3B0AB

Crystal structure of the mouse hoil1-l-nzf in complex with linear di-ubiquitin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
b'MPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyubiquitin-C
publication title Specific recognition of linear ubiquitin chains by the Npl4 zinc finger (NZF) domain of the HOIL-1L subunit of the linear ubiquitin chain assembly complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/metal binding protein
total genus 10
structure length 57
sequence length 57
chains with identical sequence E
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2011-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.140 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3b0aB00
2J9UB 2PPTA 4XXBB 3B08B 2C6BA 2C6AA 3B0AB 3P2AA
chains in the Genus database with same CATH superfamily
1R9TL 4XXBB 2XJUA 3LWQB 2B5ID 2Y0SP 5M5WL 1R0GA 2PYAA 4TVMA 5AI2A 2LCQA 1SMUA 3WWNB 4X6AL 1E8JA 8RXNA 1R0JA 3SS2A 5M5XL 5AN9H 3LWOB 1B71A 2APOB 3K35A 1QYBA 2DSXA 4A3CL 4A93L 5M3ML 3MQKB 5DM61 4AR6A 2O5JD 4A3BL 1S2ZA 4C2M1 3PKIA 1YV1A 4POGA 3KYVA 3P2AA 5M3FL 5IYDL 3HJYB 3S14L 1BRFA 4TPUA 3RZDL 2B63L 3WWLA 1R0HA 5DM71 1FHHA 3GTGL 3QQCE 4YWLA 3MPSA 4AI1A 4AI2A 7RXNA 1T9PA 3LNLA 1RYTA 2EY4E 4A3GL 2E2IL 1RDGA 2PPTA 1I50L 3FDJA 1RDVA 1T9QA 2MS3A 1IU5A 2BE5D 5IYCL 5FJ8L 3KYYA 3J7Y1 1DX8A 1NNQA 2JA5L 5EIOC 4BXXL 1TWFL 3I4NL 3B0AB 4C3IL 4XGHA 3PO3L 2RDVA 1TWGL 3P8BA 1RWDA 4C3HL 1RYQA 1I6HL 4LHNA 4A3IL 5JVH1 1Y1VL 1RB9A 4BY7L 1VZGA 3JR7A 4A3KL 1R0FA 3PWFA 4AI0A 1JYBA 1S30A 2KN9A 2KKDA 2AQCA 3PZAA 2AYJA 2CKAA 2GMGA 2M4VA 2A6ED 5IP7L 3RYGA 3H9BA 1TWCL 4ZN3B 4E6YA 2NVTL 4UY81 4A3JL 3HOZL 4AR5A 1BE7A 4AYBP 3HAXC 3HKZP 3LWPB 3HOWL 1B2JA 1Z92B 1PFUA 3H0GL 4LHLA 3VPBE 5M5YL 5C4JL 3M4OL 4A3LL 1PZXA 2HVYC 4B8CD 1WCML 2NVYL 3LWRB 1ZRPA 3CQZL 2XJPA 2PSMC 3PIO1 2NYDA 3HOUL 5MF6A 2YU9L 2PMZP 5GADc 3GTJL 5C4XL 4JADA 4AR3A 2PVEA 3FKIL 4GS7D 1VCXA 4A3EL 2XJRA 1F4LA 1LKOA 4AR4A 3I4ML 2J9UB 4RXNA 1LKPA 3PO2L 4YWMA 3HOVL 3S2HL 2R93L 2JI3A 3S1QL 1OWCA 2E2JL 2RFKB 2XJVA 3GTML 1VZIA 4ME3A 2M6PA 1CAAA 5AI3A 3PKJA 3GTLL 5MLC3 1Y1WL 3HJWB 4A3DL 2VL6A 3H97A 3HOYL 3B08B 4AHXA 1H7VA 2H12A 1YUZA 2NVXL 4AHWA 2AUSB 3QVDA 5MFZA 5EINC 2ERJA 2HR5A 1PFVA 2M4YA 1SFOL 1LKMA 4BY1L 3KYUA 4K9FA 4G6BA 3ZG6A 2JA7L 3S15L 4BBRL 2WAQP 2R92L 2V0EA 1IU6A 4ZN1B 1IROA 3PL5A 5GAEc 4A3ML 5H1Sc 5C3EL 3GTOL 5FLML 2M6OA 2VUML 2JA8L 2ERSA 2V0FA 2ZIXA 3H99A 3LWVB 1ODHA 5MFPA 4JAFA 5MGNA 1K83L 3IU3I 4JAEA 3S16L 2A69D 2A68D 4C3JL 5C44L 4Y52L 3K7AL 1PFYA 1BQ8A 3H9CA 1QCVA 4U671 4AHZA 5GAHc 1P7PA 2XJQA 1I3QL 4POFA 2CR8A 1DVBA 3NFPI 2V3BB 1LTLA 1BFYA 5RXNA 6RXNA 3RZOL 3PIP1 4QIWP 4AI3A 1WJVA 3S1RL 4V196 1QQTA 5GAGc 1OWBA 3GTKL 1IW7D 2WB1P 1R0IA 1SMWA 1YUXA 3RZ6A 5K2ME 1YK4A 1NXGA 2CKCA 2QL0A 3HOXL 3A44A 2C6AA 2R7ZL 3S1NL 1NXEA 5JVG1 3H3VM 3KYXA 2XJSA 2Z3QB 4WFN1 3KYWA 2C6BA 1S24A 1IRNA 2XJTA 3RZTA 1YK5A 2E2HL 3GTPL 4AHYA 1SMMA 3GTQL 3J7Z1 2A6HD 2K2DA 1TWHL 1FHMA 2NVQL 1VZHA 1B13A 3S2DL 2L0ZA 1C09A 4BBSL 1PFWA 3S1ML 5IYBL 1T9OA 5IY0A 1BQ9A 4Y7NL 1CADA 3MSUA 5IP9L 3LPEB 1TWAL 3M3YL 2PVXA 2JI2A 4JAGA 3S17L 1B2OA 4A3FL 2Z3RB 2JI1A 2JA6L
chains in the Genus database with same CATH topology
2PVEA 4GS7D 1DX8A 4XXBB 4JAEA 1VCXA 2XJRA 1NNQA 2A69D 2A68D 1LKOA 4AR4A 2XJUA 5EIOC 2B5ID 2J9UB 4RXNA 1LKPA 1R0GA 2PYAA 4TVMA 1BQ8A 5AI2A 4YWMA 3B0AB 2LCQA 1SMUA 4XGHA 1QCVA 4U671 3WWNB 2JI3A 2RDVA 4AHZA 5GAHc 1E8JA 8RXNA 1OWCA 3P8BA 1R0JA 3SS2A 5AN9H 1RWDA 2XJQA 4POFA 1RYQA 1B71A 2CR8A 1DVBA 3NFPI 2V3BB 1LTLA 4LHNA 5JVH1 1BFYA 3K35A 2XJVA 6RXNA 5RXNA 1RB9A 3PIP1 1VZIA 1QYBA 4ME3A 4AI3A 2DSXA 1VZGA 1WJVA 2M6PA 4V196 1CAAA 5GAGc 5AI3A 1OWBA 3PKJA 5MLC3 5DM61 1IW7D 4AR6A 1R0IA 2O5JD 1SMWA 1YUXA 3RZ6A 1R0FA 3PWFA 4AI0A 1YK4A 5K2ME 1S2ZA 2VL6A 1JYBA 1NXGA 1S30A 2KN9A 2KKDA 2CKCA 2QL0A 3A44A 3PKIA 3PZAA 1YV1A 2AYJA 2CKAA 3B08B 4POGA 4AHXA 2GMGA 2C6AA 3KYVA 1NXEA 2M4VA 3P2AA 5JVG1 2A6ED 1H7VA 3RYGA 3KYXA 2H12A 2XJSA 1YUZA 4ZN3B 4E6YA 2Z3QB 4WFN1 4AHWA 3KYWA 3QVDA 2C6BA 5EINC 1S24A 2ERJA 2HR5A 5MFZA 4UY81 2M4YA 1IRNA 1LKMA 1BE7A 4AR5A 1BRFA 3J7Y1 2XJTA 4TPUA 1YK5A 3RZTA 3WWLA 3KYUA 4K9FA 4G6BA 3ZG6A 4AHYA 1R0HA 1SMMA 1B2JA 1FHHA 5DM71 1Z92B 2A6HD 3J7Z1 4LHLA 3VPBE 2K2DA 1FHMA 2V0EA 1IU6A 1VZHA 3QQCE 1B13A 3MPSA 2L0ZA 4YWLA 4AI1A 4B8CD 4ZN1B 4AI2A 1IROA 1C09A 7RXNA 1T9PA 1ZRPA 5GAEc 5H1Sc 3LNLA 1RYTA 2XJPA 1T9OA 5IY0A 1BQ9A 2M6OA 2PSMC 1CADA 1RDGA 2PPTA 3MSUA 2NYDA 3PIO1 3LPEB 2ERSA 5MF6A 2V0FA 1RDVA 2ZIXA 2PVXA 5GADc 1T9QA 2JI2A 2MS3A 4JAGA 1B2OA 1IU5A 2BE5D 4JAFA 5MFPA 5MGNA 1ODHA 2Z3RB 2JI1A 3IU3I 4JADA 3KYYA 4AR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9U B;  2PPT A;  4XXB B;  3B08 B;  2C6B A;  2C6A A;  3B0A B;  3P2A A; 
#chains in the Genus database with same CATH topology
 1R9T L;  4XXB B;  2XJU A;  3LWQ B;  2B5I D;  2Y0S P;  5M5W L;  1R0G A;  2PYA A;  4TVM A;  5AI2 A;  2LCQ A;  1SMU A;  3WWN B;  4X6A L;  1E8J A;  8RXN A;  1R0J A;  3SS2 A;  5M5X L;  5AN9 H;  3LWO B;  1B71 A;  2APO B;  3K35 A;  1QYB A;  2DSX A;  4A3C L;  4A93 L;  5M3M L;  3MQK B;  5DM6 1;  4AR6 A;  2O5J D;  4A3B L;  1S2Z A;  4C2M 1;  3PKI A;  1YV1 A;  4POG A;  3KYV A;  3P2A A;  5M3F L;  5IYD L;  3HJY B;  3S14 L;  1BRF A;  4TPU A;  3RZD L;  2B63 L;  3WWL A;  1R0H A;  5DM7 1;  1FHH A;  3GTG L;  3QQC E;  4YWL A;  3MPS A;  4AI1 A;  4AI2 A;  7RXN A;  1T9P A;  3LNL A;  1RYT A;  2EY4 E;  4A3G L;  2E2I L;  1RDG A;  2PPT A;  1I50 L;  3FDJ A;  1RDV A;  1T9Q A;  2MS3 A;  1IU5 A;  2BE5 D;  5IYC L;  5FJ8 L;  3KYY A;  3J7Y 1;  1DX8 A;  1NNQ A;  2JA5 L;  5EIO C;  4BXX L;  1TWF L;  3I4N L;  3B0A B;  4C3I L;  4XGH A;  3PO3 L;  2RDV A;  1TWG L;  3P8B A;  1RWD A;  4C3H L;  1RYQ A;  1I6H L;  4LHN A;  4A3I L;  5JVH 1;  1Y1V L;  1RB9 A;  4BY7 L;  1VZG A;  3JR7 A;  4A3K L;  1R0F A;  3PWF A;  4AI0 A;  1JYB A;  1S30 A;  2KN9 A;  2KKD A;  2AQC A;  3PZA A;  2AYJ A;  2CKA A;  2GMG A;  2M4V A;  2A6E D;  5IP7 L;  3RYG A;  3H9B A;  1TWC L;  4ZN3 B;  4E6Y A;  2NVT L;  4UY8 1;  4A3J L;  3HOZ L;  4AR5 A;  1BE7 A;  4AYB P;  3HAX C;  3HKZ P;  3LWP B;  3HOW L;  1B2J A;  1Z92 B;  1PFU A;  3H0G L;  4LHL A;  3VPB E;  5M5Y L;  5C4J L;  3M4O L;  4A3L L;  1PZX A;  2HVY C;  4B8C D;  1WCM L;  2NVY L;  3LWR B;  1ZRP A;  3CQZ L;  2XJP A;  2PSM C;  3PIO 1;  2NYD A;  3HOU L;  5MF6 A;  2YU9 L;  2PMZ P;  5GAD c;  3GTJ L;  5C4X L;  4JAD A;  4AR3 A;  2PVE A;  3FKI L;  4GS7 D;  1VCX A;  4A3E L;  2XJR A;  1F4L A;  1LKO A;  4AR4 A;  3I4M L;  2J9U B;  4RXN A;  1LKP A;  3PO2 L;  4YWM A;  3HOV L;  3S2H L;  2R93 L;  2JI3 A;  3S1Q L;  1OWC A;  2E2J L;  2RFK B;  2XJV A;  3GTM L;  1VZI A;  4ME3 A;  2M6P A;  1CAA A;  5AI3 A;  3PKJ A;  3GTL L;  5MLC 3;  1Y1W L;  3HJW B;  4A3D L;  2VL6 A;  3H97 A;  3HOY L;  3B08 B;  4AHX A;  1H7V A;  2H12 A;  1YUZ A;  2NVX L;  4AHW A;  2AUS B;  3QVD A;  5MFZ A;  5EIN C;  2ERJ A;  2HR5 A;  1PFV A;  2M4Y A;  1SFO L;  1LKM A;  4BY1 L;  3KYU A;  4K9F A;  4G6B A;  3ZG6 A;  2JA7 L;  3S15 L;  4BBR L;  2WAQ P;  2R92 L;  2V0E A;  1IU6 A;  4ZN1 B;  1IRO A;  3PL5 A;  5GAE c;  4A3M L;  5H1S c;  5C3E L;  3GTO L;  5FLM L;  2M6O A;  2VUM L;  2JA8 L;  2ERS A;  2V0F A;  2ZIX A;  3H99 A;  3LWV B;  1ODH A;  5MFP A;  4JAF A;  5MGN A;  1K83 L;  3IU3 I;  4JAE A;  3S16 L;  2A69 D;  2A68 D;  4C3J L;  5C44 L;  4Y52 L;  3K7A L;  1PFY A;  1BQ8 A;  3H9C A;  1QCV A;  4U67 1;  4AHZ A;  5GAH c;  1P7P A;  2XJQ A;  1I3Q L;  4POF A;  2CR8 A;  1DVB A;  3NFP I;  2V3B B;  1LTL A;  1BFY A;  5RXN A;  6RXN A;  3RZO L;  3PIP 1;  4QIW P;  4AI3 A;  1WJV A;  3S1R L;  4V19 6;  1QQT A;  5GAG c;  1OWB A;  3GTK L;  1IW7 D;  2WB1 P;  1R0I A;  1SMW A;  1YUX A;  3RZ6 A;  5K2M E;  1YK4 A;  1NXG A;  2CKC A;  2QL0 A;  3HOX L;  3A44 A;  2C6A A;  2R7Z L;  3S1N L;  1NXE A;  5JVG 1;  3H3V M;  3KYX A;  2XJS A;  2Z3Q B;  4WFN 1;  3KYW A;  2C6B A;  1S24 A;  1IRN A;  2XJT A;  3RZT A;  1YK5 A;  2E2H L;  3GTP L;  4AHY A;  1SMM A;  3GTQ L;  3J7Z 1;  2A6H D;  2K2D A;  1TWH L;  1FHM A;  2NVQ L;  1VZH A;  1B13 A;  3S2D L;  2L0Z A;  1C09 A;  4BBS L;  1PFW A;  3S1M L;  5IYB L;  1T9O A;  5IY0 A;  1BQ9 A;  4Y7N L;  1CAD A;  3MSU A;  5IP9 L;  3LPE B;  1TWA L;  3M3Y L;  2PVX A;  2JI2 A;  4JAG A;  3S17 L;  1B2O A;  4A3F L;  2Z3R B;  2JI1 A;  2JA6 L; 
#chains in the Genus database with same CATH homology
 2PVE A;  4GS7 D;  1DX8 A;  4XXB B;  4JAE A;  1VCX A;  2XJR A;  1NNQ A;  2A69 D;  2A68 D;  1LKO A;  4AR4 A;  2XJU A;  5EIO C;  2B5I D;  2J9U B;  4RXN A;  1LKP A;  1R0G A;  2PYA A;  4TVM A;  1BQ8 A;  5AI2 A;  4YWM A;  3B0A B;  2LCQ A;  1SMU A;  4XGH A;  1QCV A;  4U67 1;  3WWN B;  2JI3 A;  2RDV A;  4AHZ A;  5GAH c;  1E8J A;  8RXN A;  1OWC A;  3P8B A;  1R0J A;  3SS2 A;  5AN9 H;  1RWD A;  2XJQ A;  4POF A;  1RYQ A;  1B71 A;  2CR8 A;  1DVB A;  3NFP I;  2V3B B;  1LTL A;  4LHN A;  5JVH 1;  1BFY A;  3K35 A;  2XJV A;  6RXN A;  5RXN A;  1RB9 A;  3PIP 1;  1VZI A;  1QYB A;  4ME3 A;  4AI3 A;  2DSX A;  1VZG A;  1WJV A;  2M6P A;  4V19 6;  1CAA A;  5GAG c;  5AI3 A;  1OWB A;  3PKJ A;  5MLC 3;  5DM6 1;  1IW7 D;  4AR6 A;  1R0I A;  2O5J D;  1SMW A;  1YUX A;  3RZ6 A;  1R0F A;  3PWF A;  4AI0 A;  1YK4 A;  5K2M E;  1S2Z A;  2VL6 A;  1JYB A;  1NXG A;  1S30 A;  2KN9 A;  2KKD A;  2CKC A;  2QL0 A;  3A44 A;  3PKI A;  3PZA A;  1YV1 A;  2AYJ A;  2CKA A;  3B08 B;  4POG A;  4AHX A;  2GMG A;  2C6A A;  3KYV A;  1NXE A;  2M4V A;  3P2A A;  5JVG 1;  2A6E D;  1H7V A;  3RYG A;  3KYX A;  2H12 A;  2XJS A;  1YUZ A;  4ZN3 B;  4E6Y A;  2Z3Q B;  4WFN 1;  4AHW A;  3KYW A;  3QVD A;  2C6B A;  5EIN C;  1S24 A;  2ERJ A;  2HR5 A;  5MFZ A;  4UY8 1;  2M4Y A;  1IRN A;  1LKM A;  1BE7 A;  4AR5 A;  1BRF A;  3J7Y 1;  2XJT A;  4TPU A;  1YK5 A;  3RZT A;  3WWL A;  3KYU A;  4K9F A;  4G6B A;  3ZG6 A;  4AHY A;  1R0H A;  1SMM A;  1B2J A;  1FHH A;  5DM7 1;  1Z92 B;  2A6H D;  3J7Z 1;  4LHL A;  3VPB E;  2K2D A;  1FHM A;  2V0E A;  1IU6 A;  1VZH A;  3QQC E;  1B13 A;  3MPS A;  2L0Z A;  4YWL A;  4AI1 A;  4B8C D;  4ZN1 B;  4AI2 A;  1IRO A;  1C09 A;  7RXN A;  1T9P A;  1ZRP A;  5GAE c;  5H1S c;  3LNL A;  1RYT A;  2XJP A;  1T9O A;  5IY0 A;  1BQ9 A;  2M6O A;  2PSM C;  1CAD A;  1RDG A;  2PPT A;  3MSU A;  2NYD A;  3PIO 1;  3LPE B;  2ERS A;  5MF6 A;  2V0F A;  1RDV A;  2ZIX A;  2PVX A;  5GAD c;  1T9Q A;  2JI2 A;  2MS3 A;  4JAG A;  1B2O A;  1IU5 A;  2BE5 D;  4JAF A;  5MFP A;  5MGN A;  1ODH A;  2Z3R B;  2JI1 A;  3IU3 I;  4JAD A;  3KYY A;  4AR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...