3AZLD

Crystal structure of human nucleosome core particle containing h4k77q mutation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.1
publication title Comprehensive Structural Analysis of Mutant Nucleosomes Containing Lysine to Glutamine (KQ) Substitutions in the H3 and H4 Histone-Fold Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 37
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3azlD00
3UT9B 1P3LA 4XZQD 5AV6C 2NZDA 3MGQD 1U35D 1KX3C 3AZMA 1KX5C 5JRGC 3W98A 1S32A 3B6FC 3REHA 2YFVB 5DNMA 3WA9C 5B31B 3KWQC 3KXBB 3AZEC 3WTPE 3AZKA 3NQJA 3UT9C 5FUGA 3AZNC 3NQUA 3REJD 1P34C 4KUDB 3VH5T 5AV6D 3AZID 1KX3D 1KX5D 4KGCC 1P3IA 1WWSA 5B31C 2IO5B 1A7WA 1M1AC 2F8NH 5JA4A 3KWQD 1BH9A 3WTPC 5B32B 4Z5TB 4WZSB 3AZND 1P3AB 3UT9D 4HGAC 1P34D 4UUZB 5B0YB 4ZBJC 4KGCD 3RELA 5B31D 1F66B 3KXBD 4H9NB 1M1AD 4Z5TC 5B2IA 5DNNC 1JFIB 3B0CW 3WTPD 3MGPC 4KUDD 1BFMA 4J8XA 1ZLAB 2NQBC 4QLCC 3AYWA 1P3PC 3X1SA 5B24C 3W96B 1F66C 4AWLC 3LJAB 1HQ3B 5BS7A 5E5AC 4J8VA 3WAAB 4Z2MH 5B32D 4Z5TD 4ZUXA 1P3AD 5B33A 1ZLAC 3MGPD 3AZFB 3AFAC 5B0YD 1ULYA 3X1TA 1P3PD 5CPKA 2CV5A 2F8NB 1F66D 3LZ0C 3AZLB 4NE5A 1EQZA 1AOIB 3MGSB 5E5AD 4NE3A 4H9SC 3AZFC 3UTAA 1ZLAD 5B2JB 3REIB 3B0CT 5GT0A 3LJAD 1HQ3D 3MGSC 3LZ0D 2AROC 3WAAD 5CPIC 4J8UA 2PYOA 3WKJA 5B40A 3B6GB 3AN2B 5B1MB 4WV4B 3W97A 3AZFD 2F8ND 3C1CA 3AZLD 4H9NA 3AV1B 5AV5B 3MGSD 2AROD 3AZHA 1JFIA 3O62B 5CPID 3AV2C 5AV9B 4R8PC 1P3GB 1P3KA 5BNXA 1HTAA 2CWEA 3W96A 1P3MB 5AV8B 3AV1C 5AV5C 3VH6A 3MGQB 3LZ1B 5AY8B 4LD9B 4H9OB 5AV9C 3B6GD 1P3GC 5B1MD 1P3LC 3AV2D 2NZDC 4R8PD 3A6NA 4NE6A 5G49B 1P3MC 4Z66B 5GXQC 4KHAA 3REHC 5B1LB 5DNMC 4LD9C 3AV1D 1P3OA 5AVBB 5AV5D 1AOIA 5CPJA 5AV6B 2BYMA 1KX5B 5AV9D 5JRGB 1TZYC 1P3GD 3B6FB 5B2JA 4Z66C 3REIA 3WA9B 4J8WA 4WU8C 3KWQB 1ID3A 2FJ7A 1P3MD 3W99A 4CSRA 5GXQD 3AZEB 3AZGB 1P34B 4LD9D 3LZ1D 5AY8D 3V9RB 1KU5A 4JJNC 3AN2A 4KGCB 3REKA 1TZYD 3C1BC 1M1AB 4Z66D 4WU8D 3MVDC 5B1LD 3AZGC 4CAYB 3TU4A 3WTPB 5AVBD 4HGAB 3O62A 4X23A 5B2IC 5KDMB 5JRGD 4E44A 3B6FD 4JJND 4J8XC 4ZBJB 3KUYA 3WA9D 4XUJA 3X1VC 3C1BD 5B0ZB 5AV8A 3AZED 3MVDD 3AZGD 5DNNB 3LELC 1P3FA 4XZQA 1P3BB 3MGPB 3MGQA 1U35A 4H9OA 4J8VC 2NQBB 4QLCB 5F99B 1P3PB 5B24B 5CHLB 1H3OB 5GSUB 4AWLB 4EO5B 5B0ZC 3X1TC 3X1VD 5E5AB 3MGRC 2CV5C 3REJA 1P3BC 3LELD 5F99C 5AV6A 3AZIA 1EQZC 1KX3A 5AVCB 3AFAB 5GSUC 1N1JA 4EO5C 3MNNC 5GT3C 1TAFB 3LZ0B 3KWQA 5B0ZD 5BT1C 3AZNA 1H3OA 4G92B 4H9RB 5DNND 3MGRD 3UT9A 3B0BA 2CV5D 1P3BD 1P34A 3B0DB 5AVCC 1M18C 2NQBD 4J8UC 4QLCD 5F99D 2PYOC 1BH8B 5B40C 5B24D 2YFVA 5GSUD 5B31A 3X1UB 3MNND 4YM6B 3KXBA 5GT3D 3W97C 1M1AA 4G92C 2AROB 5CPIB 3B0DC 4KUDA 3C1CC 4G91B 4H9QB 4YS3B 5AVCD 1M18D 3AFAD 3X1UC 4YM6C 5BO0B 4WU9B 1B67A 2HIOB 5B32A 4Z5TA 4G91C 1P3AA 4H9PB 3AZJB 5BNVB 4UUZA 4YS3C 3AV2B 3C1CD 4R8PB 5B0YA 2L5AA 4E45A 3UTBB 1P3PA 5B31G 1F66A 4WU9C 3X1UD 1WWIA 3VH6W 4YM6D 2HIOC 3A6NC 1M19B 5CP6C 1KX4B 3AZJC 3UTBC 2LY8A 1ZLAA 2BYKB 4YS3D 1P3LB 2NZDB 5GXQB 2JSSA 3LJAA 1HQ3A 3REHB 4WU9D 1M19C 3LZ0A 5B32G 5DNMB 4J8WC 1KX4C 3WAAA 2HIOD 1ID3C 2FJ7C 3W99C 5CP6D 3AZJD 3AZKB 3NQJB 5FUGB 3NQUB 1TZYB 3AZFA 3UTBD 3AZMC 3W98C 1S32C 4WU8B 2F8NA 3R45B 3REKC 3AZLA 3MGSA 1M19D 2AROA 1KX4D 3AZKC 1BH9B 3VH6T 3TU4C 4JJNB 1P3LD 2NZDD 3AZMD 3C1BB 1P3IC 3W98D 1S32D 3MVDB 3REHD 5DNMD 3KSYA 2HUEC 3VH5W 3B6GA 3AZKD 5B1MA 5BNVA 5B2IB 3AV2A 4XZQC 4R8PA 1U35C 4J8XB 2F8NG 3X1VB 3RELC 1P3ID 3AV1A 5AV5A 3LELB 5C3IB 4J8VB 3VH5A 5AV9A 3REJC 1P3GA 4ZUXB 5B33B 3AYWC 3AZIC 3X1SC 1P3MA 5GXQA 3X1TB 5CPKB 4NFTA 5C3IC 3MGRB 3RELD 2CV5B 5BS7C 4LD9A 3LZ1A 5AY8A 1EQZB 4ZUXC 1Q9CA 5B2ID 5B33C 1TZYA 3MNNB 5G49A 4J8XD 5GT3B 3UTAB 4Z66A 3AYWD 4WU8A 3X1SD 5B1LA 4M6BA 4Z2MG 5CPKC 3R45A 5GT0B 2RVQC 5AVBA 3KXBC 1KX5A 4J8VD 1M18B 5JRGA 4J8UB 2PYOB 3B6FA 4JJNA 3WKJB 4ZUXD 5B40B 4KUDC 3UTAC 5B33D 3WA9A 3C1BA 3W97B 4WNNB 5GT0C 2IO5C 3X1TD 3AZEA 3MVDA 3AZGA 5CPKD 2RVQD 3V9RA 2YFWB 3C1CB 5B32C 3WKJC 1EQZD 3AZHB 1P3AC 4KGCA 1P3KB 3UTAD 5BNXB 5B0YC 3X1VA 4CAYA 5BT1D 5GT0D 1F1EA 3WTPA 3LELA 2BYKA 3AZHC 5KDMA 4J8UD 2PYOD 3WKJD 5B40D 1P3KC 3W97D 5B0ZA 3W96C 3A6NB 5CP6B 5DNNA 3MGRA 3LJAC 1P3BA 1HQ3C 4KHAB 3MGPA 3WAAC 2NQBA 4QLCA 5F99A 1P3OB 5CPJB 3AZHD 4DRAA 5B24A 2BYMB 5GSUA 3MNNA 1P3KD 5GT3A 5E5AA 4J8WB 3W96D 1R4VA 1ID3B 2FJ7B 3W99B 4CSRB 3AZLC 1P3OC 2F8NK 1AOIC 5CPJC 5AVCA 1M18A 3AFAA 3AZMB 3W98B 1S32B 1TAFA 1B6WA 5B2JC 3REIC 3REKB 4WNNA 3A6ND 4H9RA 4H9SA 2YFWA 3TU4B 1P3OD 1AOID 1BH8A 5CPJD 3B6GC 3AN2C 4X23B 5B1MC 3X1UA 1P3IB 4YM6A 3KUYB 5B2JD 3REID 4XUJB 4J8WD 5CPIA 5JA4B 2HUEB 1ID3D 4DRBA 3W99D 2FJ7D 4H9QA 4YS3A 1P3FB 4XZQB 3O62C 1U35B 4X23C 3AN2D 5BO0A 3KUYC 4WU9A 3RELB 3REKD 4XUJC 2HIOA 5CP6A 5AV8C 4H9PA 3AZJA 1P3FC 3TU4D 3REJB 3MGQC 3LZ1C 5AY8C 3UTBA 3AYWB 3AZIB 3O62D 1KX3B 3X1SB 4X23D 1N1JB 3KUYD 1M19A 4XUJD 1KX4A 5B1LC 5AV8D 3AZNB 5AVBC 1P3FD
chains in the Genus database with same CATH superfamily
3UT9B 1P3LA 4XZQD 5AV6C 2NZDA 3MGQD 1U35D 1KX3C 3AZMA 1KX5C 5JRGC 3W98A 1S32A 3B6FC 3REHA 2YFVB 5DNMA 3WA9C 5B31B 3KWQC 3KXBB 2ZY2A 3AZEC 3WTPE 3AZKA 3NQJA 3UT9C 5FUGA 2ZY4A 3AZNC 3NQUA 3REJD 2Y2HA 1P34C 4KUDB 3VH5T 5AV6D 3AZID 3FDDA 1KX3D 1KX5D 4KGCC 1P3IA 1WWSA 5B31C 2IO5B 1A7WA 1M1AC 3P5JB 2F8NH 4WJ3C 5JA4A 3KWQD 1BH9A 3WTPC 5B32B 4Z5TB 4WZSB 3AZND 2G5HC 1P3AB 3UT9D 4HGAC 1P34D 4UUZB 5B0YB 4ZBJC 4KGCD 3RELA 5B31D 1F66B 3KXBD 4H9NB 1M1AD 4Z5TC 2JE5A 5B2IA 5DNNC 4UPKA 3B0CW 1JFIB 3H0RC 3WTPD 3MGPC 4KUDD 3F6TA 1BFMA 4J8XA 1ZLAB 2NQBC 4QLCC 3AYWA 1P3PC 3X1SA 5B24C 3W96B 1F66C 4AWLC 3LJAB 1HQ3B 5BS7A 5E5AC 4J8VA 3WAAB 4Z2MH 5B32D 4Z5TD 4ZUXA 1P3AD 5B33A 1ZLAC 3MGPD 3AZFB 3AFAC 5B0YD 4DQYB 1ULYA 3X1TA 1P3PD 5CPKA 2CV5A 2F8NB 1F66D 3LZ0C 3AZLB 4NE5A 1EQZA 1AOIB 3MGSB 5E5AD 4NE3A 4H9SC 3AZFC 3UTAA 1ZLAD 2Y2GA 5B2JB 3REIB 3B0CT 5GT0A 3EPHA 3LJAD 1HQ3D 3MGSC 3LZ0D 2AROC 3WAAD 5CPIC 4J8UA 2PYOA 3WKJA 5B40A 2W8SA 3B6GB 3AN2B 5B1MB 4WV4B 3W97A 3AZFD 2F8ND 3C1CA 3AZLD 4H9NA 3AV1B 5AV5B 3MGSD 2AROD 3AZHA 1JFIA 3O62B 5CPID 3AV2C 5AV9B 4R8PC 1P3GB 1P3KA 5BNXA 1HTAA 2CWEA 3W96A 2Y2QA 1P3MB 5AV8B 3AV1C 5AV5C 3VH6A 3MGQB 3LZ1B 5AY8B 4LD9B 4H9OB 5AV9C 3B6GD 1P3GC 5B1MD 1P3LC 3AV2D 2NZDC 4R8PD 3A6NA 4NE6A 5G49B 2DF4C 1P3MC 4Z66B 5GXQC 4KHAA 3REHC 5B1LB 5DNMC 2RIQA 4LD9C 3AV1D 1P3OA 5AVBB 5AV5D 1AOIA 5CPJA 5AV6B 2BYMA 1KX5B 5AV9D 5JRGB 1TZYC 1P3GD 2Y2OA 3B6FB 5B2JA 4Z66C 3REIA 3WA9B 4J8WA 4WU8C 2G5IC 3KWQB 1ID3A 2FJ7A 1P3MD 3W99A 4CSRA 5GXQD 3AZEB 3AZGB 1P34B 4LD9D 3LZ1D 5AY8D 3EG5B 3V9RB 1KU5A 4JJNC 3AN2A 4KGCB 3REKA 1TZYD 3EPJA 3C1BC 1M1AB 4Z66D 4WU8D 3MVDC 5B1LD 3AZGC 4CAYB 3TU4A 3WTPB 2Y2IA 5AVBD 3H0MC 4HGAB 3O62A 4X23A 5B2IC 5KDMB 5JRGD 4E44A 3B6FD 4JJND 4J8XC 4ZBJB 3KUYA 3WA9D 4XUJA 3X1VC 3C1BD 5B0ZB 3IP4C 5AV8A 3AZED 3MVDD 3AZGD 5DNNB 3LELC 1P3FA 4XZQA 1P3BB 3MGPB 3MGQA 1U35A 4H9OA 4J8VC 2NQBB 4QLCB 5F99B 1P3PB 5B24B 5CHLB 1H3OB 5GSUB 4AWLB 4EO5B 5B0ZC 3X1TC 3X1VD 5E5AB 3MGRC 2CV5C 3REJA 1P3BC 3LELD 5F99C 5AV6A 3AZIA 1EQZC 1W2EA 1KX3A 5AVCB 3AFAB 5GSUC 1N1JA 4EO5C 3MNNC 2XD1A 5GT3C 1TAFB 3LZ0B 3KWQA 5B0ZD 5BT1C 3AZNA 1H3OA 4G92B 4H9RB 5DNND 3MGRD 3UT9A 3B0BA 2CV5D 1P3BD 1P34A 3B0DB 5AVCC 1M18C 2NQBD 4J8UC 4QLCD 5F99D 2PYOC 1BH8B 5B40C 5B24D 2YFVA 5GSUD 5B31A 2ZM5A 3X1UB 3MNND 4YM6B 3KXBA 5GT3D 3W97C 1M1AA 1PZRA 4G92C 2AROB 5CPIB 3B0DC 4KUDA 3C1CC 4G91B 4H9QB 4YS3B 5AVCD 1M18D 3AFAD 3X1UC 4YM6C 5BO0B 4WU9B 1B67A 2HIOB 5B32A 4Z5TA 4G91C 1P3AA 2Y2JA 4H9PB 3AZJB 5BNVB 4UUZA 4YS3C 3AV2B 3C1CD 4R8PB 5B0YA 2L5AA 4E45A 3UTBB 1P3PA 5B31G 1F66A 4WU9C 3X1UD 3AL0C 1WWIA 3VH6W 4YM6D 2HIOC 2VQRA 3A6NC 1M19B 5CP6C 1KX4B 3AZJC 3UTBC 2LY8A 1ZLAA 2BYKB 4YS3D 1P3LB 2NZDB 5GXQB 2FFFB 2JSSA 3LJAA 1HQ3A 3REHB 4WU9D 1M19C 3LZ0A 5B32G 5DNMB 4J8WC 1KX4C 3WAAA 2HIOD 1ID3C 2FJ7C 3W99C 5CP6D 3AZJD 3AZKB 3NQJB 5FUGB 1Z2CB 3NQUB 1TZYB 3AZFA 3UTBD 3AZMC 3W98C 1S32C 4WU8B 2F8NA 3R45B 3REKC 3AZLA 3A1KA 3MGSA 1M19D 2AROA 1KX4D 3AZKC 1BH9B 3VH6T 3TU4C 4JJNB 1P3LD 2NZDD 3AZMD 3C1BB 1P3IC 3W98D 1S32D 3KFUG 3MVDB 3REHD 5DNMD 3KSYA 2HUEC 3VH5W 3B6GA 3AZKD 5B1MA 5BNVA 5B2IB 3AV2A 4XZQC 4R8PA 2JCHA 2UWXA 1U35C 4J8XB 2F8NG 3X1VB 3RELC 1P3ID 2XD5A 3AV1A 5AV5A 3LELB 5C3IB 4J8VB 3VH5A 5AV9A 3REJC 1P3GA 4ZUXB 2Y2NA 5B33B 2F2AC 3AYWC 3AZIC 3X1SC 1P3MA 5GXQA 3X1TB 5CPKB 4NFTA 5C3IC 3MGRB 3RELD 2CV5B 2Y2KA 5BS7C 3LZ1A 5AY8A 4LD9A 3EPLA 1EQZB 4ZUXC 1Q9CA 5B2ID 5B33C 1TZYA 3MNNB 5G49A 4J8XD 5GT3B 3UTAB 4Z66A 3AYWD 4WU8A 3X1SD 5B1LA 4M6BA 4Z2MG 5CPKC 3R45A 5GT0B 2RVQC 5AVBA 3KXBC 1KX5A 4J8VD 1M18B 5JRGA 4J8UB 2PYOB 3B6FA 4JJNA 3WKJB 4ZUXD 5B40B 4KUDC 3UTAC 5B33D 3WA9A 3C1BA 3W97B 4WNNB 5GT0C 2IO5C 3X1TD 3AZEA 3MVDA 3AZGA 5CPKD 2RVQD 3V9RA 2YFWB 3C1CB 5B32C 3WKJC 1EQZD 3AZHB 1P3AC 4KGCA 1P3KB 3UTAD 5BNXB 5B0YC 3X1VA 4CAYA 5BT1D 5GT0D 1F1EA 3WTPA 3LELA 2BYKA 3AZHC 5KDMA 4J8UD 2PYOD 3WKJD 5B40D 1P3KC 3W97D 5B0ZA 3W96C 3A6NB 5CP6B 5DNNA 3MGRA 3LJAC 1P3BA 1HQ3C 4KHAB 3MGPA 3WAAC 2NQBA 4QLCA 5F99A 1P3OB 5CPJB 3AZHD 4DRAA 5B24A 2BYMB 5GSUA 3MNNA 1P3KD 5GT3A 2Y2LA 5E5AA 4J8WB 3W96D 1R4VA 1ID3B 2FJ7B 3W99B 4CSRB 3AZLC 1P3OC 2F8NK 1AOIC 5CPJC 5AVCA 1M18A 3AFAA 2Y2PA 3AZMB 3W98B 1S32B 1TAFA 1B6WA 5B2JC 3REIC 3REKB 4WNNA 3A6ND 2BG1A 4H9RA 3A1IA 4H9SA 2YFWA 3TU4B 3H0LC 1P3OD 1AOID 1BH8A 5CPJD 3B6GC 3AN2C 4X23B 5B1MC 3X1UA 1P3IB 4YM6A 2ZY3A 3KUYB 5B2JD 3REID 4XUJB 4J8WD 5CPIA 3EPKA 5JA4B 2HUEB 1ID3D 4DRBA 3W99D 2FJ7D 4H9QA 4YS3A 1P3FB 4XZQB 3O62C 1U35B 4X23C 1T3UA 3AN2D 5BO0A 3KUYC 4WU9A 3RELB 3REKD 4XUJC 2HIOA 5CP6A 5AV8C 4H9PA 3AZJA 1P3FC 3TU4D 3REJB 3MGQC 3LZ1C 5AY8C 3UTBA 2Y2MA 3AYWB 3AZIB 3O62D 1KX3B 3X1SB 2DQNC 4X23D 1N1JB 3KUYD 1M19A 4XUJD 1KX4A 2ZY5A 5B1LC 2J8PA 5AV8D 3AZNB 5AVBC 1P3FD
chains in the Genus database with same CATH topology
3UT9B 1P3LA 4XZQD 5AV6C 2NZDA 3MGQD 1U35D 1KX3C 3AZMA 1KX5C 5JRGC 3W98A 1S32A 3B6FC 3REHA 2YFVB 5DNMA 3WA9C 5B31B 3KWQC 3KXBB 2ZY2A 3AZEC 3WTPE 3AZKA 3NQJA 3UT9C 5FUGA 2ZY4A 3AZNC 3NQUA 3REJD 2Y2HA 1P34C 4KUDB 3VH5T 5AV6D 3AZID 3FDDA 1KX3D 1KX5D 4KGCC 1P3IA 1WWSA 5B31C 2IO5B 1A7WA 1M1AC 3P5JB 2F8NH 4WJ3C 5JA4A 3KWQD 1BH9A 3WTPC 5B32B 4Z5TB 4WZSB 3AZND 2G5HC 1P3AB 3UT9D 4HGAC 1P34D 4UUZB 5B0YB 4ZBJC 4KGCD 3RELA 5B31D 1F66B 3KXBD 4H9NB 1M1AD 4Z5TC 2JE5A 5B2IA 5DNNC 4UPKA 3B0CW 1JFIB 3H0RC 3WTPD 3MGPC 4KUDD 3F6TA 1BFMA 4J8XA 1ZLAB 2NQBC 4QLCC 3AYWA 1P3PC 3X1SA 5B24C 3W96B 1F66C 4AWLC 3LJAB 1HQ3B 5BS7A 5E5AC 4J8VA 3WAAB 4Z2MH 5B32D 4Z5TD 4ZUXA 1P3AD 5B33A 1ZLAC 3MGPD 3AZFB 3AFAC 5B0YD 4DQYB 1ULYA 3X1TA 1P3PD 5CPKA 2CV5A 2F8NB 1F66D 3LZ0C 3AZLB 4NE5A 1EQZA 1AOIB 3MGSB 5E5AD 4NE3A 4H9SC 3AZFC 3UTAA 1ZLAD 2Y2GA 5B2JB 3REIB 3B0CT 5GT0A 3EPHA 3LJAD 1HQ3D 3MGSC 3LZ0D 2AROC 3WAAD 5CPIC 4J8UA 2PYOA 3WKJA 5B40A 2W8SA 3B6GB 3AN2B 5B1MB 4WV4B 3W97A 3AZFD 2F8ND 3C1CA 3AZLD 4H9NA 3AV1B 5AV5B 3MGSD 2AROD 3AZHA 1JFIA 3O62B 5CPID 3AV2C 5AV9B 4R8PC 1P3GB 1P3KA 5BNXA 1HTAA 2CWEA 3W96A 2Y2QA 1P3MB 5AV8B 3AV1C 5AV5C 3VH6A 3MGQB 3LZ1B 5AY8B 4LD9B 4H9OB 5AV9C 3B6GD 1P3GC 5B1MD 1P3LC 3AV2D 2NZDC 4R8PD 3A6NA 4NE6A 5G49B 2DF4C 1P3MC 4Z66B 5GXQC 4KHAA 3REHC 5B1LB 5DNMC 2RIQA 4LD9C 3AV1D 1P3OA 5AVBB 5AV5D 1AOIA 5CPJA 5AV6B 2BYMA 1KX5B 5AV9D 5JRGB 1TZYC 1P3GD 2Y2OA 3B6FB 5B2JA 4Z66C 3REIA 3WA9B 4J8WA 4WU8C 2G5IC 3KWQB 1ID3A 2FJ7A 1P3MD 3W99A 4CSRA 5GXQD 3AZEB 3AZGB 1P34B 4LD9D 3LZ1D 5AY8D 3EG5B 3V9RB 1KU5A 4JJNC 3AN2A 4KGCB 3REKA 1TZYD 3EPJA 3C1BC 1M1AB 4Z66D 4WU8D 3MVDC 5B1LD 3AZGC 4CAYB 3TU4A 3WTPB 2Y2IA 5AVBD 3H0MC 4HGAB 3O62A 4X23A 5B2IC 5KDMB 5JRGD 4E44A 3B6FD 4JJND 4J8XC 4ZBJB 3KUYA 3WA9D 4XUJA 3X1VC 3C1BD 5B0ZB 3IP4C 5AV8A 3AZED 3MVDD 3AZGD 5DNNB 3LELC 1P3FA 4XZQA 1P3BB 3MGPB 3MGQA 1U35A 4H9OA 4J8VC 2NQBB 4QLCB 5F99B 1P3PB 5B24B 5CHLB 1H3OB 5GSUB 4AWLB 4EO5B 5B0ZC 3X1TC 3X1VD 5E5AB 3MGRC 2CV5C 3REJA 1P3BC 3LELD 5F99C 5AV6A 3AZIA 1EQZC 1W2EA 1KX3A 5AVCB 3AFAB 5GSUC 1N1JA 4EO5C 3MNNC 2XD1A 5GT3C 1TAFB 3LZ0B 3KWQA 5B0ZD 5BT1C 3AZNA 1H3OA 4G92B 4H9RB 5DNND 3MGRD 3UT9A 3B0BA 2CV5D 1P3BD 1P34A 3B0DB 5AVCC 1M18C 2NQBD 4J8UC 4QLCD 5F99D 2PYOC 1BH8B 5B40C 5B24D 2YFVA 5GSUD 5B31A 2ZM5A 3X1UB 3MNND 4YM6B 3KXBA 5GT3D 3W97C 1M1AA 1PZRA 4G92C 2AROB 5CPIB 3B0DC 4KUDA 3C1CC 4G91B 4H9QB 4YS3B 5AVCD 1M18D 3AFAD 3X1UC 4YM6C 5BO0B 4WU9B 1B67A 2HIOB 5B32A 4Z5TA 4G91C 1P3AA 2Y2JA 4H9PB 3AZJB 5BNVB 4UUZA 4YS3C 3AV2B 3C1CD 4R8PB 5B0YA 2L5AA 4E45A 3UTBB 1P3PA 5B31G 1F66A 4WU9C 3X1UD 3AL0C 1WWIA 3VH6W 4YM6D 2HIOC 2VQRA 3A6NC 1M19B 5CP6C 1KX4B 3AZJC 3UTBC 2LY8A 1ZLAA 2BYKB 4YS3D 1P3LB 2NZDB 5GXQB 2FFFB 2JSSA 3LJAA 1HQ3A 3REHB 4WU9D 1M19C 3LZ0A 5B32G 5DNMB 4J8WC 1KX4C 3WAAA 2HIOD 1ID3C 2FJ7C 3W99C 5CP6D 3AZJD 3AZKB 3NQJB 5FUGB 1Z2CB 3NQUB 1TZYB 3AZFA 3UTBD 3AZMC 3W98C 1S32C 4WU8B 2F8NA 3R45B 3REKC 3AZLA 3A1KA 3MGSA 1M19D 2AROA 1KX4D 3AZKC 1BH9B 3VH6T 3TU4C 4JJNB 1P3LD 2NZDD 3AZMD 3C1BB 1P3IC 3W98D 1S32D 3KFUG 3MVDB 3REHD 5DNMD 3KSYA 2HUEC 3VH5W 3B6GA 3AZKD 5B1MA 5BNVA 5B2IB 3AV2A 4XZQC 4R8PA 2JCHA 2UWXA 1U35C 4J8XB 2F8NG 3X1VB 3RELC 1P3ID 2XD5A 3AV1A 5AV5A 3LELB 5C3IB 4J8VB 3VH5A 5AV9A 3REJC 1P3GA 4ZUXB 2Y2NA 5B33B 2F2AC 3AYWC 3AZIC 3X1SC 1P3MA 5GXQA 3X1TB 5CPKB 4NFTA 5C3IC 3MGRB 3RELD 2CV5B 2Y2KA 5BS7C 3LZ1A 5AY8A 4LD9A 3EPLA 1EQZB 4ZUXC 1Q9CA 5B2ID 5B33C 1TZYA 3MNNB 5G49A 4J8XD 5GT3B 3UTAB 4Z66A 3AYWD 4WU8A 3X1SD 5B1LA 4M6BA 4Z2MG 5CPKC 3R45A 5GT0B 2RVQC 5AVBA 3KXBC 1KX5A 4J8VD 1M18B 5JRGA 4J8UB 2PYOB 3B6FA 4JJNA 3WKJB 4ZUXD 5B40B 4KUDC 3UTAC 5B33D 3WA9A 3C1BA 3W97B 4WNNB 5GT0C 2IO5C 3X1TD 3AZEA 3MVDA 3AZGA 5CPKD 2RVQD 3V9RA 2YFWB 3C1CB 5B32C 3WKJC 1EQZD 3AZHB 1P3AC 4KGCA 1P3KB 3UTAD 5BNXB 5B0YC 3X1VA 4CAYA 5BT1D 5GT0D 1F1EA 3WTPA 3LELA 2BYKA 3AZHC 5KDMA 4J8UD 2PYOD 3WKJD 5B40D 1P3KC 3W97D 5B0ZA 3W96C 3A6NB 5CP6B 5DNNA 3MGRA 3LJAC 1P3BA 1HQ3C 4KHAB 3MGPA 3WAAC 2NQBA 4QLCA 5F99A 1P3OB 5CPJB 3AZHD 4DRAA 5B24A 2BYMB 5GSUA 3MNNA 1P3KD 5GT3A 2Y2LA 5E5AA 4J8WB 3W96D 1R4VA 1ID3B 2FJ7B 3W99B 4CSRB 3AZLC 1P3OC 2F8NK 1AOIC 5CPJC 5AVCA 1M18A 3AFAA 2Y2PA 3AZMB 3W98B 1S32B 1TAFA 1B6WA 5B2JC 3REIC 3REKB 4WNNA 3A6ND 2BG1A 4H9RA 3A1IA 4H9SA 2YFWA 3TU4B 3H0LC 1P3OD 1AOID 1BH8A 5CPJD 3B6GC 3AN2C 4X23B 5B1MC 3X1UA 1P3IB 4YM6A 2ZY3A 3KUYB 5B2JD 3REID 4XUJB 4J8WD 5CPIA 3EPKA 5JA4B 2HUEB 1ID3D 4DRBA 3W99D 2FJ7D 4H9QA 4YS3A 1P3FB 4XZQB 3O62C 1U35B 4X23C 1T3UA 3AN2D 5BO0A 3KUYC 4WU9A 3RELB 3REKD 4XUJC 2HIOA 5CP6A 5AV8C 4H9PA 3AZJA 1P3FC 3TU4D 3REJB 3MGQC 3LZ1C 5AY8C 3UTBA 2Y2MA 3AYWB 3AZIB 3O62D 1KX3B 3X1SB 2DQNC 4X23D 1N1JB 3KUYD 1M19A 4XUJD 1KX4A 2ZY5A 5B1LC 2J8PA 5AV8D 3AZNB 5AVBC 1P3FD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT9 B;  1P3L A;  4XZQ D;  5AV6 C;  2NZD A;  3MGQ D;  1U35 D;  1KX3 C;  3AZM A;  1KX5 C;  5JRG C;  3W98 A;  1S32 A;  3B6F C;  3REH A;  2YFV B;  5DNM A;  3WA9 C;  5B31 B;  3KWQ C;  3KXB B;  3AZE C;  3WTP E;  3AZK A;  3NQJ A;  3UT9 C;  5FUG A;  3AZN C;  3NQU A;  3REJ D;  1P34 C;  4KUD B;  3VH5 T;  5AV6 D;  3AZI D;  1KX3 D;  1KX5 D;  4KGC C;  1P3I A;  1WWS A;  5B31 C;  2IO5 B;  1A7W A;  1M1A C;  2F8N H;  5JA4 A;  3KWQ D;  1BH9 A;  3WTP C;  5B32 B;  4Z5T B;  4WZS B;  3AZN D;  1P3A B;  3UT9 D;  4HGA C;  1P34 D;  4UUZ B;  5B0Y B;  4ZBJ C;  4KGC D;  3REL A;  5B31 D;  1F66 B;  3KXB D;  4H9N B;  1M1A D;  4Z5T C;  5B2I A;  5DNN C;  1JFI B;  3B0C W;  3WTP D;  3MGP C;  4KUD D;  1BFM A;  4J8X A;  1ZLA B;  2NQB C;  4QLC C;  3AYW A;  1P3P C;  3X1S A;  5B24 C;  3W96 B;  1F66 C;  4AWL C;  3LJA B;  1HQ3 B;  5BS7 A;  5E5A C;  4J8V A;  3WAA B;  4Z2M H;  5B32 D;  4Z5T D;  4ZUX A;  1P3A D;  5B33 A;  1ZLA C;  3MGP D;  3AZF B;  3AFA C;  5B0Y D;  1ULY A;  3X1T A;  1P3P D;  5CPK A;  2CV5 A;  2F8N B;  1F66 D;  3LZ0 C;  3AZL B;  4NE5 A;  1EQZ A;  1AOI B;  3MGS B;  5E5A D;  4NE3 A;  4H9S C;  3AZF C;  3UTA A;  1ZLA D;  5B2J B;  3REI B;  3B0C T;  5GT0 A;  3LJA D;  1HQ3 D;  3MGS C;  3LZ0 D;  2ARO C;  3WAA D;  5CPI C;  4J8U A;  2PYO A;  3WKJ A;  5B40 A;  3B6G B;  3AN2 B;  5B1M B;  4WV4 B;  3W97 A;  3AZF D;  2F8N D;  3C1C A;  3AZL D;  4H9N A;  3AV1 B;  5AV5 B;  3MGS D;  2ARO D;  3AZH A;  1JFI A;  3O62 B;  5CPI D;  3AV2 C;  5AV9 B;  4R8P C;  1P3G B;  1P3K A;  5BNX A;  1HTA A;  2CWE A;  3W96 A;  1P3M B;  5AV8 B;  3AV1 C;  5AV5 C;  3VH6 A;  3MGQ B;  3LZ1 B;  5AY8 B;  4LD9 B;  4H9O B;  5AV9 C;  3B6G D;  1P3G C;  5B1M D;  1P3L C;  3AV2 D;  2NZD C;  4R8P D;  3A6N A;  4NE6 A;  5G49 B;  1P3M C;  4Z66 B;  5GXQ C;  4KHA A;  3REH C;  5B1L B;  5DNM C;  4LD9 C;  3AV1 D;  1P3O A;  5AVB B;  5AV5 D;  1AOI A;  5CPJ A;  5AV6 B;  2BYM A;  1KX5 B;  5AV9 D;  5JRG B;  1TZY C;  1P3G D;  3B6F B;  5B2J A;  4Z66 C;  3REI A;  3WA9 B;  4J8W A;  4WU8 C;  3KWQ B;  1ID3 A;  2FJ7 A;  1P3M D;  3W99 A;  4CSR A;  5GXQ D;  3AZE B;  3AZG B;  1P34 B;  4LD9 D;  3LZ1 D;  5AY8 D;  3V9R B;  1KU5 A;  4JJN C;  3AN2 A;  4KGC B;  3REK A;  1TZY D;  3C1B C;  1M1A B;  4Z66 D;  4WU8 D;  3MVD C;  5B1L D;  3AZG C;  4CAY B;  3TU4 A;  3WTP B;  5AVB D;  4HGA B;  3O62 A;  4X23 A;  5B2I C;  5KDM B;  5JRG D;  4E44 A;  3B6F D;  4JJN D;  4J8X C;  4ZBJ B;  3KUY A;  3WA9 D;  4XUJ A;  3X1V C;  3C1B D;  5B0Z B;  5AV8 A;  3AZE D;  3MVD D;  3AZG D;  5DNN B;  3LEL C;  1P3F A;  4XZQ A;  1P3B B;  3MGP B;  3MGQ A;  1U35 A;  4H9O A;  4J8V C;  2NQB B;  4QLC B;  5F99 B;  1P3P B;  5B24 B;  5CHL B;  1H3O B;  5GSU B;  4AWL B;  4EO5 B;  5B0Z C;  3X1T C;  3X1V D;  5E5A B;  3MGR C;  2CV5 C;  3REJ A;  1P3B C;  3LEL D;  5F99 C;  5AV6 A;  3AZI A;  1EQZ C;  1KX3 A;  5AVC B;  3AFA B;  5GSU C;  1N1J A;  4EO5 C;  3MNN C;  5GT3 C;  1TAF B;  3LZ0 B;  3KWQ A;  5B0Z D;  5BT1 C;  3AZN A;  1H3O A;  4G92 B;  4H9R B;  5DNN D;  3MGR D;  3UT9 A;  3B0B A;  2CV5 D;  1P3B D;  1P34 A;  3B0D B;  5AVC C;  1M18 C;  2NQB D;  4J8U C;  4QLC D;  5F99 D;  2PYO C;  1BH8 B;  5B40 C;  5B24 D;  2YFV A;  5GSU D;  5B31 A;  3X1U B;  3MNN D;  4YM6 B;  3KXB A;  5GT3 D;  3W97 C;  1M1A A;  4G92 C;  2ARO B;  5CPI B;  3B0D C;  4KUD A;  3C1C C;  4G91 B;  4H9Q B;  4YS3 B;  5AVC D;  1M18 D;  3AFA D;  3X1U C;  4YM6 C;  5BO0 B;  4WU9 B;  1B67 A;  2HIO B;  5B32 A;  4Z5T A;  4G91 C;  1P3A A;  4H9P B;  3AZJ B;  5BNV B;  4UUZ A;  4YS3 C;  3AV2 B;  3C1C D;  4R8P B;  5B0Y A;  2L5A A;  4E45 A;  3UTB B;  1P3P A;  5B31 G;  1F66 A;  4WU9 C;  3X1U D;  1WWI A;  3VH6 W;  4YM6 D;  2HIO C;  3A6N C;  1M19 B;  5CP6 C;  1KX4 B;  3AZJ C;  3UTB C;  2LY8 A;  1ZLA A;  2BYK B;  4YS3 D;  1P3L B;  2NZD B;  5GXQ B;  2JSS A;  3LJA A;  1HQ3 A;  3REH B;  4WU9 D;  1M19 C;  3LZ0 A;  5B32 G;  5DNM B;  4J8W C;  1KX4 C;  3WAA A;  2HIO D;  1ID3 C;  2FJ7 C;  3W99 C;  5CP6 D;  3AZJ D;  3AZK B;  3NQJ B;  5FUG B;  3NQU B;  1TZY B;  3AZF A;  3UTB D;  3AZM C;  3W98 C;  1S32 C;  4WU8 B;  2F8N A;  3R45 B;  3REK C;  3AZL A;  3MGS A;  1M19 D;  2ARO A;  1KX4 D;  3AZK C;  1BH9 B;  3VH6 T;  3TU4 C;  4JJN B;  1P3L D;  2NZD D;  3AZM D;  3C1B B;  1P3I C;  3W98 D;  1S32 D;  3MVD B;  3REH D;  5DNM D;  3KSY A;  2HUE C;  3VH5 W;  3B6G A;  3AZK D;  5B1M A;  5BNV A;  5B2I B;  3AV2 A;  4XZQ C;  4R8P A;  1U35 C;  4J8X B;  2F8N G;  3X1V B;  3REL C;  1P3I D;  3AV1 A;  5AV5 A;  3LEL B;  5C3I B;  4J8V B;  3VH5 A;  5AV9 A;  3REJ C;  1P3G A;  4ZUX B;  5B33 B;  3AYW C;  3AZI C;  3X1S C;  1P3M A;  5GXQ A;  3X1T B;  5CPK B;  4NFT A;  5C3I C;  3MGR B;  3REL D;  2CV5 B;  5BS7 C;  4LD9 A;  3LZ1 A;  5AY8 A;  1EQZ B;  4ZUX C;  1Q9C A;  5B2I D;  5B33 C;  1TZY A;  3MNN B;  5G49 A;  4J8X D;  5GT3 B;  3UTA B;  4Z66 A;  3AYW D;  4WU8 A;  3X1S D;  5B1L A;  4M6B A;  4Z2M G;  5CPK C;  3R45 A;  5GT0 B;  2RVQ C;  5AVB A;  3KXB C;  1KX5 A;  4J8V D;  1M18 B;  5JRG A;  4J8U B;  2PYO B;  3B6F A;  4JJN A;  3WKJ B;  4ZUX D;  5B40 B;  4KUD C;  3UTA C;  5B33 D;  3WA9 A;  3C1B A;  3W97 B;  4WNN B;  5GT0 C;  2IO5 C;  3X1T D;  3AZE A;  3MVD A;  3AZG A;  5CPK D;  2RVQ D;  3V9R A;  2YFW B;  3C1C B;  5B32 C;  3WKJ C;  1EQZ D;  3AZH B;  1P3A C;  4KGC A;  1P3K B;  3UTA D;  5BNX B;  5B0Y C;  3X1V A;  4CAY A;  5BT1 D;  5GT0 D;  1F1E A;  3WTP A;  3LEL A;  2BYK A;  3AZH C;  5KDM A;  4J8U D;  2PYO D;  3WKJ D;  5B40 D;  1P3K C;  3W97 D;  5B0Z A;  3W96 C;  3A6N B;  5CP6 B;  5DNN A;  3MGR A;  3LJA C;  1P3B A;  1HQ3 C;  4KHA B;  3MGP A;  3WAA C;  2NQB A;  4QLC A;  5F99 A;  1P3O B;  5CPJ B;  3AZH D;  4DRA A;  5B24 A;  2BYM B;  5GSU A;  3MNN A;  1P3K D;  5GT3 A;  5E5A A;  4J8W B;  3W96 D;  1R4V A;  1ID3 B;  2FJ7 B;  3W99 B;  4CSR B;  3AZL C;  1P3O C;  2F8N K;  1AOI C;  5CPJ C;  5AVC A;  1M18 A;  3AFA A;  3AZM B;  3W98 B;  1S32 B;  1TAF A;  1B6W A;  5B2J C;  3REI C;  3REK B;  4WNN A;  3A6N D;  4H9R A;  4H9S A;  2YFW A;  3TU4 B;  1P3O D;  1AOI D;  1BH8 A;  5CPJ D;  3B6G C;  3AN2 C;  4X23 B;  5B1M C;  3X1U A;  1P3I B;  4YM6 A;  3KUY B;  5B2J D;  3REI D;  4XUJ B;  4J8W D;  5CPI A;  5JA4 B;  2HUE B;  1ID3 D;  4DRB A;  3W99 D;  2FJ7 D;  4H9Q A;  4YS3 A;  1P3F B;  4XZQ B;  3O62 C;  1U35 B;  4X23 C;  3AN2 D;  5BO0 A;  3KUY C;  4WU9 A;  3REL B;  3REK D;  4XUJ C;  2HIO A;  5CP6 A;  5AV8 C;  4H9P A;  3AZJ A;  1P3F C;  3TU4 D;  3REJ B;  3MGQ C;  3LZ1 C;  5AY8 C;  3UTB A;  3AYW B;  3AZI B;  3O62 D;  1KX3 B;  3X1S B;  4X23 D;  1N1J B;  3KUY D;  1M19 A;  4XUJ D;  1KX4 A;  5B1L C;  5AV8 D;  3AZN B;  5AVB C;  1P3F D; 
#chains in the Genus database with same CATH topology
 3UT9 B;  1P3L A;  4XZQ D;  5AV6 C;  2NZD A;  3MGQ D;  1U35 D;  1KX3 C;  3AZM A;  1KX5 C;  5JRG C;  3W98 A;  1S32 A;  3B6F C;  3REH A;  2YFV B;  5DNM A;  3WA9 C;  5B31 B;  3KWQ C;  3KXB B;  2ZY2 A;  3AZE C;  3WTP E;  3AZK A;  3NQJ A;  3UT9 C;  5FUG A;  2ZY4 A;  3AZN C;  3NQU A;  3REJ D;  2Y2H A;  1P34 C;  4KUD B;  3VH5 T;  5AV6 D;  3AZI D;  3FDD A;  1KX3 D;  1KX5 D;  4KGC C;  1P3I A;  1WWS A;  5B31 C;  2IO5 B;  1A7W A;  1M1A C;  3P5J B;  2F8N H;  4WJ3 C;  5JA4 A;  3KWQ D;  1BH9 A;  3WTP C;  5B32 B;  4Z5T B;  4WZS B;  3AZN D;  2G5H C;  1P3A B;  3UT9 D;  4HGA C;  1P34 D;  4UUZ B;  5B0Y B;  4ZBJ C;  4KGC D;  3REL A;  5B31 D;  1F66 B;  3KXB D;  4H9N B;  1M1A D;  4Z5T C;  2JE5 A;  5B2I A;  5DNN C;  4UPK A;  3B0C W;  1JFI B;  3H0R C;  3WTP D;  3MGP C;  4KUD D;  3F6T A;  1BFM A;  4J8X A;  1ZLA B;  2NQB C;  4QLC C;  3AYW A;  1P3P C;  3X1S A;  5B24 C;  3W96 B;  1F66 C;  4AWL C;  3LJA B;  1HQ3 B;  5BS7 A;  5E5A C;  4J8V A;  3WAA B;  4Z2M H;  5B32 D;  4Z5T D;  4ZUX A;  1P3A D;  5B33 A;  1ZLA C;  3MGP D;  3AZF B;  3AFA C;  5B0Y D;  4DQY B;  1ULY A;  3X1T A;  1P3P D;  5CPK A;  2CV5 A;  2F8N B;  1F66 D;  3LZ0 C;  3AZL B;  4NE5 A;  1EQZ A;  1AOI B;  3MGS B;  5E5A D;  4NE3 A;  4H9S C;  3AZF C;  3UTA A;  1ZLA D;  2Y2G A;  5B2J B;  3REI B;  3B0C T;  5GT0 A;  3EPH A;  3LJA D;  1HQ3 D;  3MGS C;  3LZ0 D;  2ARO C;  3WAA D;  5CPI C;  4J8U A;  2PYO A;  3WKJ A;  5B40 A;  2W8S A;  3B6G B;  3AN2 B;  5B1M B;  4WV4 B;  3W97 A;  3AZF D;  2F8N D;  3C1C A;  3AZL D;  4H9N A;  3AV1 B;  5AV5 B;  3MGS D;  2ARO D;  3AZH A;  1JFI A;  3O62 B;  5CPI D;  3AV2 C;  5AV9 B;  4R8P C;  1P3G B;  1P3K A;  5BNX A;  1HTA A;  2CWE A;  3W96 A;  2Y2Q A;  1P3M B;  5AV8 B;  3AV1 C;  5AV5 C;  3VH6 A;  3MGQ B;  3LZ1 B;  5AY8 B;  4LD9 B;  4H9O B;  5AV9 C;  3B6G D;  1P3G C;  5B1M D;  1P3L C;  3AV2 D;  2NZD C;  4R8P D;  3A6N A;  4NE6 A;  5G49 B;  2DF4 C;  1P3M C;  4Z66 B;  5GXQ C;  4KHA A;  3REH C;  5B1L B;  5DNM C;  2RIQ A;  4LD9 C;  3AV1 D;  1P3O A;  5AVB B;  5AV5 D;  1AOI A;  5CPJ A;  5AV6 B;  2BYM A;  1KX5 B;  5AV9 D;  5JRG B;  1TZY C;  1P3G D;  2Y2O A;  3B6F B;  5B2J A;  4Z66 C;  3REI A;  3WA9 B;  4J8W A;  4WU8 C;  2G5I C;  3KWQ B;  1ID3 A;  2FJ7 A;  1P3M D;  3W99 A;  4CSR A;  5GXQ D;  3AZE B;  3AZG B;  1P34 B;  4LD9 D;  3LZ1 D;  5AY8 D;  3EG5 B;  3V9R B;  1KU5 A;  4JJN C;  3AN2 A;  4KGC B;  3REK A;  1TZY D;  3EPJ A;  3C1B C;  1M1A B;  4Z66 D;  4WU8 D;  3MVD C;  5B1L D;  3AZG C;  4CAY B;  3TU4 A;  3WTP B;  2Y2I A;  5AVB D;  3H0M C;  4HGA B;  3O62 A;  4X23 A;  5B2I C;  5KDM B;  5JRG D;  4E44 A;  3B6F D;  4JJN D;  4J8X C;  4ZBJ B;  3KUY A;  3WA9 D;  4XUJ A;  3X1V C;  3C1B D;  5B0Z B;  3IP4 C;  5AV8 A;  3AZE D;  3MVD D;  3AZG D;  5DNN B;  3LEL C;  1P3F A;  4XZQ A;  1P3B B;  3MGP B;  3MGQ A;  1U35 A;  4H9O A;  4J8V C;  2NQB B;  4QLC B;  5F99 B;  1P3P B;  5B24 B;  5CHL B;  1H3O B;  5GSU B;  4AWL B;  4EO5 B;  5B0Z C;  3X1T C;  3X1V D;  5E5A B;  3MGR C;  2CV5 C;  3REJ A;  1P3B C;  3LEL D;  5F99 C;  5AV6 A;  3AZI A;  1EQZ C;  1W2E A;  1KX3 A;  5AVC B;  3AFA B;  5GSU C;  1N1J A;  4EO5 C;  3MNN C;  2XD1 A;  5GT3 C;  1TAF B;  3LZ0 B;  3KWQ A;  5B0Z D;  5BT1 C;  3AZN A;  1H3O A;  4G92 B;  4H9R B;  5DNN D;  3MGR D;  3UT9 A;  3B0B A;  2CV5 D;  1P3B D;  1P34 A;  3B0D B;  5AVC C;  1M18 C;  2NQB D;  4J8U C;  4QLC D;  5F99 D;  2PYO C;  1BH8 B;  5B40 C;  5B24 D;  2YFV A;  5GSU D;  5B31 A;  2ZM5 A;  3X1U B;  3MNN D;  4YM6 B;  3KXB A;  5GT3 D;  3W97 C;  1M1A A;  1PZR A;  4G92 C;  2ARO B;  5CPI B;  3B0D C;  4KUD A;  3C1C C;  4G91 B;  4H9Q B;  4YS3 B;  5AVC D;  1M18 D;  3AFA D;  3X1U C;  4YM6 C;  5BO0 B;  4WU9 B;  1B67 A;  2HIO B;  5B32 A;  4Z5T A;  4G91 C;  1P3A A;  2Y2J A;  4H9P B;  3AZJ B;  5BNV B;  4UUZ A;  4YS3 C;  3AV2 B;  3C1C D;  4R8P B;  5B0Y A;  2L5A A;  4E45 A;  3UTB B;  1P3P A;  5B31 G;  1F66 A;  4WU9 C;  3X1U D;  3AL0 C;  1WWI A;  3VH6 W;  4YM6 D;  2HIO C;  2VQR A;  3A6N C;  1M19 B;  5CP6 C;  1KX4 B;  3AZJ C;  3UTB C;  2LY8 A;  1ZLA A;  2BYK B;  4YS3 D;  1P3L B;  2NZD B;  5GXQ B;  2FFF B;  2JSS A;  3LJA A;  1HQ3 A;  3REH B;  4WU9 D;  1M19 C;  3LZ0 A;  5B32 G;  5DNM B;  4J8W C;  1KX4 C;  3WAA A;  2HIO D;  1ID3 C;  2FJ7 C;  3W99 C;  5CP6 D;  3AZJ D;  3AZK B;  3NQJ B;  5FUG B;  1Z2C B;  3NQU B;  1TZY B;  3AZF A;  3UTB D;  3AZM C;  3W98 C;  1S32 C;  4WU8 B;  2F8N A;  3R45 B;  3REK C;  3AZL A;  3A1K A;  3MGS A;  1M19 D;  2ARO A;  1KX4 D;  3AZK C;  1BH9 B;  3VH6 T;  3TU4 C;  4JJN B;  1P3L D;  2NZD D;  3AZM D;  3C1B B;  1P3I C;  3W98 D;  1S32 D;  3KFU G;  3MVD B;  3REH D;  5DNM D;  3KSY A;  2HUE C;  3VH5 W;  3B6G A;  3AZK D;  5B1M A;  5BNV A;  5B2I B;  3AV2 A;  4XZQ C;  4R8P A;  2JCH A;  2UWX A;  1U35 C;  4J8X B;  2F8N G;  3X1V B;  3REL C;  1P3I D;  2XD5 A;  3AV1 A;  5AV5 A;  3LEL B;  5C3I B;  4J8V B;  3VH5 A;  5AV9 A;  3REJ C;  1P3G A;  4ZUX B;  2Y2N A;  5B33 B;  2F2A C;  3AYW C;  3AZI C;  3X1S C;  1P3M A;  5GXQ A;  3X1T B;  5CPK B;  4NFT A;  5C3I C;  3MGR B;  3REL D;  2CV5 B;  2Y2K A;  5BS7 C;  3LZ1 A;  5AY8 A;  4LD9 A;  3EPL A;  1EQZ B;  4ZUX C;  1Q9C A;  5B2I D;  5B33 C;  1TZY A;  3MNN B;  5G49 A;  4J8X D;  5GT3 B;  3UTA B;  4Z66 A;  3AYW D;  4WU8 A;  3X1S D;  5B1L A;  4M6B A;  4Z2M G;  5CPK C;  3R45 A;  5GT0 B;  2RVQ C;  5AVB A;  3KXB C;  1KX5 A;  4J8V D;  1M18 B;  5JRG A;  4J8U B;  2PYO B;  3B6F A;  4JJN A;  3WKJ B;  4ZUX D;  5B40 B;  4KUD C;  3UTA C;  5B33 D;  3WA9 A;  3C1B A;  3W97 B;  4WNN B;  5GT0 C;  2IO5 C;  3X1T D;  3AZE A;  3MVD A;  3AZG A;  5CPK D;  2RVQ D;  3V9R A;  2YFW B;  3C1C B;  5B32 C;  3WKJ C;  1EQZ D;  3AZH B;  1P3A C;  4KGC A;  1P3K B;  3UTA D;  5BNX B;  5B0Y C;  3X1V A;  4CAY A;  5BT1 D;  5GT0 D;  1F1E A;  3WTP A;  3LEL A;  2BYK A;  3AZH C;  5KDM A;  4J8U D;  2PYO D;  3WKJ D;  5B40 D;  1P3K C;  3W97 D;  5B0Z A;  3W96 C;  3A6N B;  5CP6 B;  5DNN A;  3MGR A;  3LJA C;  1P3B A;  1HQ3 C;  4KHA B;  3MGP A;  3WAA C;  2NQB A;  4QLC A;  5F99 A;  1P3O B;  5CPJ B;  3AZH D;  4DRA A;  5B24 A;  2BYM B;  5GSU A;  3MNN A;  1P3K D;  5GT3 A;  2Y2L A;  5E5A A;  4J8W B;  3W96 D;  1R4V A;  1ID3 B;  2FJ7 B;  3W99 B;  4CSR B;  3AZL C;  1P3O C;  2F8N K;  1AOI C;  5CPJ C;  5AVC A;  1M18 A;  3AFA A;  2Y2P A;  3AZM B;  3W98 B;  1S32 B;  1TAF A;  1B6W A;  5B2J C;  3REI C;  3REK B;  4WNN A;  3A6N D;  2BG1 A;  4H9R A;  3A1I A;  4H9S A;  2YFW A;  3TU4 B;  3H0L C;  1P3O D;  1AOI D;  1BH8 A;  5CPJ D;  3B6G C;  3AN2 C;  4X23 B;  5B1M C;  3X1U A;  1P3I B;  4YM6 A;  2ZY3 A;  3KUY B;  5B2J D;  3REI D;  4XUJ B;  4J8W D;  5CPI A;  3EPK A;  5JA4 B;  2HUE B;  1ID3 D;  4DRB A;  3W99 D;  2FJ7 D;  4H9Q A;  4YS3 A;  1P3F B;  4XZQ B;  3O62 C;  1U35 B;  4X23 C;  1T3U A;  3AN2 D;  5BO0 A;  3KUY C;  4WU9 A;  3REL B;  3REK D;  4XUJ C;  2HIO A;  5CP6 A;  5AV8 C;  4H9P A;  3AZJ A;  1P3F C;  3TU4 D;  3REJ B;  3MGQ C;  3LZ1 C;  5AY8 C;  3UTB A;  2Y2M A;  3AYW B;  3AZI B;  3O62 D;  1KX3 B;  3X1S B;  2DQN C;  4X23 D;  1N1J B;  3KUY D;  1M19 A;  4XUJ D;  1KX4 A;  2ZY5 A;  5B1L C;  2J8P A;  5AV8 D;  3AZN B;  5AVB C;  1P3F D; 
#chains in the Genus database with same CATH homology
 3UT9 B;  1P3L A;  4XZQ D;  5AV6 C;  2NZD A;  3MGQ D;  1U35 D;  1KX3 C;  3AZM A;  1KX5 C;  5JRG C;  3W98 A;  1S32 A;  3B6F C;  3REH A;  2YFV B;  5DNM A;  3WA9 C;  5B31 B;  3KWQ C;  3KXB B;  2ZY2 A;  3AZE C;  3WTP E;  3AZK A;  3NQJ A;  3UT9 C;  5FUG A;  2ZY4 A;  3AZN C;  3NQU A;  3REJ D;  2Y2H A;  1P34 C;  4KUD B;  3VH5 T;  5AV6 D;  3AZI D;  3FDD A;  1KX3 D;  1KX5 D;  4KGC C;  1P3I A;  1WWS A;  5B31 C;  2IO5 B;  1A7W A;  1M1A C;  3P5J B;  2F8N H;  4WJ3 C;  5JA4 A;  3KWQ D;  1BH9 A;  3WTP C;  5B32 B;  4Z5T B;  4WZS B;  3AZN D;  2G5H C;  1P3A B;  3UT9 D;  4HGA C;  1P34 D;  4UUZ B;  5B0Y B;  4ZBJ C;  4KGC D;  3REL A;  5B31 D;  1F66 B;  3KXB D;  4H9N B;  1M1A D;  4Z5T C;  2JE5 A;  5B2I A;  5DNN C;  4UPK A;  3B0C W;  1JFI B;  3H0R C;  3WTP D;  3MGP C;  4KUD D;  3F6T A;  1BFM A;  4J8X A;  1ZLA B;  2NQB C;  4QLC C;  3AYW A;  1P3P C;  3X1S A;  5B24 C;  3W96 B;  1F66 C;  4AWL C;  3LJA B;  1HQ3 B;  5BS7 A;  5E5A C;  4J8V A;  3WAA B;  4Z2M H;  5B32 D;  4Z5T D;  4ZUX A;  1P3A D;  5B33 A;  1ZLA C;  3MGP D;  3AZF B;  3AFA C;  5B0Y D;  4DQY B;  1ULY A;  3X1T A;  1P3P D;  5CPK A;  2CV5 A;  2F8N B;  1F66 D;  3LZ0 C;  3AZL B;  4NE5 A;  1EQZ A;  1AOI B;  3MGS B;  5E5A D;  4NE3 A;  4H9S C;  3AZF C;  3UTA A;  1ZLA D;  2Y2G A;  5B2J B;  3REI B;  3B0C T;  5GT0 A;  3EPH A;  3LJA D;  1HQ3 D;  3MGS C;  3LZ0 D;  2ARO C;  3WAA D;  5CPI C;  4J8U A;  2PYO A;  3WKJ A;  5B40 A;  2W8S A;  3B6G B;  3AN2 B;  5B1M B;  4WV4 B;  3W97 A;  3AZF D;  2F8N D;  3C1C A;  3AZL D;  4H9N A;  3AV1 B;  5AV5 B;  3MGS D;  2ARO D;  3AZH A;  1JFI A;  3O62 B;  5CPI D;  3AV2 C;  5AV9 B;  4R8P C;  1P3G B;  1P3K A;  5BNX A;  1HTA A;  2CWE A;  3W96 A;  2Y2Q A;  1P3M B;  5AV8 B;  3AV1 C;  5AV5 C;  3VH6 A;  3MGQ B;  3LZ1 B;  5AY8 B;  4LD9 B;  4H9O B;  5AV9 C;  3B6G D;  1P3G C;  5B1M D;  1P3L C;  3AV2 D;  2NZD C;  4R8P D;  3A6N A;  4NE6 A;  5G49 B;  2DF4 C;  1P3M C;  4Z66 B;  5GXQ C;  4KHA A;  3REH C;  5B1L B;  5DNM C;  2RIQ A;  4LD9 C;  3AV1 D;  1P3O A;  5AVB B;  5AV5 D;  1AOI A;  5CPJ A;  5AV6 B;  2BYM A;  1KX5 B;  5AV9 D;  5JRG B;  1TZY C;  1P3G D;  2Y2O A;  3B6F B;  5B2J A;  4Z66 C;  3REI A;  3WA9 B;  4J8W A;  4WU8 C;  2G5I C;  3KWQ B;  1ID3 A;  2FJ7 A;  1P3M D;  3W99 A;  4CSR A;  5GXQ D;  3AZE B;  3AZG B;  1P34 B;  4LD9 D;  3LZ1 D;  5AY8 D;  3EG5 B;  3V9R B;  1KU5 A;  4JJN C;  3AN2 A;  4KGC B;  3REK A;  1TZY D;  3EPJ A;  3C1B C;  1M1A B;  4Z66 D;  4WU8 D;  3MVD C;  5B1L D;  3AZG C;  4CAY B;  3TU4 A;  3WTP B;  2Y2I A;  5AVB D;  3H0M C;  4HGA B;  3O62 A;  4X23 A;  5B2I C;  5KDM B;  5JRG D;  4E44 A;  3B6F D;  4JJN D;  4J8X C;  4ZBJ B;  3KUY A;  3WA9 D;  4XUJ A;  3X1V C;  3C1B D;  5B0Z B;  3IP4 C;  5AV8 A;  3AZE D;  3MVD D;  3AZG D;  5DNN B;  3LEL C;  1P3F A;  4XZQ A;  1P3B B;  3MGP B;  3MGQ A;  1U35 A;  4H9O A;  4J8V C;  2NQB B;  4QLC B;  5F99 B;  1P3P B;  5B24 B;  5CHL B;  1H3O B;  5GSU B;  4AWL B;  4EO5 B;  5B0Z C;  3X1T C;  3X1V D;  5E5A B;  3MGR C;  2CV5 C;  3REJ A;  1P3B C;  3LEL D;  5F99 C;  5AV6 A;  3AZI A;  1EQZ C;  1W2E A;  1KX3 A;  5AVC B;  3AFA B;  5GSU C;  1N1J A;  4EO5 C;  3MNN C;  2XD1 A;  5GT3 C;  1TAF B;  3LZ0 B;  3KWQ A;  5B0Z D;  5BT1 C;  3AZN A;  1H3O A;  4G92 B;  4H9R B;  5DNN D;  3MGR D;  3UT9 A;  3B0B A;  2CV5 D;  1P3B D;  1P34 A;  3B0D B;  5AVC C;  1M18 C;  2NQB D;  4J8U C;  4QLC D;  5F99 D;  2PYO C;  1BH8 B;  5B40 C;  5B24 D;  2YFV A;  5GSU D;  5B31 A;  2ZM5 A;  3X1U B;  3MNN D;  4YM6 B;  3KXB A;  5GT3 D;  3W97 C;  1M1A A;  1PZR A;  4G92 C;  2ARO B;  5CPI B;  3B0D C;  4KUD A;  3C1C C;  4G91 B;  4H9Q B;  4YS3 B;  5AVC D;  1M18 D;  3AFA D;  3X1U C;  4YM6 C;  5BO0 B;  4WU9 B;  1B67 A;  2HIO B;  5B32 A;  4Z5T A;  4G91 C;  1P3A A;  2Y2J A;  4H9P B;  3AZJ B;  5BNV B;  4UUZ A;  4YS3 C;  3AV2 B;  3C1C D;  4R8P B;  5B0Y A;  2L5A A;  4E45 A;  3UTB B;  1P3P A;  5B31 G;  1F66 A;  4WU9 C;  3X1U D;  3AL0 C;  1WWI A;  3VH6 W;  4YM6 D;  2HIO C;  2VQR A;  3A6N C;  1M19 B;  5CP6 C;  1KX4 B;  3AZJ C;  3UTB C;  2LY8 A;  1ZLA A;  2BYK B;  4YS3 D;  1P3L B;  2NZD B;  5GXQ B;  2FFF B;  2JSS A;  3LJA A;  1HQ3 A;  3REH B;  4WU9 D;  1M19 C;  3LZ0 A;  5B32 G;  5DNM B;  4J8W C;  1KX4 C;  3WAA A;  2HIO D;  1ID3 C;  2FJ7 C;  3W99 C;  5CP6 D;  3AZJ D;  3AZK B;  3NQJ B;  5FUG B;  1Z2C B;  3NQU B;  1TZY B;  3AZF A;  3UTB D;  3AZM C;  3W98 C;  1S32 C;  4WU8 B;  2F8N A;  3R45 B;  3REK C;  3AZL A;  3A1K A;  3MGS A;  1M19 D;  2ARO A;  1KX4 D;  3AZK C;  1BH9 B;  3VH6 T;  3TU4 C;  4JJN B;  1P3L D;  2NZD D;  3AZM D;  3C1B B;  1P3I C;  3W98 D;  1S32 D;  3KFU G;  3MVD B;  3REH D;  5DNM D;  3KSY A;  2HUE C;  3VH5 W;  3B6G A;  3AZK D;  5B1M A;  5BNV A;  5B2I B;  3AV2 A;  4XZQ C;  4R8P A;  2JCH A;  2UWX A;  1U35 C;  4J8X B;  2F8N G;  3X1V B;  3REL C;  1P3I D;  2XD5 A;  3AV1 A;  5AV5 A;  3LEL B;  5C3I B;  4J8V B;  3VH5 A;  5AV9 A;  3REJ C;  1P3G A;  4ZUX B;  2Y2N A;  5B33 B;  2F2A C;  3AYW C;  3AZI C;  3X1S C;  1P3M A;  5GXQ A;  3X1T B;  5CPK B;  4NFT A;  5C3I C;  3MGR B;  3REL D;  2CV5 B;  2Y2K A;  5BS7 C;  3LZ1 A;  5AY8 A;  4LD9 A;  3EPL A;  1EQZ B;  4ZUX C;  1Q9C A;  5B2I D;  5B33 C;  1TZY A;  3MNN B;  5G49 A;  4J8X D;  5GT3 B;  3UTA B;  4Z66 A;  3AYW D;  4WU8 A;  3X1S D;  5B1L A;  4M6B A;  4Z2M G;  5CPK C;  3R45 A;  5GT0 B;  2RVQ C;  5AVB A;  3KXB C;  1KX5 A;  4J8V D;  1M18 B;  5JRG A;  4J8U B;  2PYO B;  3B6F A;  4JJN A;  3WKJ B;  4ZUX D;  5B40 B;  4KUD C;  3UTA C;  5B33 D;  3WA9 A;  3C1B A;  3W97 B;  4WNN B;  5GT0 C;  2IO5 C;  3X1T D;  3AZE A;  3MVD A;  3AZG A;  5CPK D;  2RVQ D;  3V9R A;  2YFW B;  3C1C B;  5B32 C;  3WKJ C;  1EQZ D;  3AZH B;  1P3A C;  4KGC A;  1P3K B;  3UTA D;  5BNX B;  5B0Y C;  3X1V A;  4CAY A;  5BT1 D;  5GT0 D;  1F1E A;  3WTP A;  3LEL A;  2BYK A;  3AZH C;  5KDM A;  4J8U D;  2PYO D;  3WKJ D;  5B40 D;  1P3K C;  3W97 D;  5B0Z A;  3W96 C;  3A6N B;  5CP6 B;  5DNN A;  3MGR A;  3LJA C;  1P3B A;  1HQ3 C;  4KHA B;  3MGP A;  3WAA C;  2NQB A;  4QLC A;  5F99 A;  1P3O B;  5CPJ B;  3AZH D;  4DRA A;  5B24 A;  2BYM B;  5GSU A;  3MNN A;  1P3K D;  5GT3 A;  2Y2L A;  5E5A A;  4J8W B;  3W96 D;  1R4V A;  1ID3 B;  2FJ7 B;  3W99 B;  4CSR B;  3AZL C;  1P3O C;  2F8N K;  1AOI C;  5CPJ C;  5AVC A;  1M18 A;  3AFA A;  2Y2P A;  3AZM B;  3W98 B;  1S32 B;  1TAF A;  1B6W A;  5B2J C;  3REI C;  3REK B;  4WNN A;  3A6N D;  2BG1 A;  4H9R A;  3A1I A;  4H9S A;  2YFW A;  3TU4 B;  3H0L C;  1P3O D;  1AOI D;  1BH8 A;  5CPJ D;  3B6G C;  3AN2 C;  4X23 B;  5B1M C;  3X1U A;  1P3I B;  4YM6 A;  2ZY3 A;  3KUY B;  5B2J D;  3REI D;  4XUJ B;  4J8W D;  5CPI A;  3EPK A;  5JA4 B;  2HUE B;  1ID3 D;  4DRB A;  3W99 D;  2FJ7 D;  4H9Q A;  4YS3 A;  1P3F B;  4XZQ B;  3O62 C;  1U35 B;  4X23 C;  1T3U A;  3AN2 D;  5BO0 A;  3KUY C;  4WU9 A;  3REL B;  3REK D;  4XUJ C;  2HIO A;  5CP6 A;  5AV8 C;  4H9P A;  3AZJ A;  1P3F C;  3TU4 D;  3REJ B;  3MGQ C;  3LZ1 C;  5AY8 C;  3UTB A;  2Y2M A;  3AYW B;  3AZI B;  3O62 D;  1KX3 B;  3X1S B;  2DQN C;  4X23 D;  1N1J B;  3KUY D;  1M19 A;  4XUJ D;  1KX4 A;  2ZY5 A;  5B1L C;  2J8P A;  5AV8 D;  3AZN B;  5AVB C;  1P3F D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...