleosome core particle containing h4k77q mutation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
b'RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 37
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azlD00
4Z5TB 3KXBA 1M18A 4ZUXB 5B33B 1BFMA 3O62B 4DRBA 1EQZA 5AV5B 5AV9D 5AVCB 1KX5C 5B31A 4J8XA 1HQ3A 5B40B 1ID3A 3C1CD 2PYOD 5AVBA 4X23A 3X1VC 3AZNC 3REJC 1TZYD 4Z5TD 3X1SC 5B33D 3C1BA 3O62D 1BH8B 3KWQC 4R8PC 4JJNC 4CAYA 1N1JA 4QLCC 4YM6A 4J8WA 3MGPA 2HIOB 4WV4B 5CP6C 5B2ID 3WA9C 4H9QA 4HGAB 1ZLAD 2FJ7B 4AWLC 3AZJD 3AZMA 3LZ0B 3W96A 2CV5A 4J8VB 4XZQC 3AFAC 5GSUD 2FJ7D 3UTBB 3NQJB 3LJAD 1P3KB 5GT3B 1H3OB 4J8UA 5CPJB 3LZ0D 4WU8C 3WTPB 4KUDA 1M18B 4CSRA 3UTBD 2IO5B 5B31B 1HQ3B 1ID3B 5CPJD 3R45A 5AVBB 4X23B 3MNNC 1P3GA 5B32B 1M19C 4Z66C 3RELC 3KXBD 1M18D 3W98C 5E5AC 1P3BC 3NQUB 3AN2A 1KX4B 1EQZD 4YM6B 3X1UC 3AZHB 5B31D 4J8XD 1HQ3D 1ID3D 5AVBD 4X23D 3LELA 1P3IA 5B24A 1WWIA 4G91C 5CPKA 3MGQB 4DRAA 5BNXB 3WAAA 4LD9A 3AZLC 2AROC 3AZMB 4YM6D 3LZ1C 3MGPD 4J8WD 3W96B 5GXQA 1AOIC 1P3FC 1P3PB 5B2JB 1KX3B 1BH9B 1P3MC 3B6GA 4J8UB 5GT0A 3AZMD 4KUDB 3W96D 5AV9C 2CV5D 3AZGB 4YS3C 4ZBJC 3REHA 4WU9A 3B6FC 4G92B 4CSRB 5B0ZB 2HUEB 4Z5TC 4J8UD 4ZUXC 3A6NB 1HTAA 3O62C 3R45B 5AV5C 4KUDD 5AVCC 3AZFA 5B40C 2F8NH 3AN2B 5DNMA 5B0ZD 4UUZA 5CPIA 1P34B 1F66A 2CWEA 3LELB 5B24B 5CPKB 3AZKB 3WAAB 5B1MA 2HIOC 3AN2D 4LD9B 4HGAC 2FJ7C 5AY8B 5B0YB 3LELD 5GXQB 1P3ID 5B24D 5CPKD 3WAAD 1S32B 3B6GB 3TU4A 4J8VC 4LD9D 2NZDB 1JFIA 5GT0B 3MGRC 1P3KC 5GT3C 5GXQD 3REHB 4WU9B 3KSYA 5CPJC 5BO0A 3WTPC 1P3OA 3B6GD 4Z2MH 2PYOB 4WNNB 3MGSA 3C1CB 5GT0D 3X1TA 2IO5C 1M1AA 1TZYB 5B31C 4WU9D 1HQ3C 3REHD 5AVBC 4X23C 5B32C 5B32G 2NQBC 1F66B 1Q9CA 5B2IB 1KX4C 1KU5A 1R4VA 3VH6A 1ZLAB 4YM6C 5DNNA 3VH5T 3AZHC 3AZFD 3WKJA 5BNVA 5B1MB 3VH6W 5AV6A 3AZJB 5DNMD 3MGQC 5CPID 2F8NG 3AZIA 1F66D 3AYWA 2BYMB 5B1LA 3MVDA 4XUJA 3UTAA 5GSUB 3AZMC 3W96C 3LJAB 4NE3A 2LY8A 5B1MD 3B0CT 2L5AA 5B2JC 1WWSA 1P3PC 4NE6A 1KX3C 1JFIB 1B6WA 4J8UC 1KX5A 4H9SA 3X1VA 3AZNA 3AZGC 3TU4D 3REJA 5G49B 3MGSB 4G92C 2YFWA 3W97A 3X1TB 5B0ZC 2HUEC 4QLCA 3KXBB 3A6NC 3B0DB 1EQZB 3WA9A 1P3OD 4E45A 3REKA 3V9RA 4J8XB 3MGSD 3AN2C 4Z2MG 3X1TD 3W99C 1M1AD 1P34C 5DNNB 3WKJB 3C1BB 3KUYC 3LELC 1P3AA 5B24C 4CAYB 1N1JB 1P3LA 4J8WB 3AZKC 4XZQA 3WAAC 3MGPB 3REIA 4LD9C 3UT9A 3AYWB 4H9QB 3MVDB 5AY8C 3B0BA 5DNND 3WKJD 3C1BD 5B0YC 4WU8A 5GXQC 1TAFA 1S32C 3AZID 2CV5B 3B6GC 2NZDC 3AYWD 3UTAD 3MVDD 4XUJD 5GT0C 5AV8A 3MNNA 3X1VB 4WU9C 1M19A 3RELA 3W98A 1P3BA 3W97B 2PYOC 3C1CC 1U35A 1KX5D 5JRGA 1TZYC 3X1VD 3REKB 5B33C 3REJD 1P3GB 3W97D 4H9PA 3AZLA 2AROA 4QLCD 3LZ1A 1F66C 5BS7A 5B2IC 1P3AB 1P3LB 1ZLAC 3WA9D 1AOIA 3REKD 1P3FA 3REIB 5B1MC 3AV2A 1P3GD 3AZJC 3UT9B 1P3IB 5C3IB 5BT1D 4KHAA 4E44A 5GSUC 3AV1A 4YS3A 1P3AD 1P3LD 3B6FA 4XZQD 3LJAC 3REID 3AZEA 3UT9D 4NFTA 4ZUXA 2BYKA 3LZ0C 5AV8B 5AV5A 4WU8D 5AVCA 3UTBC 5B40A 3RELB 5FUGA 1U35B 5JA4A 5JRGB 5AV8D 3X1TC 3MNND 1M18C 3KXBC 3B0DC 1M19D 3RELD 3W98D 1EQZC 2HIOA 1P3BD 2RVQD 3AZFB 4J8XC 5B31G 1ID3C 1U35D 5JRGD 5DNMB 2YFVA 4UUZB 5CPIB 4KGCA 3WTPE 3WKJC 3C1BC 3AV2B 4J8VA 4J8WC 3MGPC 3AZLD 2AROD 3LZ1D 3MGRA 1P3KA 5GT3A 1H3OA 3MVDC 5F99A 3AV1B 1AOID 1F1EA 1P3FD 3WTPA 3AZEB 3AV2D 4H9RA 2BYKB 2CV5C 3TU4B 3AV1D 4YS3D 3B6FD 4H9SC 5B32A 5FUGB 3AZED 2NQBA 5JA4B 4ZUXD 4KUDC 5BO0B 3NQUA 1KX4A 3W97C 2JSSA 1P3OB 5AV5D 5AVCD 3AZHA 3X1SA 5B40D 3KWQA 4R8PA 4JJNA 1M1AB 4H9OA 3REKC 3MGQA 5BNXA 2F8NA 1P3GC 5CP6A 2YFVB 4KGCB 5BT1C 2HIOD 4EO5B 1P3AC 1P3LC 5BNVB 5B2JA 3REIC 1P3PA 1KX3A 1BH9A 3MGRB 5AV6B 3UT9C 5CPKC 1P3IC 5C3IC 5F99B 3AFAA 4KGCD 3AZIB 3UTAB 5B1LB 4XUJB 3AZGA 4J8VD 4H9RB 5B0ZA 3MGRD 5AV6D 1P3KD 5GT3D 5F99D 3A6NA 5AV8C 3WTPD 4WZSB 4NE5A 5B1LD 3VH5A 1KX5B 2NQBB 2RVQC 3AZNB 3VH5W 3REHC 3W99A 3REJB 1P34A 4Z66A 1U35C 5E5AA 2YFWB 5JRGC 3X1SB 5CHLB 3KUYA 3KWQB 4R8PB 5B32D 4JJNB 4H9OB 4QLCB 3X1UA 3AZKA 4H9NA 2F8NB 2NQBD 5CP6B 1KX4D 3WA9B 3AZFC 3AZND 3V9RB 5AY8A 3AZHD 5BS7C 3X1SD 5B0YA 4AWLB 5DNMC 5CPIC 3B0CW 4R8PD 3KWQD 4JJND 5KDMA 3MGQD 2F8ND 1S32A 3AV2C 5CP6D 2NZDA 4XZQB 3AFAB 1P3MA 3VH6T 3AV1C 1P3PD 5B2JD 5AV9A 4WU8B 3AZEC 1KX3D 2PYOA 4WNNA 3C1CA 3AFAD 1TAFB 3TU4C 1TZYA 4Z5TA 3AZGD 5B33A 2F8NK 3O62A 3MNNB 3W99B 1M19B 4Z66B 3W98B 3A6ND 5E5AB 5B2IA 1P3BB 1P3OC 3KUYB 1ZLAA 3MGSC 3X1UB 4H9NB 1BH8A 1M1AC 3AZJA 4G91B 3W99D 1P34D 4Z66D 1ULYA 5E5AD 2BYMA 3KUYD 4H9PB 4KGCC 5GSUA 4M6BA 2AROB 5KDMB 3AZLB 3LZ1B 3X1UD 1A7WA 3AZKD 2FJ7A 3LJAA 4EO5C 5DNNC 1AOIB 1P3FB 3LZ0A 1B67A 5AY8D 1P3MB 5AV6C 5B0YD 5F99C 3UTBA 3NQJA 3AZIC 3AYWC 4KHAB 5AV9B 3UTAC 5B1LC 1S32D 4XUJC 2NZDD 4YS3B 4ZBJB 5G49A 3B6FB 5CPJA 1P3MD
chains in the Genus database with same CATH superfamily
4Z5TB 3KXBA 1M18A 4ZUXB 5B33B 1BFMA 3O62B 4DRBA 1EQZA 5AV5B 5AV9D 2Y2KA 5AVCB 1KX5C 5B31A 4J8XA 1HQ3A 5B40B 1ID3A 3C1CD 2PYOD 5AVBA 4X23A 3X1VC 3AZNC 3REJC 1TZYD 4Z5TD 3X1SC 5B33D 3C1BA 3O62D 2XD5A 1BH8B 3KWQC 4R8PC 4JJNC 4CAYA 1N1JA 2J8PA 4QLCC 4YM6A 3MGPA 4J8WA 2HIOB 4WV4B 5CP6C 5B2ID 3WA9C 4H9QA 4HGAB 1ZLAD 2FJ7B 2Y2HA 4AWLC 1T3UA 3AZJD 3AZMA 3LZ0B 3W96A 2CV5A 4J8VB 2FFFB 4XZQC 3AFAC 5GSUD 2FJ7D 3UTBB 3F6TA 3NQJB 3H0RC 3LJAD 1P3KB 5GT3B 1H3OB 4J8UA 5CPJB 3LZ0D 4WU8C 3WTPB 4KUDA 2Y2IA 1M18B 4CSRA 3UTBD 2IO5B 5B31B 1HQ3B 1ID3B 5CPJD 3R45A 5AVBB 4X23B 3MNNC 1P3GA 5B32B 3H0MC 3A1IA 1M19C 4Z66C 4UPKA 3KXBD 3RELC 1M18D 5E5AC 1P3BC 3W98C 3NQUB 3AN2A 1KX4B 1EQZD 4YM6B 3X1UC 3AZHB 5B31D 4J8XD 1HQ3D 1ID3D 5AVBD 4X23D 3LELA 1P3IA 5B24A 1WWIA 4G91C 5CPKA 3MGQB 4DRAA 5BNXB 3WAAA 4LD9A 3AZLC 2AROC 3AZMB 4YM6D 3LZ1C 3MGPD 4J8WD 3W96B 5GXQA 1AOIC 1P3FC 1P3PB 5B2JB 1KX3B 1BH9B 1P3MC 3B6GA 4J8UB 4WJ3C 5GT0A 3AZMD 4KUDB 3W96D 5AV9C 3EPHA 2CV5D 3AZGB 4YS3C 4ZBJC 3REHA 4WU9A 3B6FC 4G92B 4CSRB 3H0LC 5B0ZB 2HUEB 4Z5TC 4J8UD 4ZUXC 3A6NB 1HTAA 3O62C 3R45B 5AV5C 4KUDD 3IP4C 5AVCC 3AZFA 5B40C 2F8NH 3AN2B 5DNMA 5B0ZD 4UUZA 5CPIA 1P34B 1F66A 2CWEA 2JCHA 3EG5B 3LELB 5B24B 5CPKB 3AZKB 3WAAB 5B1MA 2HIOC 3AN2D 4LD9B 4HGAC 2FJ7C 5AY8B 3EPLA 5B0YB 3LELD 5GXQB 1P3ID 5B24D 5CPKD 3WAAD 2DF4C 1S32B 3B6GB 3TU4A 4J8VC 4LD9D 2NZDB 2JE5A 1JFIA 5GT0B 3MGRC 1P3KC 5GT3C 2VQRA 5GXQD 3REHB 4WU9B 3KSYA 5CPJC 2F2AC 5BO0A 3WTPC 2ZY3A 1P3OA 3B6GD 4Z2MH 2PYOB 4WNNB 3MGSA 3C1CB 2Y2QA 2RIQA 5GT0D 3X1TA 2IO5C 1M1AA 1TZYB 5B31C 4WU9D 1HQ3C 3REHD 5AVBC 4X23C 5B32C 5B32G 2NQBC 1F66B 1Q9CA 5B2IB 1KX4C 1KU5A 1R4VA 3VH6A 1ZLAB 4YM6C 5DNNA 3VH5T 3AZHC 3AZFD 3WKJA 5BNVA 5B1MB 3VH6W 5AV6A 3AZJB 5DNMD 3MGQC 5CPID 3A1KA 2F8NG 3AZIA 1F66D 3AYWA 2BYMB 5B1LA 3MVDA 4XUJA 3UTAA 5GSUB 3AZMC 2Y2PA 3W96C 3LJAB 4NE3A 2LY8A 5B1MD 3B0CT 2L5AA 5B2JC 1WWSA 1P3PC 4NE6A 1KX3C 1JFIB 3KFUG 1B6WA 4J8UC 1KX5A 4H9SA 3X1VA 3AZNA 3AZGC 3TU4D 3REJA 5G49B 3MGSB 4G92C 2YFWA 3W97A 3X1TB 5B0ZC 2HUEC 4QLCA 3KXBB 3A6NC 3B0DB 3P5JB 1EQZB 3WA9A 2Y2LA 1P3OD 4E45A 3REKA 3V9RA 4J8XB 3MGSD 3AN2C 4Z2MG 3X1TD 2Y2MA 3W99C 1M1AD 1P34C 5DNNB 3WKJB 3C1BB 3KUYC 3LELC 1P3AA 5B24C 4CAYB 1N1JB 1P3LA 4J8WB 3AZKC 4XZQA 3WAAC 3MGPB 3REIA 4LD9C 3UT9A 3AYWB 4H9QB 3MVDB 5AY8C 3B0BA 5DNND 3WKJD 1W2EA 5B0YC 3C1BD 4WU8A 5GXQC 2W8SA 2G5HC 1TAFA 1S32C 3AZID 2CV5B 3B6GC 2NZDC 3AYWD 3UTAD 3MVDD 4XUJD 3EPKA 5GT0C 5AV8A 3MNNA 3X1VB 4WU9C 1M19A 3RELA 3W98A 1P3BA 3W97B 2PYOC 3C1CC 1U35A 1KX5D 5JRGA 1TZYC 3X1VD 3REKB 5B33C 3REJD 1P3GB 3W97D 4H9PA 3AZLA 2AROA 4QLCD 3LZ1A 1F66C 5BS7A 5B2IC 1P3AB 1P3LB 1ZLAC 3WA9D 1AOIA 3REKD 1P3FA 3REIB 5B1MC 3AV2A 1P3GD 3AZJC 3UT9B 1P3IB 5C3IB 5BT1D 4KHAA 4E44A 1Z2CB 5GSUC 3AV1A 4YS3A 1P3AD 1P3LD 3B6FA 4XZQD 3LJAC 2Y2JA 3REID 3AZEA 3UT9D 4NFTA 4ZUXA 2BYKA 3LZ0C 5AV8B 5AV5A 4WU8D 2Y2OA 5AVCA 3UTBC 5B40A 3RELB 5FUGA 2ZY5A 1U35B 2ZY4A 5JA4A 5JRGB 5AV8D 3X1TC 3MNND 1M18C 3KXBC 3B0DC 2ZY2A 1M19D 3RELD 3W98D 1EQZC 2HIOA 1P3BD 2RVQD 3AZFB 4J8XC 5B31G 1ID3C 1U35D 5JRGD 5DNMB 2YFVA 4UUZB 5CPIB 4KGCA 3WTPE 3WKJC 2Y2GA 3C1BC 2XD1A 3AV2B 4J8VA 4J8WC 3MGPC 3AZLD 2AROD 3LZ1D 3MGRA 1P3KA 5GT3A 1H3OA 3MVDC 5F99A 3AV1B 3FDDA 1AOID 1F1EA 1P3FD 4DQYB 3WTPA 3AZEB 3AV2D 4H9RA 2BYKB 2CV5C 3TU4B 2ZM5A 3AV1D 4YS3D 3B6FD 4H9SC 5B32A 5FUGB 3AZED 2NQBA 5JA4B 4ZUXD 4KUDC 5BO0B 3NQUA 1KX4A 3W97C 2JSSA 1P3OB 5AV5D 5AVCD 3AZHA 3X1SA 5B40D 3KWQA 4R8PA 4JJNA 1M1AB 4H9OA 3REKC 3MGQA 5BNXA 2F8NA 1P3GC 5CP6A 2YFVB 4KGCB 2DQNC 5BT1C 2HIOD 4EO5B 1P3AC 1P3LC 5BNVB 5B2JA 3REIC 1P3PA 1KX3A 1BH9A 3MGRB 5AV6B 3UT9C 5CPKC 1P3IC 5C3IC 5F99B 3AFAA 4KGCD 3AZIB 3UTAB 5B1LB 4XUJB 3AZGA 4J8VD 4H9RB 5B0ZA 3MGRD 5AV6D 1P3KD 5GT3D 5F99D 3A6NA 5AV8C 3WTPD 4WZSB 4NE5A 5B1LD 3VH5A 1KX5B 2UWXA 2NQBB 2RVQC 3AZNB 3VH5W 3REHC 3W99A 3REJB 1P34A 4Z66A 1U35C 5E5AA 2YFWB 5JRGC 3X1SB 5CHLB 3KUYA 3KWQB 4R8PB 5B32D 4JJNB 4H9OB 4QLCB 3X1UA 3AZKA 4H9NA 2F8NB 3EPJA 2NQBD 5CP6B 1KX4D 3WA9B 3AZFC 3AZND 3V9RB 5AY8A 3AZHD 5BS7C 3X1SD 5B0YA 4AWLB 5DNMC 5CPIC 3B0CW 4R8PD 3KWQD 4JJND 5KDMA 3MGQD 2F8ND 1S32A 3AV2C 5CP6D 2NZDA 4XZQB 3AFAB 1P3MA 3VH6T 3AV1C 1P3PD 5B2JD 5AV9A 4WU8B 3AZEC 1KX3D 3AL0C 2PYOA 4WNNA 3C1CA 3AFAD 1TAFB 3TU4C 1TZYA 2BG1A 4Z5TA 3AZGD 5B33A 2F8NK 3O62A 3MNNB 3W99B 1M19B 4Z66B 3W98B 3A6ND 5E5AB 5B2IA 1P3BB 1P3OC 3KUYB 1ZLAA 3MGSC 3X1UB 2Y2NA 4H9NB 1BH8A 1PZRA 1M1AC 3AZJA 4G91B 3W99D 1P34D 4Z66D 1ULYA 5E5AD 2G5IC 2BYMA 3KUYD 4H9PB 4KGCC 5GSUA 4M6BA 2AROB 5KDMB 3AZLB 3LZ1B 3X1UD 1A7WA 3AZKD 2FJ7A 3LJAA 4EO5C 5DNNC 1AOIB 1P3FB 3LZ0A 1B67A 5AY8D 1P3MB 5AV6C 5B0YD 5F99C 3UTBA 3NQJA 3AZIC 3AYWC 4KHAB 5AV9B 3UTAC 5B1LC 1S32D 4XUJC 2NZDD 4YS3B 4ZBJB 5G49A 3B6FB 5CPJA 1P3MD
chains in the Genus database with same CATH topology
4Z5TB 3KXBA 1M18A 4ZUXB 5B33B 1BFMA 3O62B 4DRBA 1EQZA 5AV5B 5AV9D 2Y2KA 5AVCB 1KX5C 5B31A 4J8XA 1HQ3A 5B40B 1ID3A 3C1CD 2PYOD 5AVBA 4X23A 3X1VC 3AZNC 3REJC 1TZYD 4Z5TD 3X1SC 5B33D 3C1BA 3O62D 2XD5A 1BH8B 3KWQC 4R8PC 4JJNC 4CAYA 1N1JA 2J8PA 4QLCC 4YM6A 3MGPA 4J8WA 2HIOB 4WV4B 5CP6C 5B2ID 3WA9C 4H9QA 4HGAB 1ZLAD 2FJ7B 2Y2HA 4AWLC 1T3UA 3AZJD 3AZMA 3LZ0B 3W96A 2CV5A 4J8VB 2FFFB 4XZQC 3AFAC 5GSUD 2FJ7D 3UTBB 3F6TA 3NQJB 3H0RC 3LJAD 1P3KB 5GT3B 1H3OB 4J8UA 5CPJB 3LZ0D 4WU8C 3WTPB 4KUDA 2Y2IA 1M18B 4CSRA 3UTBD 2IO5B 5B31B 1HQ3B 1ID3B 5CPJD 3R45A 5AVBB 4X23B 3MNNC 1P3GA 5B32B 3H0MC 3A1IA 1M19C 4Z66C 4UPKA 3KXBD 3RELC 1M18D 5E5AC 1P3BC 3W98C 3NQUB 3AN2A 1KX4B 1EQZD 4YM6B 3X1UC 3AZHB 5B31D 4J8XD 1HQ3D 1ID3D 5AVBD 4X23D 3LELA 1P3IA 5B24A 1WWIA 4G91C 5CPKA 3MGQB 4DRAA 5BNXB 3WAAA 4LD9A 3AZLC 2AROC 3AZMB 4YM6D 3LZ1C 3MGPD 4J8WD 3W96B 5GXQA 1AOIC 1P3FC 1P3PB 5B2JB 1KX3B 1BH9B 1P3MC 3B6GA 4J8UB 4WJ3C 5GT0A 3AZMD 4KUDB 3W96D 5AV9C 3EPHA 2CV5D 3AZGB 4YS3C 4ZBJC 3REHA 4WU9A 3B6FC 4G92B 4CSRB 3H0LC 5B0ZB 2HUEB 4Z5TC 4J8UD 4ZUXC 3A6NB 1HTAA 3O62C 3R45B 5AV5C 4KUDD 3IP4C 5AVCC 3AZFA 5B40C 2F8NH 3AN2B 5DNMA 5B0ZD 4UUZA 5CPIA 1P34B 1F66A 2CWEA 2JCHA 3EG5B 3LELB 5B24B 5CPKB 3AZKB 3WAAB 5B1MA 2HIOC 3AN2D 4LD9B 4HGAC 2FJ7C 5AY8B 3EPLA 5B0YB 3LELD 5GXQB 1P3ID 5B24D 5CPKD 3WAAD 2DF4C 1S32B 3B6GB 3TU4A 4J8VC 4LD9D 2NZDB 2JE5A 1JFIA 5GT0B 3MGRC 1P3KC 5GT3C 2VQRA 5GXQD 3REHB 4WU9B 3KSYA 5CPJC 2F2AC 5BO0A 3WTPC 2ZY3A 1P3OA 3B6GD 4Z2MH 2PYOB 4WNNB 3MGSA 3C1CB 2Y2QA 2RIQA 5GT0D 3X1TA 2IO5C 1M1AA 1TZYB 5B31C 4WU9D 1HQ3C 3REHD 5AVBC 4X23C 5B32C 5B32G 2NQBC 1F66B 1Q9CA 5B2IB 1KX4C 1KU5A 1R4VA 3VH6A 1ZLAB 4YM6C 5DNNA 3VH5T 3AZHC 3AZFD 3WKJA 5BNVA 5B1MB 3VH6W 5AV6A 3AZJB 5DNMD 3MGQC 5CPID 3A1KA 2F8NG 3AZIA 1F66D 3AYWA 2BYMB 5B1LA 3MVDA 4XUJA 3UTAA 5GSUB 3AZMC 2Y2PA 3W96C 3LJAB 4NE3A 2LY8A 5B1MD 3B0CT 2L5AA 5B2JC 1WWSA 1P3PC 4NE6A 1KX3C 1JFIB 3KFUG 1B6WA 4J8UC 1KX5A 4H9SA 3X1VA 3AZNA 3AZGC 3TU4D 3REJA 5G49B 3MGSB 4G92C 2YFWA 3W97A 3X1TB 5B0ZC 2HUEC 4QLCA 3KXBB 3A6NC 3B0DB 3P5JB 1EQZB 3WA9A 2Y2LA 1P3OD 4E45A 3REKA 3V9RA 4J8XB 3MGSD 3AN2C 4Z2MG 3X1TD 2Y2MA 3W99C 1M1AD 1P34C 5DNNB 3WKJB 3C1BB 3KUYC 3LELC 1P3AA 5B24C 4CAYB 1N1JB 1P3LA 4J8WB 3AZKC 4XZQA 3WAAC 3MGPB 3REIA 4LD9C 3UT9A 3AYWB 4H9QB 3MVDB 5AY8C 3B0BA 5DNND 3WKJD 1W2EA 5B0YC 3C1BD 4WU8A 5GXQC 2W8SA 2G5HC 1TAFA 1S32C 3AZID 2CV5B 3B6GC 2NZDC 3AYWD 3UTAD 3MVDD 4XUJD 3EPKA 5GT0C 5AV8A 3MNNA 3X1VB 4WU9C 1M19A 3RELA 3W98A 1P3BA 3W97B 2PYOC 3C1CC 1U35A 1KX5D 5JRGA 1TZYC 3X1VD 3REKB 5B33C 3REJD 1P3GB 3W97D 4H9PA 3AZLA 2AROA 4QLCD 3LZ1A 1F66C 5BS7A 5B2IC 1P3AB 1P3LB 1ZLAC 3WA9D 1AOIA 3REKD 1P3FA 3REIB 5B1MC 3AV2A 1P3GD 3AZJC 3UT9B 1P3IB 5C3IB 5BT1D 4KHAA 4E44A 1Z2CB 5GSUC 3AV1A 4YS3A 1P3AD 1P3LD 3B6FA 4XZQD 3LJAC 2Y2JA 3REID 3AZEA 3UT9D 4NFTA 4ZUXA 2BYKA 3LZ0C 5AV8B 5AV5A 4WU8D 2Y2OA 5AVCA 3UTBC 5B40A 3RELB 5FUGA 2ZY5A 1U35B 2ZY4A 5JA4A 5JRGB 5AV8D 3X1TC 3MNND 1M18C 3KXBC 3B0DC 2ZY2A 1M19D 3RELD 3W98D 1EQZC 2HIOA 1P3BD 2RVQD 3AZFB 4J8XC 5B31G 1ID3C 1U35D 5JRGD 5DNMB 2YFVA 4UUZB 5CPIB 4KGCA 3WTPE 3WKJC 2Y2GA 3C1BC 2XD1A 3AV2B 4J8VA 4J8WC 3MGPC 3AZLD 2AROD 3LZ1D 3MGRA 1P3KA 5GT3A 1H3OA 3MVDC 5F99A 3AV1B 3FDDA 1AOID 1F1EA 1P3FD 4DQYB 3WTPA 3AZEB 3AV2D 4H9RA 2BYKB 2CV5C 3TU4B 2ZM5A 3AV1D 4YS3D 3B6FD 4H9SC 5B32A 5FUGB 3AZED 2NQBA 5JA4B 4ZUXD 4KUDC 5BO0B 3NQUA 1KX4A 3W97C 2JSSA 1P3OB 5AV5D 5AVCD 3AZHA 3X1SA 5B40D 3KWQA 4R8PA 4JJNA 1M1AB 4H9OA 3REKC 3MGQA 5BNXA 2F8NA 1P3GC 5CP6A 2YFVB 4KGCB 2DQNC 5BT1C 2HIOD 4EO5B 1P3AC 1P3LC 5BNVB 5B2JA 3REIC 1P3PA 1KX3A 1BH9A 3MGRB 5AV6B 3UT9C 5CPKC 1P3IC 5C3IC 5F99B 3AFAA 4KGCD 3AZIB 3UTAB 5B1LB 4XUJB 3AZGA 4J8VD 4H9RB 5B0ZA 3MGRD 5AV6D 1P3KD 5GT3D 5F99D 3A6NA 5AV8C 3WTPD 4WZSB 4NE5A 5B1LD 3VH5A 1KX5B 2UWXA 2NQBB 2RVQC 3AZNB 3VH5W 3REHC 3W99A 3REJB 1P34A 4Z66A 1U35C 5E5AA 2YFWB 5JRGC 3X1SB 5CHLB 3KUYA 3KWQB 4R8PB 5B32D 4JJNB 4H9OB 4QLCB 3X1UA 3AZKA 4H9NA 2F8NB 3EPJA 2NQBD 5CP6B 1KX4D 3WA9B 3AZFC 3AZND 3V9RB 5AY8A 3AZHD 5BS7C 3X1SD 5B0YA 4AWLB 5DNMC 5CPIC 3B0CW 4R8PD 3KWQD 4JJND 5KDMA 3MGQD 2F8ND 1S32A 3AV2C 5CP6D 2NZDA 4XZQB 3AFAB 1P3MA 3VH6T 3AV1C 1P3PD 5B2JD 5AV9A 4WU8B 3AZEC 1KX3D 3AL0C 2PYOA 4WNNA 3C1CA 3AFAD 1TAFB 3TU4C 1TZYA 2BG1A 4Z5TA 3AZGD 5B33A 2F8NK 3O62A 3MNNB 3W99B 1M19B 4Z66B 3W98B 3A6ND 5E5AB 5B2IA 1P3BB 1P3OC 3KUYB 1ZLAA 3MGSC 3X1UB 2Y2NA 4H9NB 1BH8A 1PZRA 1M1AC 3AZJA 4G91B 3W99D 1P34D 4Z66D 1ULYA 5E5AD 2G5IC 2BYMA 3KUYD 4H9PB 4KGCC 5GSUA 4M6BA 2AROB 5KDMB 3AZLB 3LZ1B 3X1UD 1A7WA 3AZKD 2FJ7A 3LJAA 4EO5C 5DNNC 1AOIB 1P3FB 3LZ0A 1B67A 5AY8D 1P3MB 5AV6C 5B0YD 5F99C 3UTBA 3NQJA 3AZIC 3AYWC 4KHAB 5AV9B 3UTAC 5B1LC 1S32D 4XUJC 2NZDD 4YS3B 4ZBJB 5G49A 3B6FB 5CPJA 1P3MD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5T B;  3KXB A;  1M18 A;  4ZUX B;  5B33 B;  1BFM A;  3O62 B;  4DRB A;  1EQZ A;  5AV5 B;  5AV9 D;  5AVC B;  1KX5 C;  5B31 A;  4J8X A;  1HQ3 A;  5B40 B;  1ID3 A;  3C1C D;  2PYO D;  5AVB A;  4X23 A;  3X1V C;  3AZN C;  3REJ C;  1TZY D;  4Z5T D;  3X1S C;  5B33 D;  3C1B A;  3O62 D;  1BH8 B;  3KWQ C;  4R8P C;  4JJN C;  4CAY A;  1N1J A;  4QLC C;  4YM6 A;  4J8W A;  3MGP A;  2HIO B;  4WV4 B;  5CP6 C;  5B2I D;  3WA9 C;  4H9Q A;  4HGA B;  1ZLA D;  2FJ7 B;  4AWL C;  3AZJ D;  3AZM A;  3LZ0 B;  3W96 A;  2CV5 A;  4J8V B;  4XZQ C;  3AFA C;  5GSU D;  2FJ7 D;  3UTB B;  3NQJ B;  3LJA D;  1P3K B;  5GT3 B;  1H3O B;  4J8U A;  5CPJ B;  3LZ0 D;  4WU8 C;  3WTP B;  4KUD A;  1M18 B;  4CSR A;  3UTB D;  2IO5 B;  5B31 B;  1HQ3 B;  1ID3 B;  5CPJ D;  3R45 A;  5AVB B;  4X23 B;  3MNN C;  1P3G A;  5B32 B;  1M19 C;  4Z66 C;  3REL C;  3KXB D;  1M18 D;  3W98 C;  5E5A C;  1P3B C;  3NQU B;  3AN2 A;  1KX4 B;  1EQZ D;  4YM6 B;  3X1U C;  3AZH B;  5B31 D;  4J8X D;  1HQ3 D;  1ID3 D;  5AVB D;  4X23 D;  3LEL A;  1P3I A;  5B24 A;  1WWI A;  4G91 C;  5CPK A;  3MGQ B;  4DRA A;  5BNX B;  3WAA A;  4LD9 A;  3AZL C;  2ARO C;  3AZM B;  4YM6 D;  3LZ1 C;  3MGP D;  4J8W D;  3W96 B;  5GXQ A;  1AOI C;  1P3F C;  1P3P B;  5B2J B;  1KX3 B;  1BH9 B;  1P3M C;  3B6G A;  4J8U B;  5GT0 A;  3AZM D;  4KUD B;  3W96 D;  5AV9 C;  2CV5 D;  3AZG B;  4YS3 C;  4ZBJ C;  3REH A;  4WU9 A;  3B6F C;  4G92 B;  4CSR B;  5B0Z B;  2HUE B;  4Z5T C;  4J8U D;  4ZUX C;  3A6N B;  1HTA A;  3O62 C;  3R45 B;  5AV5 C;  4KUD D;  5AVC C;  3AZF A;  5B40 C;  2F8N H;  3AN2 B;  5DNM A;  5B0Z D;  4UUZ A;  5CPI A;  1P34 B;  1F66 A;  2CWE A;  3LEL B;  5B24 B;  5CPK B;  3AZK B;  3WAA B;  5B1M A;  2HIO C;  3AN2 D;  4LD9 B;  4HGA C;  2FJ7 C;  5AY8 B;  5B0Y B;  3LEL D;  5GXQ B;  1P3I D;  5B24 D;  5CPK D;  3WAA D;  1S32 B;  3B6G B;  3TU4 A;  4J8V C;  4LD9 D;  2NZD B;  1JFI A;  5GT0 B;  3MGR C;  1P3K C;  5GT3 C;  5GXQ D;  3REH B;  4WU9 B;  3KSY A;  5CPJ C;  5BO0 A;  3WTP C;  1P3O A;  3B6G D;  4Z2M H;  2PYO B;  4WNN B;  3MGS A;  3C1C B;  5GT0 D;  3X1T A;  2IO5 C;  1M1A A;  1TZY B;  5B31 C;  4WU9 D;  1HQ3 C;  3REH D;  5AVB C;  4X23 C;  5B32 C;  5B32 G;  2NQB C;  1F66 B;  1Q9C A;  5B2I B;  1KX4 C;  1KU5 A;  1R4V A;  3VH6 A;  1ZLA B;  4YM6 C;  5DNN A;  3VH5 T;  3AZH C;  3AZF D;  3WKJ A;  5BNV A;  5B1M B;  3VH6 W;  5AV6 A;  3AZJ B;  5DNM D;  3MGQ C;  5CPI D;  2F8N G;  3AZI A;  1F66 D;  3AYW A;  2BYM B;  5B1L A;  3MVD A;  4XUJ A;  3UTA A;  5GSU B;  3AZM C;  3W96 C;  3LJA B;  4NE3 A;  2LY8 A;  5B1M D;  3B0C T;  2L5A A;  5B2J C;  1WWS A;  1P3P C;  4NE6 A;  1KX3 C;  1JFI B;  1B6W A;  4J8U C;  1KX5 A;  4H9S A;  3X1V A;  3AZN A;  3AZG C;  3TU4 D;  3REJ A;  5G49 B;  3MGS B;  4G92 C;  2YFW A;  3W97 A;  3X1T B;  5B0Z C;  2HUE C;  4QLC A;  3KXB B;  3A6N C;  3B0D B;  1EQZ B;  3WA9 A;  1P3O D;  4E45 A;  3REK A;  3V9R A;  4J8X B;  3MGS D;  3AN2 C;  4Z2M G;  3X1T D;  3W99 C;  1M1A D;  1P34 C;  5DNN B;  3WKJ B;  3C1B B;  3KUY C;  3LEL C;  1P3A A;  5B24 C;  4CAY B;  1N1J B;  1P3L A;  4J8W B;  3AZK C;  4XZQ A;  3WAA C;  3MGP B;  3REI A;  4LD9 C;  3UT9 A;  3AYW B;  4H9Q B;  3MVD B;  5AY8 C;  3B0B A;  5DNN D;  3WKJ D;  3C1B D;  5B0Y C;  4WU8 A;  5GXQ C;  1TAF A;  1S32 C;  3AZI D;  2CV5 B;  3B6G C;  2NZD C;  3AYW D;  3UTA D;  3MVD D;  4XUJ D;  5GT0 C;  5AV8 A;  3MNN A;  3X1V B;  4WU9 C;  1M19 A;  3REL A;  3W98 A;  1P3B A;  3W97 B;  2PYO C;  3C1C C;  1U35 A;  1KX5 D;  5JRG A;  1TZY C;  3X1V D;  3REK B;  5B33 C;  3REJ D;  1P3G B;  3W97 D;  4H9P A;  3AZL A;  2ARO A;  4QLC D;  3LZ1 A;  1F66 C;  5BS7 A;  5B2I C;  1P3A B;  1P3L B;  1ZLA C;  3WA9 D;  1AOI A;  3REK D;  1P3F A;  3REI B;  5B1M C;  3AV2 A;  1P3G D;  3AZJ C;  3UT9 B;  1P3I B;  5C3I B;  5BT1 D;  4KHA A;  4E44 A;  5GSU C;  3AV1 A;  4YS3 A;  1P3A D;  1P3L D;  3B6F A;  4XZQ D;  3LJA C;  3REI D;  3AZE A;  3UT9 D;  4NFT A;  4ZUX A;  2BYK A;  3LZ0 C;  5AV8 B;  5AV5 A;  4WU8 D;  5AVC A;  3UTB C;  5B40 A;  3REL B;  5FUG A;  1U35 B;  5JA4 A;  5JRG B;  5AV8 D;  3X1T C;  3MNN D;  1M18 C;  3KXB C;  3B0D C;  1M19 D;  3REL D;  3W98 D;  1EQZ C;  2HIO A;  1P3B D;  2RVQ D;  3AZF B;  4J8X C;  5B31 G;  1ID3 C;  1U35 D;  5JRG D;  5DNM B;  2YFV A;  4UUZ B;  5CPI B;  4KGC A;  3WTP E;  3WKJ C;  3C1B C;  3AV2 B;  4J8V A;  4J8W C;  3MGP C;  3AZL D;  2ARO D;  3LZ1 D;  3MGR A;  1P3K A;  5GT3 A;  1H3O A;  3MVD C;  5F99 A;  3AV1 B;  1AOI D;  1F1E A;  1P3F D;  3WTP A;  3AZE B;  3AV2 D;  4H9R A;  2BYK B;  2CV5 C;  3TU4 B;  3AV1 D;  4YS3 D;  3B6F D;  4H9S C;  5B32 A;  5FUG B;  3AZE D;  2NQB A;  5JA4 B;  4ZUX D;  4KUD C;  5BO0 B;  3NQU A;  1KX4 A;  3W97 C;  2JSS A;  1P3O B;  5AV5 D;  5AVC D;  3AZH A;  3X1S A;  5B40 D;  3KWQ A;  4R8P A;  4JJN A;  1M1A B;  4H9O A;  3REK C;  3MGQ A;  5BNX A;  2F8N A;  1P3G C;  5CP6 A;  2YFV B;  4KGC B;  5BT1 C;  2HIO D;  4EO5 B;  1P3A C;  1P3L C;  5BNV B;  5B2J A;  3REI C;  1P3P A;  1KX3 A;  1BH9 A;  3MGR B;  5AV6 B;  3UT9 C;  5CPK C;  1P3I C;  5C3I C;  5F99 B;  3AFA A;  4KGC D;  3AZI B;  3UTA B;  5B1L B;  4XUJ B;  3AZG A;  4J8V D;  4H9R B;  5B0Z A;  3MGR D;  5AV6 D;  1P3K D;  5GT3 D;  5F99 D;  3A6N A;  5AV8 C;  3WTP D;  4WZS B;  4NE5 A;  5B1L D;  3VH5 A;  1KX5 B;  2NQB B;  2RVQ C;  3AZN B;  3VH5 W;  3REH C;  3W99 A;  3REJ B;  1P34 A;  4Z66 A;  1U35 C;  5E5A A;  2YFW B;  5JRG C;  3X1S B;  5CHL B;  3KUY A;  3KWQ B;  4R8P B;  5B32 D;  4JJN B;  4H9O B;  4QLC B;  3X1U A;  3AZK A;  4H9N A;  2F8N B;  2NQB D;  5CP6 B;  1KX4 D;  3WA9 B;  3AZF C;  3AZN D;  3V9R B;  5AY8 A;  3AZH D;  5BS7 C;  3X1S D;  5B0Y A;  4AWL B;  5DNM C;  5CPI C;  3B0C W;  4R8P D;  3KWQ D;  4JJN D;  5KDM A;  3MGQ D;  2F8N D;  1S32 A;  3AV2 C;  5CP6 D;  2NZD A;  4XZQ B;  3AFA B;  1P3M A;  3VH6 T;  3AV1 C;  1P3P D;  5B2J D;  5AV9 A;  4WU8 B;  3AZE C;  1KX3 D;  2PYO A;  4WNN A;  3C1C A;  3AFA D;  1TAF B;  3TU4 C;  1TZY A;  4Z5T A;  3AZG D;  5B33 A;  2F8N K;  3O62 A;  3MNN B;  3W99 B;  1M19 B;  4Z66 B;  3W98 B;  3A6N D;  5E5A B;  5B2I A;  1P3B B;  1P3O C;  3KUY B;  1ZLA A;  3MGS C;  3X1U B;  4H9N B;  1BH8 A;  1M1A C;  3AZJ A;  4G91 B;  3W99 D;  1P34 D;  4Z66 D;  1ULY A;  5E5A D;  2BYM A;  3KUY D;  4H9P B;  4KGC C;  5GSU A;  4M6B A;  2ARO B;  5KDM B;  3AZL B;  3LZ1 B;  3X1U D;  1A7W A;  3AZK D;  2FJ7 A;  3LJA A;  4EO5 C;  5DNN C;  1AOI B;  1P3F B;  3LZ0 A;  1B67 A;  5AY8 D;  1P3M B;  5AV6 C;  5B0Y D;  5F99 C;  3UTB A;  3NQJ A;  3AZI C;  3AYW C;  4KHA B;  5AV9 B;  3UTA C;  5B1L C;  1S32 D;  4XUJ C;  2NZD D;  4YS3 B;  4ZBJ B;  5G49 A;  3B6F B;  5CPJ A;  1P3M D; 
#chains in the Genus database with same CATH topology
 4Z5T B;  3KXB A;  1M18 A;  4ZUX B;  5B33 B;  1BFM A;  3O62 B;  4DRB A;  1EQZ A;  5AV5 B;  5AV9 D;  2Y2K A;  5AVC B;  1KX5 C;  5B31 A;  4J8X A;  1HQ3 A;  5B40 B;  1ID3 A;  3C1C D;  2PYO D;  5AVB A;  4X23 A;  3X1V C;  3AZN C;  3REJ C;  1TZY D;  4Z5T D;  3X1S C;  5B33 D;  3C1B A;  3O62 D;  2XD5 A;  1BH8 B;  3KWQ C;  4R8P C;  4JJN C;  4CAY A;  1N1J A;  2J8P A;  4QLC C;  4YM6 A;  3MGP A;  4J8W A;  2HIO B;  4WV4 B;  5CP6 C;  5B2I D;  3WA9 C;  4H9Q A;  4HGA B;  1ZLA D;  2FJ7 B;  2Y2H A;  4AWL C;  1T3U A;  3AZJ D;  3AZM A;  3LZ0 B;  3W96 A;  2CV5 A;  4J8V B;  2FFF B;  4XZQ C;  3AFA C;  5GSU D;  2FJ7 D;  3UTB B;  3F6T A;  3NQJ B;  3H0R C;  3LJA D;  1P3K B;  5GT3 B;  1H3O B;  4J8U A;  5CPJ B;  3LZ0 D;  4WU8 C;  3WTP B;  4KUD A;  2Y2I A;  1M18 B;  4CSR A;  3UTB D;  2IO5 B;  5B31 B;  1HQ3 B;  1ID3 B;  5CPJ D;  3R45 A;  5AVB B;  4X23 B;  3MNN C;  1P3G A;  5B32 B;  3H0M C;  3A1I A;  1M19 C;  4Z66 C;  4UPK A;  3KXB D;  3REL C;  1M18 D;  5E5A C;  1P3B C;  3W98 C;  3NQU B;  3AN2 A;  1KX4 B;  1EQZ D;  4YM6 B;  3X1U C;  3AZH B;  5B31 D;  4J8X D;  1HQ3 D;  1ID3 D;  5AVB D;  4X23 D;  3LEL A;  1P3I A;  5B24 A;  1WWI A;  4G91 C;  5CPK A;  3MGQ B;  4DRA A;  5BNX B;  3WAA A;  4LD9 A;  3AZL C;  2ARO C;  3AZM B;  4YM6 D;  3LZ1 C;  3MGP D;  4J8W D;  3W96 B;  5GXQ A;  1AOI C;  1P3F C;  1P3P B;  5B2J B;  1KX3 B;  1BH9 B;  1P3M C;  3B6G A;  4J8U B;  4WJ3 C;  5GT0 A;  3AZM D;  4KUD B;  3W96 D;  5AV9 C;  3EPH A;  2CV5 D;  3AZG B;  4YS3 C;  4ZBJ C;  3REH A;  4WU9 A;  3B6F C;  4G92 B;  4CSR B;  3H0L C;  5B0Z B;  2HUE B;  4Z5T C;  4J8U D;  4ZUX C;  3A6N B;  1HTA A;  3O62 C;  3R45 B;  5AV5 C;  4KUD D;  3IP4 C;  5AVC C;  3AZF A;  5B40 C;  2F8N H;  3AN2 B;  5DNM A;  5B0Z D;  4UUZ A;  5CPI A;  1P34 B;  1F66 A;  2CWE A;  2JCH A;  3EG5 B;  3LEL B;  5B24 B;  5CPK B;  3AZK B;  3WAA B;  5B1M A;  2HIO C;  3AN2 D;  4LD9 B;  4HGA C;  2FJ7 C;  5AY8 B;  3EPL A;  5B0Y B;  3LEL D;  5GXQ B;  1P3I D;  5B24 D;  5CPK D;  3WAA D;  2DF4 C;  1S32 B;  3B6G B;  3TU4 A;  4J8V C;  4LD9 D;  2NZD B;  2JE5 A;  1JFI A;  5GT0 B;  3MGR C;  1P3K C;  5GT3 C;  2VQR A;  5GXQ D;  3REH B;  4WU9 B;  3KSY A;  5CPJ C;  2F2A C;  5BO0 A;  3WTP C;  2ZY3 A;  1P3O A;  3B6G D;  4Z2M H;  2PYO B;  4WNN B;  3MGS A;  3C1C B;  2Y2Q A;  2RIQ A;  5GT0 D;  3X1T A;  2IO5 C;  1M1A A;  1TZY B;  5B31 C;  4WU9 D;  1HQ3 C;  3REH D;  5AVB C;  4X23 C;  5B32 C;  5B32 G;  2NQB C;  1F66 B;  1Q9C A;  5B2I B;  1KX4 C;  1KU5 A;  1R4V A;  3VH6 A;  1ZLA B;  4YM6 C;  5DNN A;  3VH5 T;  3AZH C;  3AZF D;  3WKJ A;  5BNV A;  5B1M B;  3VH6 W;  5AV6 A;  3AZJ B;  5DNM D;  3MGQ C;  5CPI D;  3A1K A;  2F8N G;  3AZI A;  1F66 D;  3AYW A;  2BYM B;  5B1L A;  3MVD A;  4XUJ A;  3UTA A;  5GSU B;  3AZM C;  2Y2P A;  3W96 C;  3LJA B;  4NE3 A;  2LY8 A;  5B1M D;  3B0C T;  2L5A A;  5B2J C;  1WWS A;  1P3P C;  4NE6 A;  1KX3 C;  1JFI B;  3KFU G;  1B6W A;  4J8U C;  1KX5 A;  4H9S A;  3X1V A;  3AZN A;  3AZG C;  3TU4 D;  3REJ A;  5G49 B;  3MGS B;  4G92 C;  2YFW A;  3W97 A;  3X1T B;  5B0Z C;  2HUE C;  4QLC A;  3KXB B;  3A6N C;  3B0D B;  3P5J B;  1EQZ B;  3WA9 A;  2Y2L A;  1P3O D;  4E45 A;  3REK A;  3V9R A;  4J8X B;  3MGS D;  3AN2 C;  4Z2M G;  3X1T D;  2Y2M A;  3W99 C;  1M1A D;  1P34 C;  5DNN B;  3WKJ B;  3C1B B;  3KUY C;  3LEL C;  1P3A A;  5B24 C;  4CAY B;  1N1J B;  1P3L A;  4J8W B;  3AZK C;  4XZQ A;  3WAA C;  3MGP B;  3REI A;  4LD9 C;  3UT9 A;  3AYW B;  4H9Q B;  3MVD B;  5AY8 C;  3B0B A;  5DNN D;  3WKJ D;  1W2E A;  5B0Y C;  3C1B D;  4WU8 A;  5GXQ C;  2W8S A;  2G5H C;  1TAF A;  1S32 C;  3AZI D;  2CV5 B;  3B6G C;  2NZD C;  3AYW D;  3UTA D;  3MVD D;  4XUJ D;  3EPK A;  5GT0 C;  5AV8 A;  3MNN A;  3X1V B;  4WU9 C;  1M19 A;  3REL A;  3W98 A;  1P3B A;  3W97 B;  2PYO C;  3C1C C;  1U35 A;  1KX5 D;  5JRG A;  1TZY C;  3X1V D;  3REK B;  5B33 C;  3REJ D;  1P3G B;  3W97 D;  4H9P A;  3AZL A;  2ARO A;  4QLC D;  3LZ1 A;  1F66 C;  5BS7 A;  5B2I C;  1P3A B;  1P3L B;  1ZLA C;  3WA9 D;  1AOI A;  3REK D;  1P3F A;  3REI B;  5B1M C;  3AV2 A;  1P3G D;  3AZJ C;  3UT9 B;  1P3I B;  5C3I B;  5BT1 D;  4KHA A;  4E44 A;  1Z2C B;  5GSU C;  3AV1 A;  4YS3 A;  1P3A D;  1P3L D;  3B6F A;  4XZQ D;  3LJA C;  2Y2J A;  3REI D;  3AZE A;  3UT9 D;  4NFT A;  4ZUX A;  2BYK A;  3LZ0 C;  5AV8 B;  5AV5 A;  4WU8 D;  2Y2O A;  5AVC A;  3UTB C;  5B40 A;  3REL B;  5FUG A;  2ZY5 A;  1U35 B;  2ZY4 A;  5JA4 A;  5JRG B;  5AV8 D;  3X1T C;  3MNN D;  1M18 C;  3KXB C;  3B0D C;  2ZY2 A;  1M19 D;  3REL D;  3W98 D;  1EQZ C;  2HIO A;  1P3B D;  2RVQ D;  3AZF B;  4J8X C;  5B31 G;  1ID3 C;  1U35 D;  5JRG D;  5DNM B;  2YFV A;  4UUZ B;  5CPI B;  4KGC A;  3WTP E;  3WKJ C;  2Y2G A;  3C1B C;  2XD1 A;  3AV2 B;  4J8V A;  4J8W C;  3MGP C;  3AZL D;  2ARO D;  3LZ1 D;  3MGR A;  1P3K A;  5GT3 A;  1H3O A;  3MVD C;  5F99 A;  3AV1 B;  3FDD A;  1AOI D;  1F1E A;  1P3F D;  4DQY B;  3WTP A;  3AZE B;  3AV2 D;  4H9R A;  2BYK B;  2CV5 C;  3TU4 B;  2ZM5 A;  3AV1 D;  4YS3 D;  3B6F D;  4H9S C;  5B32 A;  5FUG B;  3AZE D;  2NQB A;  5JA4 B;  4ZUX D;  4KUD C;  5BO0 B;  3NQU A;  1KX4 A;  3W97 C;  2JSS A;  1P3O B;  5AV5 D;  5AVC D;  3AZH A;  3X1S A;  5B40 D;  3KWQ A;  4R8P A;  4JJN A;  1M1A B;  4H9O A;  3REK C;  3MGQ A;  5BNX A;  2F8N A;  1P3G C;  5CP6 A;  2YFV B;  4KGC B;  2DQN C;  5BT1 C;  2HIO D;  4EO5 B;  1P3A C;  1P3L C;  5BNV B;  5B2J A;  3REI C;  1P3P A;  1KX3 A;  1BH9 A;  3MGR B;  5AV6 B;  3UT9 C;  5CPK C;  1P3I C;  5C3I C;  5F99 B;  3AFA A;  4KGC D;  3AZI B;  3UTA B;  5B1L B;  4XUJ B;  3AZG A;  4J8V D;  4H9R B;  5B0Z A;  3MGR D;  5AV6 D;  1P3K D;  5GT3 D;  5F99 D;  3A6N A;  5AV8 C;  3WTP D;  4WZS B;  4NE5 A;  5B1L D;  3VH5 A;  1KX5 B;  2UWX A;  2NQB B;  2RVQ C;  3AZN B;  3VH5 W;  3REH C;  3W99 A;  3REJ B;  1P34 A;  4Z66 A;  1U35 C;  5E5A A;  2YFW B;  5JRG C;  3X1S B;  5CHL B;  3KUY A;  3KWQ B;  4R8P B;  5B32 D;  4JJN B;  4H9O B;  4QLC B;  3X1U A;  3AZK A;  4H9N A;  2F8N B;  3EPJ A;  2NQB D;  5CP6 B;  1KX4 D;  3WA9 B;  3AZF C;  3AZN D;  3V9R B;  5AY8 A;  3AZH D;  5BS7 C;  3X1S D;  5B0Y A;  4AWL B;  5DNM C;  5CPI C;  3B0C W;  4R8P D;  3KWQ D;  4JJN D;  5KDM A;  3MGQ D;  2F8N D;  1S32 A;  3AV2 C;  5CP6 D;  2NZD A;  4XZQ B;  3AFA B;  1P3M A;  3VH6 T;  3AV1 C;  1P3P D;  5B2J D;  5AV9 A;  4WU8 B;  3AZE C;  1KX3 D;  3AL0 C;  2PYO A;  4WNN A;  3C1C A;  3AFA D;  1TAF B;  3TU4 C;  1TZY A;  2BG1 A;  4Z5T A;  3AZG D;  5B33 A;  2F8N K;  3O62 A;  3MNN B;  3W99 B;  1M19 B;  4Z66 B;  3W98 B;  3A6N D;  5E5A B;  5B2I A;  1P3B B;  1P3O C;  3KUY B;  1ZLA A;  3MGS C;  3X1U B;  2Y2N A;  4H9N B;  1BH8 A;  1PZR A;  1M1A C;  3AZJ A;  4G91 B;  3W99 D;  1P34 D;  4Z66 D;  1ULY A;  5E5A D;  2G5I C;  2BYM A;  3KUY D;  4H9P B;  4KGC C;  5GSU A;  4M6B A;  2ARO B;  5KDM B;  3AZL B;  3LZ1 B;  3X1U D;  1A7W A;  3AZK D;  2FJ7 A;  3LJA A;  4EO5 C;  5DNN C;  1AOI B;  1P3F B;  3LZ0 A;  1B67 A;  5AY8 D;  1P3M B;  5AV6 C;  5B0Y D;  5F99 C;  3UTB A;  3NQJ A;  3AZI C;  3AYW C;  4KHA B;  5AV9 B;  3UTA C;  5B1L C;  1S32 D;  4XUJ C;  2NZD D;  4YS3 B;  4ZBJ B;  5G49 A;  3B6F B;  5CPJ A;  1P3M D; 
#chains in the Genus database with same CATH homology
 4Z5T B;  3KXB A;  1M18 A;  4ZUX B;  5B33 B;  1BFM A;  3O62 B;  4DRB A;  1EQZ A;  5AV5 B;  5AV9 D;  2Y2K A;  5AVC B;  1KX5 C;  5B31 A;  4J8X A;  1HQ3 A;  5B40 B;  1ID3 A;  3C1C D;  2PYO D;  5AVB A;  4X23 A;  3X1V C;  3AZN C;  3REJ C;  1TZY D;  4Z5T D;  3X1S C;  5B33 D;  3C1B A;  3O62 D;  2XD5 A;  1BH8 B;  3KWQ C;  4R8P C;  4JJN C;  4CAY A;  1N1J A;  2J8P A;  4QLC C;  4YM6 A;  3MGP A;  4J8W A;  2HIO B;  4WV4 B;  5CP6 C;  5B2I D;  3WA9 C;  4H9Q A;  4HGA B;  1ZLA D;  2FJ7 B;  2Y2H A;  4AWL C;  1T3U A;  3AZJ D;  3AZM A;  3LZ0 B;  3W96 A;  2CV5 A;  4J8V B;  2FFF B;  4XZQ C;  3AFA C;  5GSU D;  2FJ7 D;  3UTB B;  3F6T A;  3NQJ B;  3H0R C;  3LJA D;  1P3K B;  5GT3 B;  1H3O B;  4J8U A;  5CPJ B;  3LZ0 D;  4WU8 C;  3WTP B;  4KUD A;  2Y2I A;  1M18 B;  4CSR A;  3UTB D;  2IO5 B;  5B31 B;  1HQ3 B;  1ID3 B;  5CPJ D;  3R45 A;  5AVB B;  4X23 B;  3MNN C;  1P3G A;  5B32 B;  3H0M C;  3A1I A;  1M19 C;  4Z66 C;  4UPK A;  3KXB D;  3REL C;  1M18 D;  5E5A C;  1P3B C;  3W98 C;  3NQU B;  3AN2 A;  1KX4 B;  1EQZ D;  4YM6 B;  3X1U C;  3AZH B;  5B31 D;  4J8X D;  1HQ3 D;  1ID3 D;  5AVB D;  4X23 D;  3LEL A;  1P3I A;  5B24 A;  1WWI A;  4G91 C;  5CPK A;  3MGQ B;  4DRA A;  5BNX B;  3WAA A;  4LD9 A;  3AZL C;  2ARO C;  3AZM B;  4YM6 D;  3LZ1 C;  3MGP D;  4J8W D;  3W96 B;  5GXQ A;  1AOI C;  1P3F C;  1P3P B;  5B2J B;  1KX3 B;  1BH9 B;  1P3M C;  3B6G A;  4J8U B;  4WJ3 C;  5GT0 A;  3AZM D;  4KUD B;  3W96 D;  5AV9 C;  3EPH A;  2CV5 D;  3AZG B;  4YS3 C;  4ZBJ C;  3REH A;  4WU9 A;  3B6F C;  4G92 B;  4CSR B;  3H0L C;  5B0Z B;  2HUE B;  4Z5T C;  4J8U D;  4ZUX C;  3A6N B;  1HTA A;  3O62 C;  3R45 B;  5AV5 C;  4KUD D;  3IP4 C;  5AVC C;  3AZF A;  5B40 C;  2F8N H;  3AN2 B;  5DNM A;  5B0Z D;  4UUZ A;  5CPI A;  1P34 B;  1F66 A;  2CWE A;  2JCH A;  3EG5 B;  3LEL B;  5B24 B;  5CPK B;  3AZK B;  3WAA B;  5B1M A;  2HIO C;  3AN2 D;  4LD9 B;  4HGA C;  2FJ7 C;  5AY8 B;  3EPL A;  5B0Y B;  3LEL D;  5GXQ B;  1P3I D;  5B24 D;  5CPK D;  3WAA D;  2DF4 C;  1S32 B;  3B6G B;  3TU4 A;  4J8V C;  4LD9 D;  2NZD B;  2JE5 A;  1JFI A;  5GT0 B;  3MGR C;  1P3K C;  5GT3 C;  2VQR A;  5GXQ D;  3REH B;  4WU9 B;  3KSY A;  5CPJ C;  2F2A C;  5BO0 A;  3WTP C;  2ZY3 A;  1P3O A;  3B6G D;  4Z2M H;  2PYO B;  4WNN B;  3MGS A;  3C1C B;  2Y2Q A;  2RIQ A;  5GT0 D;  3X1T A;  2IO5 C;  1M1A A;  1TZY B;  5B31 C;  4WU9 D;  1HQ3 C;  3REH D;  5AVB C;  4X23 C;  5B32 C;  5B32 G;  2NQB C;  1F66 B;  1Q9C A;  5B2I B;  1KX4 C;  1KU5 A;  1R4V A;  3VH6 A;  1ZLA B;  4YM6 C;  5DNN A;  3VH5 T;  3AZH C;  3AZF D;  3WKJ A;  5BNV A;  5B1M B;  3VH6 W;  5AV6 A;  3AZJ B;  5DNM D;  3MGQ C;  5CPI D;  3A1K A;  2F8N G;  3AZI A;  1F66 D;  3AYW A;  2BYM B;  5B1L A;  3MVD A;  4XUJ A;  3UTA A;  5GSU B;  3AZM C;  2Y2P A;  3W96 C;  3LJA B;  4NE3 A;  2LY8 A;  5B1M D;  3B0C T;  2L5A A;  5B2J C;  1WWS A;  1P3P C;  4NE6 A;  1KX3 C;  1JFI B;  3KFU G;  1B6W A;  4J8U C;  1KX5 A;  4H9S A;  3X1V A;  3AZN A;  3AZG C;  3TU4 D;  3REJ A;  5G49 B;  3MGS B;  4G92 C;  2YFW A;  3W97 A;  3X1T B;  5B0Z C;  2HUE C;  4QLC A;  3KXB B;  3A6N C;  3B0D B;  3P5J B;  1EQZ B;  3WA9 A;  2Y2L A;  1P3O D;  4E45 A;  3REK A;  3V9R A;  4J8X B;  3MGS D;  3AN2 C;  4Z2M G;  3X1T D;  2Y2M A;  3W99 C;  1M1A D;  1P34 C;  5DNN B;  3WKJ B;  3C1B B;  3KUY C;  3LEL C;  1P3A A;  5B24 C;  4CAY B;  1N1J B;  1P3L A;  4J8W B;  3AZK C;  4XZQ A;  3WAA C;  3MGP B;  3REI A;  4LD9 C;  3UT9 A;  3AYW B;  4H9Q B;  3MVD B;  5AY8 C;  3B0B A;  5DNN D;  3WKJ D;  1W2E A;  5B0Y C;  3C1B D;  4WU8 A;  5GXQ C;  2W8S A;  2G5H C;  1TAF A;  1S32 C;  3AZI D;  2CV5 B;  3B6G C;  2NZD C;  3AYW D;  3UTA D;  3MVD D;  4XUJ D;  3EPK A;  5GT0 C;  5AV8 A;  3MNN A;  3X1V B;  4WU9 C;  1M19 A;  3REL A;  3W98 A;  1P3B A;  3W97 B;  2PYO C;  3C1C C;  1U35 A;  1KX5 D;  5JRG A;  1TZY C;  3X1V D;  3REK B;  5B33 C;  3REJ D;  1P3G B;  3W97 D;  4H9P A;  3AZL A;  2ARO A;  4QLC D;  3LZ1 A;  1F66 C;  5BS7 A;  5B2I C;  1P3A B;  1P3L B;  1ZLA C;  3WA9 D;  1AOI A;  3REK D;  1P3F A;  3REI B;  5B1M C;  3AV2 A;  1P3G D;  3AZJ C;  3UT9 B;  1P3I B;  5C3I B;  5BT1 D;  4KHA A;  4E44 A;  1Z2C B;  5GSU C;  3AV1 A;  4YS3 A;  1P3A D;  1P3L D;  3B6F A;  4XZQ D;  3LJA C;  2Y2J A;  3REI D;  3AZE A;  3UT9 D;  4NFT A;  4ZUX A;  2BYK A;  3LZ0 C;  5AV8 B;  5AV5 A;  4WU8 D;  2Y2O A;  5AVC A;  3UTB C;  5B40 A;  3REL B;  5FUG A;  2ZY5 A;  1U35 B;  2ZY4 A;  5JA4 A;  5JRG B;  5AV8 D;  3X1T C;  3MNN D;  1M18 C;  3KXB C;  3B0D C;  2ZY2 A;  1M19 D;  3REL D;  3W98 D;  1EQZ C;  2HIO A;  1P3B D;  2RVQ D;  3AZF B;  4J8X C;  5B31 G;  1ID3 C;  1U35 D;  5JRG D;  5DNM B;  2YFV A;  4UUZ B;  5CPI B;  4KGC A;  3WTP E;  3WKJ C;  2Y2G A;  3C1B C;  2XD1 A;  3AV2 B;  4J8V A;  4J8W C;  3MGP C;  3AZL D;  2ARO D;  3LZ1 D;  3MGR A;  1P3K A;  5GT3 A;  1H3O A;  3MVD C;  5F99 A;  3AV1 B;  3FDD A;  1AOI D;  1F1E A;  1P3F D;  4DQY B;  3WTP A;  3AZE B;  3AV2 D;  4H9R A;  2BYK B;  2CV5 C;  3TU4 B;  2ZM5 A;  3AV1 D;  4YS3 D;  3B6F D;  4H9S C;  5B32 A;  5FUG B;  3AZE D;  2NQB A;  5JA4 B;  4ZUX D;  4KUD C;  5BO0 B;  3NQU A;  1KX4 A;  3W97 C;  2JSS A;  1P3O B;  5AV5 D;  5AVC D;  3AZH A;  3X1S A;  5B40 D;  3KWQ A;  4R8P A;  4JJN A;  1M1A B;  4H9O A;  3REK C;  3MGQ A;  5BNX A;  2F8N A;  1P3G C;  5CP6 A;  2YFV B;  4KGC B;  2DQN C;  5BT1 C;  2HIO D;  4EO5 B;  1P3A C;  1P3L C;  5BNV B;  5B2J A;  3REI C;  1P3P A;  1KX3 A;  1BH9 A;  3MGR B;  5AV6 B;  3UT9 C;  5CPK C;  1P3I C;  5C3I C;  5F99 B;  3AFA A;  4KGC D;  3AZI B;  3UTA B;  5B1L B;  4XUJ B;  3AZG A;  4J8V D;  4H9R B;  5B0Z A;  3MGR D;  5AV6 D;  1P3K D;  5GT3 D;  5F99 D;  3A6N A;  5AV8 C;  3WTP D;  4WZS B;  4NE5 A;  5B1L D;  3VH5 A;  1KX5 B;  2UWX A;  2NQB B;  2RVQ C;  3AZN B;  3VH5 W;  3REH C;  3W99 A;  3REJ B;  1P34 A;  4Z66 A;  1U35 C;  5E5A A;  2YFW B;  5JRG C;  3X1S B;  5CHL B;  3KUY A;  3KWQ B;  4R8P B;  5B32 D;  4JJN B;  4H9O B;  4QLC B;  3X1U A;  3AZK A;  4H9N A;  2F8N B;  3EPJ A;  2NQB D;  5CP6 B;  1KX4 D;  3WA9 B;  3AZF C;  3AZN D;  3V9R B;  5AY8 A;  3AZH D;  5BS7 C;  3X1S D;  5B0Y A;  4AWL B;  5DNM C;  5CPI C;  3B0C W;  4R8P D;  3KWQ D;  4JJN D;  5KDM A;  3MGQ D;  2F8N D;  1S32 A;  3AV2 C;  5CP6 D;  2NZD A;  4XZQ B;  3AFA B;  1P3M A;  3VH6 T;  3AV1 C;  1P3P D;  5B2J D;  5AV9 A;  4WU8 B;  3AZE C;  1KX3 D;  3AL0 C;  2PYO A;  4WNN A;  3C1C A;  3AFA D;  1TAF B;  3TU4 C;  1TZY A;  2BG1 A;  4Z5T A;  3AZG D;  5B33 A;  2F8N K;  3O62 A;  3MNN B;  3W99 B;  1M19 B;  4Z66 B;  3W98 B;  3A6N D;  5E5A B;  5B2I A;  1P3B B;  1P3O C;  3KUY B;  1ZLA A;  3MGS C;  3X1U B;  2Y2N A;  4H9N B;  1BH8 A;  1PZR A;  1M1A C;  3AZJ A;  4G91 B;  3W99 D;  1P34 D;  4Z66 D;  1ULY A;  5E5A D;  2G5I C;  2BYM A;  3KUY D;  4H9P B;  4KGC C;  5GSU A;  4M6B A;  2ARO B;  5KDM B;  3AZL B;  3LZ1 B;  3X1U D;  1A7W A;  3AZK D;  2FJ7 A;  3LJA A;  4EO5 C;  5DNN C;  1AOI B;  1P3F B;  3LZ0 A;  1B67 A;  5AY8 D;  1P3M B;  5AV6 C;  5B0Y D;  5F99 C;  3UTB A;  3NQJ A;  3AZI C;  3AYW C;  4KHA B;  5AV9 B;  3UTA C;  5B1L C;  1S32 D;  4XUJ C;  2NZD D;  4YS3 B;  4ZBJ B;  5G49 A;  3B6F B;  5CPJ A;  1P3M D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...