3B08B

Crystal structure of the mouse hoil1-l-nzf in complex with linear di-ubiquitin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
MPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyubiquitin-C
publication title Specific recognition of linear ubiquitin chains by the Npl4 zinc finger (NZF) domain of the HOIL-1L subunit of the linear ubiquitin chain assembly complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/metal binding protein
total genus 11
structure length 58
sequence length 58
chains with identical sequence E, H, K
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2011-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.140 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3b08B00
3B08B 2J9UB 4XXBB 3B0AB 2C6AA 2C6BA 2PPTA 3P2AA
chains in the Genus database with same CATH superfamily
1RWDA 1VZHA 1R0IA 3MPSA 2PPTA 3PZAA 3MSUA 2KKDA 5IYBL 4A3IL 3QQCE 1H7VA 3H9CA 3J7Y1 4POGA 2AYJA 3HOWL 2JA7L 2HR5A 5GADc 3I4ML 1QQTA 2JA8L 2V0FA 2ZIXA 3GTOL 4B8CD 5IYCL 2EY4E 1JYBA 3GTJL 3FKIL 1LKOA 3S2DL 1OWCA 3HJYB 1PFVA 5M3FL 3S2HL 2CKCA 4A3LL 4AHWA 1PZXA 2XJQA 5DM71 2WB1P 1CADA 2H12A 4A3BL 3PIP1 1C09A 2M4YA 4BY1L 2M4VA 3GTLL 4TVMA 4A3CL 5M5YL 3P8BA 5C3EL 3K7AL 4C3HL 1NNQA 2PYAA 3GTQL 2VL6A 4AI0A 4A93L 2PMZP 5MFZA 2XJUA 1RDVA 3RZ6A 1VZGA 2A68D 3QVDA 2K2DA 2V0EA 3RZDL 4A3KL 4ME3A 4JAEA 3HAXC 3VPBE 1S30A 3P2AA 5JVG1 4Y7NL 3H9BA 1R9TL 3PO2L 2YU9L 1S24A 1B2OA 8RXNA 2RDVA 3B0AB 2ERSA 2LCQA 3H3VM 1PFYA 1YK4A 5EINC 3LWQB 5IP9L 2A6HD 4E6YA 3LWOB 1TWHL 2AUSB 2RFKB 3RZOL 4UY81 2A69D 4LHLA 4C3IL 2NYDA 4JADA 1S2ZA 4A3GL 1T9OA 4RXNA 2R7ZL 1IU6A 2DSXA 1SMWA 3GTGL 3PKJA 5IYDL 2BE5D 1RDGA 1TWAL 3S1RL 4A3JL 4AR4A 6RXNA 1ZRPA 5MGNA 1YV1A 4XXBB 1R0GA 2CKAA 2HVYC 2L0ZA 2APOB 3SS2A 1NXEA 1YK5A 3ZG6A 2ERJA 4YWLA 4QIWP 1R0JA 3H99A 4A3FL 1DVBA 2A6ED 2Z3RB 4V196 1BE7A 2M6PA 1I6HL 1WCML 3HOYL 3HOZL 4AHYA 1LKMA 4WFN1 3KYYA 2JA6L 1TWFL 3LWPB 2C6AA 4AI3A 5GAGc 1OWBA 1RYQA 2V3BB 3S1ML 2B5ID 4Y52L 3HOVL 2JA5L 5C4XL 4POFA 1T9QA 3WWLA 3S17L 3S1NL 1E8JA 2M6OA 4AYBP 3GTPL 1B13A 4LHNA 2VUML 3S14L 2R92L 1WJVA 3S16L 1YUZA 1VZIA 2R93L 1PFUA 3A44A 1Y1VL 2NVYL 1IROA 1IU5A 1BQ8A 3S15L 2JI3A 1IRNA 5EIOC 3CQZL 4BY7L 2B63L 1I3QL 4A3EL 3RYGA 2XJRA 5M5XL 1CAAA 1B2JA 3LWRB 4A3ML 4ZN1B 2XJVA 3M3YL 5FJ8L 3LPEB 1YUXA 5MF6A 1LKPA 1F4LA 3KYWA 2C6BA 4U671 2PSMC 2E2HL 1BQ9A 3KYXA 4JAGA 1T9PA 3PO3L 4X6AL 2JI1A 3HOXL 5GAEc 2XJTA 3H0GL 3WWNB 5H1Sc 2WAQP 2XJPA 3IU3I 5K2ME 5IP7L 3K35A 5MLC3 3LWVB 5AN9H 1K83L 2JI2A 2GMGA 3S1QL 3B08B 2Z3QB 3NFPI 4AI2A 4XGHA 4BBRL 3KYVA 4BBSL 2CR8A 3PL5A 4AR3A 1SFOL 2O5JD 4AHZA 1PFWA 4YWMA 5MFPA 3J7Z1 1NXGA 5AI3A 3M4OL 1R0FA 1RYTA 5IY0A 2J9UB 5C4JL 2PVXA 3PWFA 5DM61 1BFYA 3LNLA 3GTML 1VCXA 3HJWB 2KN9A 4AR5A 1SMMA 5AI2A 1B71A 1TWCL 5JVH1 2NVQL 3HKZP 4G6BA 1DX8A 3RZTA 1I50L 4A3DL 1QYBA 5M5WL 1ODHA 1Z92B 1TWGL 1R0HA 4BXXL 3H97A 1QCVA 5FLML 2E2JL 2NVTL 1P7PA 5GAHc 3HOUL 5M3ML 3I4NL 3KYUA 1BRFA 5C44L 3FDJA 1LTLA 2NVXL 3PKIA 5RXNA 3GTKL 4AI1A 4AHXA 1Y1WL 3JR7A 2MS3A 2E2IL 3MQKB 7RXNA 2QL0A 4C3JL 4AR6A 1FHMA 1SMUA 1FHHA 1RB9A 4TPUA 2PVEA 4K9FA 4ZN3B 4GS7D 2Y0SP 1IW7D 3PIO1 2AQCA 4C2M1 4JAFA 2XJSA
chains in the Genus database with same CATH topology
1RWDA 2RDVA 1VZHA 3B0AB 2B5ID 1R0IA 2ERSA 3MPSA 2LCQA 5JVG1 3KYVA 2PPTA 4POFA 4AHYA 3PZAA 3MSUA 2KKDA 1T9QA 3WWLA 1YK4A 1E8JA 2CR8A 3QQCE 4AR3A 5EINC 2O5JD 2A6HD 4AHZA 4E6YA 1H7VA 4YWMA 2M6OA 3J7Y1 5MFPA 1B13A 3J7Z1 1NXGA 4LHNA 5AI3A 4POGA 1R0FA 1RYTA 5IY0A 2AYJA 2J9UB 4UY81 2A69D 1WJVA 4LHLA 2PVXA 3PWFA 1YUZA 5DM61 2HR5A 5GADc 1VZIA 2NYDA 1BFYA 3LNLA 1VCXA 4JADA 1S2ZA 2V0FA 2ZIXA 3A44A 1T9OA 2KN9A 4RXNA 4AR5A 4B8CD 1IROA 1JYBA 1SMMA 1IU6A 5AI2A 1B71A 5JVH1 1IU5A 1BQ8A 2DSXA 1SMWA 1LKOA 4G6BA 1DX8A 3RZTA 1OWCA 2JI3A 3PKJA 1IRNA 2BE5D 5EIOC 1RDGA 2CKCA 4AHWA 2XJQA 1QYBA 5DM71 4AR4A 1ODHA 2XJSA 2H12A 1CADA 3RYGA 2XJRA 1R0HA 3PIP1 1C09A 1CAAA 1B2JA 2M4YA 6RXNA 1ZRPA 4ZN1B 1QCVA 2M4VA 5MGNA 1YV1A 4TVMA 3P8BA 2XJVA 4XXBB 2CKAA 1R0GA 2L0ZA 3SS2A 1NXEA 1YK5A 3LPEB 5GAHc 1YUXA 1NNQA 5MF6A 2PYAA 2VL6A 1LKPA 3ZG6A 4AI0A 3KYWA 3KYUA 1BRFA 2ERJA 2C6BA 4U671 2PSMC 1BQ9A 3KYXA 4JAGA 5MFZA 2XJUA 1LTLA 1T9PA 4YWLA 2JI1A 3PKIA 1R0JA 5RXNA 5GAEc 4AI1A 1RDVA 2XJTA 4AHXA 1DVBA 3RZ6A 2A6ED 1VZGA 2A68D 2MS3A 3WWNB 3QVDA 2K2DA 2Z3RB 2V3BB 7RXNA 2QL0A 2V0EA 4V196 1BE7A 2M6PA 4AR6A 5H1Sc 2XJPA 3IU3I 1FHMA 5K2ME 4ME3A 3K35A 4JAEA 5MLC3 5AN9H 1SMUA 3VPBE 2JI2A 1S30A 1FHHA 1LKMA 1RB9A 2GMGA 3B08B 2Z3QB 3NFPI 3KYYA 3P2AA 4TPUA 4WFN1 4AI2A 2PVEA 4K9FA 4ZN3B 4GS7D 1IW7D 4XGHA 2C6AA 4AI3A 1S24A 3PIO1 5GAGc 1OWBA 1RYQA 4JAFA 1Z92B 1B2OA 8RXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B08 B;  2J9U B;  4XXB B;  3B0A B;  2C6A A;  2C6B A;  2PPT A;  3P2A A; 
#chains in the Genus database with same CATH topology
 1RWD A;  1VZH A;  1R0I A;  3MPS A;  2PPT A;  3PZA A;  3MSU A;  2KKD A;  5IYB L;  4A3I L;  3QQC E;  1H7V A;  3H9C A;  3J7Y 1;  4POG A;  2AYJ A;  3HOW L;  2JA7 L;  2HR5 A;  5GAD c;  3I4M L;  1QQT A;  2JA8 L;  2V0F A;  2ZIX A;  3GTO L;  4B8C D;  5IYC L;  2EY4 E;  1JYB A;  3GTJ L;  3FKI L;  1LKO A;  3S2D L;  1OWC A;  3HJY B;  1PFV A;  5M3F L;  3S2H L;  2CKC A;  4A3L L;  4AHW A;  1PZX A;  2XJQ A;  5DM7 1;  2WB1 P;  1CAD A;  2H12 A;  4A3B L;  3PIP 1;  1C09 A;  2M4Y A;  4BY1 L;  2M4V A;  3GTL L;  4TVM A;  4A3C L;  5M5Y L;  3P8B A;  5C3E L;  3K7A L;  4C3H L;  1NNQ A;  2PYA A;  3GTQ L;  2VL6 A;  4AI0 A;  4A93 L;  2PMZ P;  5MFZ A;  2XJU A;  1RDV A;  3RZ6 A;  1VZG A;  2A68 D;  3QVD A;  2K2D A;  2V0E A;  3RZD L;  4A3K L;  4ME3 A;  4JAE A;  3HAX C;  3VPB E;  1S30 A;  3P2A A;  5JVG 1;  4Y7N L;  3H9B A;  1R9T L;  3PO2 L;  2YU9 L;  1S24 A;  1B2O A;  8RXN A;  2RDV A;  3B0A B;  2ERS A;  2LCQ A;  3H3V M;  1PFY A;  1YK4 A;  5EIN C;  3LWQ B;  5IP9 L;  2A6H D;  4E6Y A;  3LWO B;  1TWH L;  2AUS B;  2RFK B;  3RZO L;  4UY8 1;  2A69 D;  4LHL A;  4C3I L;  2NYD A;  4JAD A;  1S2Z A;  4A3G L;  1T9O A;  4RXN A;  2R7Z L;  1IU6 A;  2DSX A;  1SMW A;  3GTG L;  3PKJ A;  5IYD L;  2BE5 D;  1RDG A;  1TWA L;  3S1R L;  4A3J L;  4AR4 A;  6RXN A;  1ZRP A;  5MGN A;  1YV1 A;  4XXB B;  1R0G A;  2CKA A;  2HVY C;  2L0Z A;  2APO B;  3SS2 A;  1NXE A;  1YK5 A;  3ZG6 A;  2ERJ A;  4YWL A;  4QIW P;  1R0J A;  3H99 A;  4A3F L;  1DVB A;  2A6E D;  2Z3R B;  4V19 6;  1BE7 A;  2M6P A;  1I6H L;  1WCM L;  3HOY L;  3HOZ L;  4AHY A;  1LKM A;  4WFN 1;  3KYY A;  2JA6 L;  1TWF L;  3LWP B;  2C6A A;  4AI3 A;  5GAG c;  1OWB A;  1RYQ A;  2V3B B;  3S1M L;  2B5I D;  4Y52 L;  3HOV L;  2JA5 L;  5C4X L;  4POF A;  1T9Q A;  3WWL A;  3S17 L;  3S1N L;  1E8J A;  2M6O A;  4AYB P;  3GTP L;  1B13 A;  4LHN A;  2VUM L;  3S14 L;  2R92 L;  1WJV A;  3S16 L;  1YUZ A;  1VZI A;  2R93 L;  1PFU A;  3A44 A;  1Y1V L;  2NVY L;  1IRO A;  1IU5 A;  1BQ8 A;  3S15 L;  2JI3 A;  1IRN A;  5EIO C;  3CQZ L;  4BY7 L;  2B63 L;  1I3Q L;  4A3E L;  3RYG A;  2XJR A;  5M5X L;  1CAA A;  1B2J A;  3LWR B;  4A3M L;  4ZN1 B;  2XJV A;  3M3Y L;  5FJ8 L;  3LPE B;  1YUX A;  5MF6 A;  1LKP A;  1F4L A;  3KYW A;  2C6B A;  4U67 1;  2PSM C;  2E2H L;  1BQ9 A;  3KYX A;  4JAG A;  1T9P A;  3PO3 L;  4X6A L;  2JI1 A;  3HOX L;  5GAE c;  2XJT A;  3H0G L;  3WWN B;  5H1S c;  2WAQ P;  2XJP A;  3IU3 I;  5K2M E;  5IP7 L;  3K35 A;  5MLC 3;  3LWV B;  5AN9 H;  1K83 L;  2JI2 A;  2GMG A;  3S1Q L;  3B08 B;  2Z3Q B;  3NFP I;  4AI2 A;  4XGH A;  4BBR L;  3KYV A;  4BBS L;  2CR8 A;  3PL5 A;  4AR3 A;  1SFO L;  2O5J D;  4AHZ A;  1PFW A;  4YWM A;  5MFP A;  3J7Z 1;  1NXG A;  5AI3 A;  3M4O L;  1R0F A;  1RYT A;  5IY0 A;  2J9U B;  5C4J L;  2PVX A;  3PWF A;  5DM6 1;  1BFY A;  3LNL A;  3GTM L;  1VCX A;  3HJW B;  2KN9 A;  4AR5 A;  1SMM A;  5AI2 A;  1B71 A;  1TWC L;  5JVH 1;  2NVQ L;  3HKZ P;  4G6B A;  1DX8 A;  3RZT A;  1I50 L;  4A3D L;  1QYB A;  5M5W L;  1ODH A;  1Z92 B;  1TWG L;  1R0H A;  4BXX L;  3H97 A;  1QCV A;  5FLM L;  2E2J L;  2NVT L;  1P7P A;  5GAH c;  3HOU L;  5M3M L;  3I4N L;  3KYU A;  1BRF A;  5C44 L;  3FDJ A;  1LTL A;  2NVX L;  3PKI A;  5RXN A;  3GTK L;  4AI1 A;  4AHX A;  1Y1W L;  3JR7 A;  2MS3 A;  2E2I L;  3MQK B;  7RXN A;  2QL0 A;  4C3J L;  4AR6 A;  1FHM A;  1SMU A;  1FHH A;  1RB9 A;  4TPU A;  2PVE A;  4K9F A;  4ZN3 B;  4GS7 D;  2Y0S P;  1IW7 D;  3PIO 1;  2AQC A;  4C2M 1;  4JAF A;  2XJS A; 
#chains in the Genus database with same CATH homology
 1RWD A;  2RDV A;  1VZH A;  3B0A B;  2B5I D;  1R0I A;  2ERS A;  3MPS A;  2LCQ A;  5JVG 1;  3KYV A;  2PPT A;  4POF A;  4AHY A;  3PZA A;  3MSU A;  2KKD A;  1T9Q A;  3WWL A;  1YK4 A;  1E8J A;  2CR8 A;  3QQC E;  4AR3 A;  5EIN C;  2O5J D;  2A6H D;  4AHZ A;  4E6Y A;  1H7V A;  4YWM A;  2M6O A;  3J7Y 1;  5MFP A;  1B13 A;  3J7Z 1;  1NXG A;  4LHN A;  5AI3 A;  4POG A;  1R0F A;  1RYT A;  5IY0 A;  2AYJ A;  2J9U B;  4UY8 1;  2A69 D;  1WJV A;  4LHL A;  2PVX A;  3PWF A;  1YUZ A;  5DM6 1;  2HR5 A;  5GAD c;  1VZI A;  2NYD A;  1BFY A;  3LNL A;  1VCX A;  4JAD A;  1S2Z A;  2V0F A;  2ZIX A;  3A44 A;  1T9O A;  2KN9 A;  4RXN A;  4AR5 A;  4B8C D;  1IRO A;  1JYB A;  1SMM A;  1IU6 A;  5AI2 A;  1B71 A;  5JVH 1;  1IU5 A;  1BQ8 A;  2DSX A;  1SMW A;  1LKO A;  4G6B A;  1DX8 A;  3RZT A;  1OWC A;  2JI3 A;  3PKJ A;  1IRN A;  2BE5 D;  5EIO C;  1RDG A;  2CKC A;  4AHW A;  2XJQ A;  1QYB A;  5DM7 1;  4AR4 A;  1ODH A;  2XJS A;  2H12 A;  1CAD A;  3RYG A;  2XJR A;  1R0H A;  3PIP 1;  1C09 A;  1CAA A;  1B2J A;  2M4Y A;  6RXN A;  1ZRP A;  4ZN1 B;  1QCV A;  2M4V A;  5MGN A;  1YV1 A;  4TVM A;  3P8B A;  2XJV A;  4XXB B;  2CKA A;  1R0G A;  2L0Z A;  3SS2 A;  1NXE A;  1YK5 A;  3LPE B;  5GAH c;  1YUX A;  1NNQ A;  5MF6 A;  2PYA A;  2VL6 A;  1LKP A;  3ZG6 A;  4AI0 A;  3KYW A;  3KYU A;  1BRF A;  2ERJ A;  2C6B A;  4U67 1;  2PSM C;  1BQ9 A;  3KYX A;  4JAG A;  5MFZ A;  2XJU A;  1LTL A;  1T9P A;  4YWL A;  2JI1 A;  3PKI A;  1R0J A;  5RXN A;  5GAE c;  4AI1 A;  1RDV A;  2XJT A;  4AHX A;  1DVB A;  3RZ6 A;  2A6E D;  1VZG A;  2A68 D;  2MS3 A;  3WWN B;  3QVD A;  2K2D A;  2Z3R B;  2V3B B;  7RXN A;  2QL0 A;  2V0E A;  4V19 6;  1BE7 A;  2M6P A;  4AR6 A;  5H1S c;  2XJP A;  3IU3 I;  1FHM A;  5K2M E;  4ME3 A;  3K35 A;  4JAE A;  5MLC 3;  5AN9 H;  1SMU A;  3VPB E;  2JI2 A;  1S30 A;  1FHH A;  1LKM A;  1RB9 A;  2GMG A;  3B08 B;  2Z3Q B;  3NFP I;  3KYY A;  3P2A A;  4TPU A;  4WFN 1;  4AI2 A;  2PVE A;  4K9F A;  4ZN3 B;  4GS7 D;  1IW7 D;  4XGH A;  2C6A A;  4AI3 A;  1S24 A;  3PIO 1;  5GAG c;  1OWB A;  1RYQ A;  4JAF A;  1Z92 B;  1B2O A;  8RXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...