3B0BA

Crystal structure of the chicken cenp-s/cenp-x complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
98
structure length
98
Chain Sequence
GGEQRELLIQRLRAAVHYTTGCLCQDVAEDKGVLFSKQTVAAISEITFRQCENFARDLEMFARHAKRSTITSEDVKLLARRSNSLLKYITQKSDELAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CENP-T-W-S-X Forms a Unique Centromeric Chromatin Structure with a Histone-like Fold.
pubmed doi rcsb
molecule keywords Centromere protein S
molecule tags Dna binding protein
source organism Gallus gallus
total genus 39
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15630 CENP-S CENP-S protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b0bA00
2AROB 2AROA 1P3PD 4NE6A 5AVCB 5AVCA 1P3LD 3VH6A 3MNNC 4WU9C 4QLCD 3AYWD 2HUEC 3LZ0D 3MGPD 5AV5D 2YFVB 2YFVA 5FUGA 5FUGB 3WKJD 3WAAD 4CAYA 3WTPC 1P3BC 4X23B 4X23A 4Z2MG 3X1SC 3AV1B 3AZIC 3AV1A 1EQZC 3MGRC 3KUYC 4G91B 4WZSB 5CPID 3AZNC 1F66B 5BO0B 5GT3B 5GT3A 4J8XD 3AZKC 4LD9C 3AN2B 3W96C 1P3OD 3AZHC 4WU9B 3MNNB 3MNNA 4WU9A 1ID3D 4KHAB 2L5AA 3B0CW 1U35C 3VH5T 5E5AC 3C1CD 5F99C 2LY8A 1WWSA 3AZJD 3KWQC 2NZDC 3WTPB 3WTPA 4YM6C 1P3BA 3X1SB 3X1SA 3AZIB 3AZIA 5JRGD 5CP6D 1EQZA 5BT1C 3MGSC 3MGQC 3MGRB 3MGRA 5GSUC 3KUYB 3KUYA 4H9OB 4H9OA 5B0ZB 5B0ZA 3AZNA 5B1LD 3A6NB 3AZNB 3AFAC 3O62C 2HIOC 2FJ7B 1WWIA 5C3IC 2FJ7A 3B6FC 4G92C 3AZKA 5B33B 5AV6C 5B31C 4LD9A 5B2JD 3W96A 3AZLB 5B0YC 5B40C 3AZLA 3AZMB 3AZMA 2F8NB 3AZHB 3AZHA 5DNMC 2F8NG 1P3KD 3REHB 3REHA 1P3FA 1P3FB 4WNNB 4WNNA 3W99C 1U35B 1U35A 1M18A 1M18B 2NQBD 5E5AA 5JA4A 4KGCC 5CPKC 5F99B 5F99A 4WU8D 3KWQB 3KWQA 2NZDA 5B32D 4YM6A 3NQUB 1TZYD 4YS3C 3MGSA 3MGSB 3MGQA 3MGQB 3UTBB 5GXQD 3UTBA 3W98D 5GSUB 5GSUA 3AZGD 3MVDC 4Z5TD 3X1UC 3O62B 3O62A 2HIOA 3AFAA 3B6FB 3B6FA 4H9QB 4H9QA 1B67A 4G92B 1P34C 4J8VB 5AV6B 5AV6A 4H9NB 4H9NA 3W97C 3LZ1C 5B0YB 5B0YA 5B1MB 5B40A 1R4VA 1KX5B 2RVQC 5AV8C 5BNXB 5BNXA 5DNMA 5DNMB 3X1VD 1S32D 3W99B 3REID 3W99A 5CPKB 3UT9D 5CPKA 1JFIA 1JFIB 4KGCA 3UTAD 1BH8B 1BH8A 2AROD 4H9SC 4XUJC 5DNNC 5AY8C 2YFWB 2YFWA 3LJAC 4J8UB 3RELC 4YS3A 4YS3B 1M19C 1P3ID 3MVDA 3C1BB 3X1UB 3X1UA 4ZBJB 5KDMB 5KDMA 1P34A 4X23D 3W97B 3W97A 1HQ3B 4Z66B 3REJC 3B0BA 3LZ1B 3LZ1A 5AV8B 5AV8A 4JJNC 4UUZA 3AZEB 3AZEA 1F66D 2BYMA 5B2ID 4NE5A 3VH5A 5AV9C 3B0CT 1KX4C 3AN2D 4H9SA 4XUJA 4XUJB 5DNNA 5AY8A 1P3PC 4KUDD 1TAFB 1TAFA 4NE3A 4CAYB 1P3LC 4DRAA 3LJAA 3RELB 3RELA 1M19B 4QLCC 1M19A 3X1TD 2CV5D 3LZ0C 3MGPC 4DRBA 1N1JB 1N1JA 2PYOD 4R8PB 4R8PA 3WKJC 3WAAC 3REJA 4JJNA 5B0ZD 3A6ND 5CPIC 5AVBD 2FJ7D 5AV9A 2HUEB 4J8XC 1KX4B 1KX4A 5B33D 2IO5C 3REKD 1P3OC 1P3PB 1P3PA 3AZLD 3AZMD 2F8ND 1P3LB 1P3LA 3KXBD 1P3BB 1ID3C 4QLCA 3REHD 1P3FD 4E45A 1EQZB 1M18D 3LZ0B 1A7WA 3LZ0A 3MGPB 3MGPA 3C1CC 3AZFD 3WTPE 1ZLAD 3KWQD 3WAAA 4H9PB 4H9PA 3V9RA 3V9RB 3AZKB 5JRGC 3UTBD 1M1AD 4LD9B 2BYKB 2BYKA 3W96B 5CPIB 5CPIA 5B1LC 5BNVB 5BNVA 4J8VD 2IO5B 3WA9C 5E5AB 5JA4B 5B2JC 1P3OA 5B0YD 1P3MD 5B1MD 1KX5D 2NZDB 4YM6B 1ID3B 1ID3A 4J8WD 1P3KC 4XZQD 3C1CA 5CPKD 2NQBC 5B24D 3TU4D 4WU8C 3AFAB 2HIOB 5B32C 5C3IB 1AOID 1TZYC 5JRGA 4J8UD 5B31B 3VH6W 5B31A 3AV2D 3W98C 3B6GD 5B31G 3C1BD 4Z5TC 5B40B 5GT0D 3X1UD 4ZUXD 5CPJD 3B0DC 3LELD 1P3GD 3WA9B 3WA9A 4KGCB 1HQ3D 1Q9CA 4Z66D 2F8NK 1P3AD 2RVQD 5AVCD 3AZED 3X1VC 1S32C 3REIC 2NQBA 3UT9C 3MVDB 3UTAC 4WU8B 4WU8A 4XUJD 5B32B 5B32A 1P34B 1TZYB 1TZYA 5B32G 4WV4B 3AV1D 3W98B 3W98A 1P3IC 5CHLB 3R45B 3R45A 4Z5TB 4Z5TA 1KX3C 4UUZB 4CSRB 4CSRA 4R8PD 2BYMB 3B0DB 3KSYA 5GT3D 4X23C 5G49B 5G49A 5DNNB 5AY8B 4G91C 1HTAA 3X1VA 1S32A 4WU9D 5B2IC 3MNND 3LJAB 1F66C 3REIB 3REIA 3AYWC 1KX4D 3UT9A 3UTAB 4EO5C 3UTAA 5AV5C 3AN2C 4NFTA 4KUDC 5BS7C 3WTPD 1P3BD 3X1SD 3AZID 1EQZD 3REJB 1P3IA 1P3IB 3X1TC 2CV5C 3MGRD 1KX3B 1KX3A 3KUYD 4JJNB 2PYOC 1F1EA 3AZND 5AV9B 3AZKD 4LD9D 4M6BA 3W96D 3NQJB 3NQJA 1ULYA 3AZHD 5B0ZC 5B2IB 1H3OB 1H3OA 5B2IA 5BO0A 5AVBC 3A6NC 1F66A 2FJ7C 4QLCB 4AWLC 3AYWA 3AYWB 1U35D 5B33C 5E5AD 4EO5B 3REKC 1KU5A 5AV5A 5AV5B 3AN2A 5F99D 4KUDB 4KUDA 3WKJB 3AZLC 3WKJA 3WAAB 2NZDD 3AZMC 3AZJC 5BS7A 4YM6D 3KXBC 2CWEA 3REHC 1P3FC 4KHAA 5BT1D 5CP6C 1M18C 3MGSD 3VH6T 3MGQD 3X1TB 3X1TA 2CV5A 2CV5B 3AZFC 5GSUD 2PYOB 2PYOA 1ZLAC 3AFAD 3O62D 2HIOD 3B6FD 4J8XB 4J8XA 1BFMA 5AV6D 5B31D 3UTBC 1M1AC 1P3OB 1B6WA 5B40D 3A6NA 5AVBB 5AVBA 5DNMD 4AWLB 3W99D 4J8VC 3WA9D 5B33A 3REKA 3REKB 4Z2MH 3C1CB 4KGCD 1P3MC 5B1MC 1KX5C 3AZJB 3AZJA 2F8NA 3KXBB 3KXBA 4J8WC 4E44A 4HGAC 5JRGB 5CP6B 5CP6A 4XZQC 4YS3D 3VH5W 5GXQC 3AZFA 3AZFB 3MVDD 5B24C 3AZGC 3TU4C 1ZLAB 1ZLAA 5B1LB 5B1LA 1P34D 3NQUA 1AOIC 4J8UC 1M1AB 1M1AA 3W97D 5B2JB 5B2JA 3AV2C 3LZ1D 3B6GC 3C1BC 5GT0C 5AV8D 4ZUXC 4ZBJC 5CPJC 1P3KA 1P3KB 4J8VA 3LELC 1P3GC 2NQBB 1HQ3C 4Z66C 1P3AC 1P3MB 1P3MA 5B1MA 2AROC 1KX5A 5DNND 5AY8D 5AVCC 4J8WB 4J8WA 3AZEC 4HGAB 3LJAD 4XZQB 4XZQA 3RELD 1M19D 5GXQB 5GXQA 5B24B 5B24A 3TU4B 3TU4A 3AZGA 3AZGB 4H9RB 4H9RA 1BH9B 1BH9A 1AOIB 1AOIA 4J8UA 2F8NH 3AV1C 3AV2B 3AV2A 3REJD 3B6GB 3B6GA 3C1BA 5GT0B 5GT0A 1KX3D 4ZUXB 4ZUXA 4JJND 4R8PC 3X1VB 2JSSA 5CPJB 5CPJA 1S32B 3LELB 5AV9D 5GT3C 3LELA 1P3GB 1P3GA 3UT9B 1HQ3A 4Z66A 1P3AB 1P3AA
chains in the Genus database with same CATH superfamily
2AROB 2AROA 1P3PD 2Y2JA 4NE6A 5AVCB 5AVCA 2G5IC 3A1IA 1P3LD 3VH6A 3MNNC 4WU9C 2JE5A 4QLCD 3AYWD 2HUEC 3LZ0D 3MGPD 5AV5D 2YFVB 2YFVA 5FUGA 5FUGB 1Z2CB 2RIQA 3WKJD 3IP4C 3WAAD 4CAYA 3H0MC 3WTPC 1P3BC 4X23B 4X23A 4Z2MG 3X1SC 3AV1B 3AZIC 3AV1A 1EQZC 3KFUG 3MGRC 3KUYC 4G91B 4WZSB 5CPID 3AZNC 1F66B 5BO0B 5GT3B 5GT3A 4J8XD 3AZKC 4LD9C 3AN2B 3W96C 1P3OD 1W2EA 3AZHC 4WU9B 3MNNB 3MNNA 4WU9A 1ID3D 4KHAB 1T3UA 2L5AA 2VQRA 3B0CW 1U35C 3VH5T 5E5AC 3C1CD 5F99C 2LY8A 1WWSA 3AZJD 3KWQC 2NZDC 3WTPB 4YM6C 3WTPA 1P3BA 3X1SB 3X1SA 3AZIB 3AZIA 5JRGD 5CP6D 1EQZA 5BT1C 3MGSC 3MGQC 3MGRB 3MGRA 5GSUC 3KUYB 3KUYA 4H9OB 4H9OA 5B0ZB 5B0ZA 3AZNA 5B1LD 3A6NB 3AZNB 3AFAC 3O62C 2HIOC 2FJ7B 1WWIA 5C3IC 2FJ7A 3B6FC 4G92C 3AZKA 5B33B 5AV6C 3EPHA 5B31C 4LD9A 5B2JD 3W96A 3AZLB 5B0YC 5B40C 3AZLA 3AZMB 3AZMA 2F8NB 3AZHB 3AZHA 5DNMC 2F8NG 1P3KD 3REHB 3REHA 1P3FA 1P3FB 4WNNB 4WNNA 3W99C 1U35B 1U35A 1M18A 2Y2PA 1M18B 2NQBD 5E5AA 3EPJA 5JA4A 4KGCC 5CPKC 5F99B 5F99A 4WU8D 3AL0C 3KWQB 3KWQA 2NZDA 5B32D 4YM6A 3NQUB 1TZYD 4YS3C 3MGSA 3MGSB 3MGQA 3MGQB 3UTBB 5GXQD 3UTBA 3W98D 2Y2GA 5GSUB 5GSUA 3AZGD 3MVDC 4Z5TD 3X1UC 3O62B 3O62A 2HIOA 3AFAA 4DQYB 3B6FB 4H9QB 4H9QA 1B67A 4G92B 1P34C 4J8VB 3B6FA 2Y2NA 5AV6B 2DQNC 5AV6A 4H9NB 4H9NA 3W97C 3LZ1C 5B0YB 5B0YA 5B1MB 5B40A 1R4VA 1KX5B 2RVQC 5AV8C 5BNXB 5BNXA 5DNMA 5DNMB 3X1VD 1S32D 3W99B 3REID 3W99A 2Y2MA 5CPKB 3UT9D 5CPKA 1JFIA 1JFIB 4KGCA 3UTAD 1BH8B 1BH8A 2AROD 4H9SC 4XUJC 2G5HC 5AY8C 5DNNC 2W8SA 2YFWB 2YFWA 2ZY3A 3LJAC 4J8UB 3RELC 4YS3A 4YS3B 1M19C 3EPKA 1P3ID 3H0LC 3MVDA 3C1BB 3X1UB 3X1UA 4ZBJB 5KDMB 5KDMA 1P34A 4X23D 3W97B 3W97A 1HQ3B 4Z66B 3REJC 3B0BA 3LZ1B 3LZ1A 5AV8B 5AV8A 4JJNC 4UUZA 3AZEB 3AZEA 1F66D 2BYMA 5B2ID 3P5JB 4NE5A 3VH5A 5AV9C 3B0CT 1KX4C 3AN2D 4H9SA 4XUJA 4XUJB 5DNNA 5AY8A 1P3PC 4KUDD 1TAFB 1TAFA 4NE3A 4CAYB 1P3LC 4DRAA 3LJAA 3RELB 3RELA 1M19B 4QLCC 1M19A 3X1TD 2CV5D 3LZ0C 3MGPC 4DRBA 1N1JB 1N1JA 2PYOD 4R8PB 4R8PA 3WKJC 3WAAC 2Y2IA 3REJA 4JJNA 5B0ZD 3A6ND 5CPIC 5AVBD 2FJ7D 3EG5B 5AV9A 2HUEB 4J8XC 1KX4B 1KX4A 5B33D 2IO5C 3REKD 1P3OC 1P3PB 1P3PA 3AZLD 3AZMD 2F8ND 1P3LB 1P3LA 3KXBD 1P3BB 1ID3C 4QLCA 3REHD 1P3FD 4E45A 1EQZB 1M18D 3LZ0B 1A7WA 3LZ0A 3MGPB 3MGPA 3C1CC 3AZFD 2DF4C 3F6TA 3WTPE 1ZLAD 3KWQD 3WAAA 4H9PB 4H9PA 3V9RA 3V9RB 3AZKB 5JRGC 3UTBD 1M1AD 4LD9B 2BYKB 2BYKA 3W96B 2ZY4A 5CPIB 5CPIA 5B1LC 5BNVB 5BNVA 4J8VD 2IO5B 3WA9C 5E5AB 5JA4B 5B2JC 1P3OA 5B0YD 1P3MD 5B1MD 1KX5D 2NZDB 2ZY2A 4YM6B 1ID3B 1ID3A 4J8WD 2JCHA 1P3KC 4XZQD 3C1CA 5CPKD 2NQBC 5B24D 3TU4D 4WU8C 3AFAB 2HIOB 5B32C 5C3IB 1AOID 1TZYC 5JRGA 4J8UD 5B31B 3VH6W 5B31A 3AV2D 3W98C 3B6GD 5B31G 3C1BD 4Z5TC 5B40B 5GT0D 3X1UD 2BG1A 2ZY5A 4ZUXD 5CPJD 3B0DC 3LELD 1P3GD 3WA9B 3WA9A 4KGCB 1HQ3D 1Q9CA 4Z66D 2F8NK 1P3AD 2RVQD 5AVCD 2UWXA 3AZED 3X1VC 1S32C 3REIC 2NQBA 3UT9C 2FFFB 3MVDB 3UTAC 4WU8B 4WU8A 4XUJD 5B32B 5B32A 1P34B 1TZYB 1TZYA 5B32G 4WV4B 3AV1D 3W98B 3W98A 1P3IC 5CHLB 3R45B 3R45A 4Z5TB 4Z5TA 1KX3C 4UUZB 4CSRB 4CSRA 4R8PD 2BYMB 3B0DB 3KSYA 5GT3D 4X23C 5G49B 5G49A 5DNNB 5AY8B 4G91C 1HTAA 3X1VA 1S32A 4WU9D 5B2IC 3MNND 3LJAB 1F66C 3REIB 3REIA 3FDDA 3AYWC 1KX4D 3UT9A 3UTAB 4EO5C 3UTAA 5AV5C 3AN2C 2J8PA 4NFTA 4KUDC 5BS7C 3WTPD 1P3BD 3X1SD 3AZID 1EQZD 3REJB 1P3IA 1P3IB 2ZM5A 3X1TC 2CV5C 4UPKA 3MGRD 1KX3B 1KX3A 3KUYD 4JJNB 2PYOC 1F1EA 3AZND 5AV9B 3AZKD 2Y2HA 4LD9D 4M6BA 3W96D 3NQJB 3NQJA 1ULYA 3AZHD 1H3OB 5B2IB 1H3OA 5B2IA 5B0ZC 5BO0A 5AVBC 3A6NC 1F66A 2FJ7C 4QLCB 4AWLC 3AYWA 3AYWB 1U35D 3H0RC 5B33C 5E5AD 4EO5B 3REKC 1KU5A 5AV5A 5AV5B 3AN2A 5F99D 4KUDB 4KUDA 3WKJB 2Y2OA 3AZLC 3WKJA 3WAAB 3AZMC 3AZJC 2NZDD 5BS7A 4YM6D 3KXBC 2CWEA 3REHC 1P3FC 4KHAA 5BT1D 5CP6C 1M18C 3MGSD 3VH6T 3MGQD 3X1TB 3X1TA 2CV5A 2CV5B 3AZFC 5GSUD 3A1KA 2PYOB 2PYOA 2Y2LA 1ZLAC 3AFAD 3O62D 2HIOD 3B6FD 2XD5A 4J8XB 4J8XA 1BFMA 5AV6D 5B31D 3UTBC 1M1AC 4WJ3C 1P3OB 1B6WA 5B40D 3A6NA 5AVBB 5AVBA 5DNMD 4AWLB 3W99D 4J8VC 3WA9D 5B33A 3REKA 3REKB 4Z2MH 3C1CB 4KGCD 1P3MC 5B1MC 1KX5C 3AZJB 3AZJA 2F8NA 2XD1A 3KXBB 3KXBA 4J8WC 4E44A 4HGAC 5JRGB 5CP6B 5CP6A 4XZQC 4YS3D 3EPLA 3VH5W 5GXQC 3AZFA 3AZFB 3MVDD 5B24C 3AZGC 3TU4C 1ZLAB 1ZLAA 5B1LB 5B1LA 1P34D 3NQUA 2Y2QA 1AOIC 4J8UC 1M1AB 1M1AA 3W97D 5B2JB 5B2JA 2Y2KA 3AV2C 3LZ1D 3B6GC 3C1BC 5GT0C 5AV8D 4ZUXC 4ZBJC 5CPJC 1P3KA 1P3KB 4J8VA 3LELC 1P3GC 2NQBB 1HQ3C 4Z66C 1P3AC 1P3MB 1PZRA 1P3MA 5B1MA 2AROC 1KX5A 5DNND 5AY8D 5AVCC 4J8WB 4J8WA 3AZEC 4HGAB 3LJAD 4XZQB 4XZQA 3RELD 1M19D 5GXQB 5GXQA 5B24B 5B24A 3TU4B 3TU4A 3AZGA 3AZGB 4H9RB 4H9RA 1BH9B 1BH9A 1AOIB 1AOIA 4J8UA 2F8NH 3AV1C 3AV2B 3AV2A 3REJD 3B6GB 3B6GA 3C1BA 5GT0B 5GT0A 1KX3D 2F2AC 4ZUXB 4ZUXA 4JJND 4R8PC 3X1VB 2JSSA 5CPJB 5CPJA 1S32B 3LELB 5AV9D 5GT3C 3LELA 1P3GB 1P3GA 3UT9B 1HQ3A 4Z66A 1P3AB 1P3AA
chains in the Genus database with same CATH topology
2AROB 2AROA 1P3PD 2Y2JA 4NE6A 5AVCB 5AVCA 2G5IC 3A1IA 1P3LD 3VH6A 3MNNC 4WU9C 2JE5A 4QLCD 3AYWD 2HUEC 3LZ0D 3MGPD 5AV5D 2YFVB 2YFVA 5FUGA 5FUGB 1Z2CB 2RIQA 3WKJD 3IP4C 3WAAD 4CAYA 3H0MC 3WTPC 1P3BC 4X23B 4X23A 4Z2MG 3X1SC 3AV1B 3AZIC 3AV1A 1EQZC 3KFUG 3MGRC 3KUYC 4G91B 4WZSB 5CPID 3AZNC 1F66B 5BO0B 5GT3B 5GT3A 4J8XD 3AZKC 4LD9C 3AN2B 3W96C 1P3OD 1W2EA 3AZHC 4WU9B 3MNNB 3MNNA 4WU9A 1ID3D 4KHAB 1T3UA 2L5AA 2VQRA 3B0CW 1U35C 3VH5T 5E5AC 3C1CD 5F99C 2LY8A 1WWSA 3AZJD 3KWQC 2NZDC 3WTPB 4YM6C 3WTPA 1P3BA 3X1SB 3X1SA 3AZIB 3AZIA 5JRGD 5CP6D 1EQZA 5BT1C 3MGSC 3MGQC 3MGRB 3MGRA 5GSUC 3KUYB 3KUYA 4H9OB 4H9OA 5B0ZB 5B0ZA 3AZNA 5B1LD 3A6NB 3AZNB 3AFAC 3O62C 2HIOC 2FJ7B 1WWIA 5C3IC 2FJ7A 3B6FC 4G92C 3AZKA 5B33B 5AV6C 3EPHA 5B31C 4LD9A 5B2JD 3W96A 3AZLB 5B0YC 5B40C 3AZLA 3AZMB 3AZMA 2F8NB 3AZHB 3AZHA 5DNMC 2F8NG 1P3KD 3REHB 3REHA 1P3FA 1P3FB 4WNNB 4WNNA 3W99C 1U35B 1U35A 1M18A 2Y2PA 1M18B 2NQBD 5E5AA 3EPJA 5JA4A 4KGCC 5CPKC 5F99B 5F99A 4WU8D 3AL0C 3KWQB 3KWQA 2NZDA 5B32D 4YM6A 3NQUB 1TZYD 4YS3C 3MGSA 3MGSB 3MGQA 3MGQB 3UTBB 5GXQD 3UTBA 3W98D 2Y2GA 5GSUB 5GSUA 3AZGD 3MVDC 4Z5TD 3X1UC 3O62B 3O62A 2HIOA 3AFAA 4DQYB 3B6FB 4H9QB 4H9QA 1B67A 4G92B 1P34C 4J8VB 3B6FA 2Y2NA 5AV6B 2DQNC 5AV6A 4H9NB 4H9NA 3W97C 3LZ1C 5B0YB 5B0YA 5B1MB 5B40A 1R4VA 1KX5B 2RVQC 5AV8C 5BNXB 5BNXA 5DNMA 5DNMB 3X1VD 1S32D 3W99B 3REID 3W99A 2Y2MA 5CPKB 3UT9D 5CPKA 1JFIA 1JFIB 4KGCA 3UTAD 1BH8B 1BH8A 2AROD 4H9SC 4XUJC 2G5HC 5AY8C 5DNNC 2W8SA 2YFWB 2YFWA 2ZY3A 3LJAC 4J8UB 3RELC 4YS3A 4YS3B 1M19C 3EPKA 1P3ID 3H0LC 3MVDA 3C1BB 3X1UB 3X1UA 4ZBJB 5KDMB 5KDMA 1P34A 4X23D 3W97B 3W97A 1HQ3B 4Z66B 3REJC 3B0BA 3LZ1B 3LZ1A 5AV8B 5AV8A 4JJNC 4UUZA 3AZEB 3AZEA 1F66D 2BYMA 5B2ID 3P5JB 4NE5A 3VH5A 5AV9C 3B0CT 1KX4C 3AN2D 4H9SA 4XUJA 4XUJB 5DNNA 5AY8A 1P3PC 4KUDD 1TAFB 1TAFA 4NE3A 4CAYB 1P3LC 4DRAA 3LJAA 3RELB 3RELA 1M19B 4QLCC 1M19A 3X1TD 2CV5D 3LZ0C 3MGPC 4DRBA 1N1JB 1N1JA 2PYOD 4R8PB 4R8PA 3WKJC 3WAAC 2Y2IA 3REJA 4JJNA 5B0ZD 3A6ND 5CPIC 5AVBD 2FJ7D 3EG5B 5AV9A 2HUEB 4J8XC 1KX4B 1KX4A 5B33D 2IO5C 3REKD 1P3OC 1P3PB 1P3PA 3AZLD 3AZMD 2F8ND 1P3LB 1P3LA 3KXBD 1P3BB 1ID3C 4QLCA 3REHD 1P3FD 4E45A 1EQZB 1M18D 3LZ0B 1A7WA 3LZ0A 3MGPB 3MGPA 3C1CC 3AZFD 2DF4C 3F6TA 3WTPE 1ZLAD 3KWQD 3WAAA 4H9PB 4H9PA 3V9RA 3V9RB 3AZKB 5JRGC 3UTBD 1M1AD 4LD9B 2BYKB 2BYKA 3W96B 2ZY4A 5CPIB 5CPIA 5B1LC 5BNVB 5BNVA 4J8VD 2IO5B 3WA9C 5E5AB 5JA4B 5B2JC 1P3OA 5B0YD 1P3MD 5B1MD 1KX5D 2NZDB 2ZY2A 4YM6B 1ID3B 1ID3A 4J8WD 2JCHA 1P3KC 4XZQD 3C1CA 5CPKD 2NQBC 5B24D 3TU4D 4WU8C 3AFAB 2HIOB 5B32C 5C3IB 1AOID 1TZYC 5JRGA 4J8UD 5B31B 3VH6W 5B31A 3AV2D 3W98C 3B6GD 5B31G 3C1BD 4Z5TC 5B40B 5GT0D 3X1UD 2BG1A 2ZY5A 4ZUXD 5CPJD 3B0DC 3LELD 1P3GD 3WA9B 3WA9A 4KGCB 1HQ3D 1Q9CA 4Z66D 2F8NK 1P3AD 2RVQD 5AVCD 2UWXA 3AZED 3X1VC 1S32C 3REIC 2NQBA 3UT9C 2FFFB 3MVDB 3UTAC 4WU8B 4WU8A 4XUJD 5B32B 5B32A 1P34B 1TZYB 1TZYA 5B32G 4WV4B 3AV1D 3W98B 3W98A 1P3IC 5CHLB 3R45B 3R45A 4Z5TB 4Z5TA 1KX3C 4UUZB 4CSRB 4CSRA 4R8PD 2BYMB 3B0DB 3KSYA 5GT3D 4X23C 5G49B 5G49A 5DNNB 5AY8B 4G91C 1HTAA 3X1VA 1S32A 4WU9D 5B2IC 3MNND 3LJAB 1F66C 3REIB 3REIA 3FDDA 3AYWC 1KX4D 3UT9A 3UTAB 4EO5C 3UTAA 5AV5C 3AN2C 2J8PA 4NFTA 4KUDC 5BS7C 3WTPD 1P3BD 3X1SD 3AZID 1EQZD 3REJB 1P3IA 1P3IB 2ZM5A 3X1TC 2CV5C 4UPKA 3MGRD 1KX3B 1KX3A 3KUYD 4JJNB 2PYOC 1F1EA 3AZND 5AV9B 3AZKD 2Y2HA 4LD9D 4M6BA 3W96D 3NQJB 3NQJA 1ULYA 3AZHD 1H3OB 5B2IB 1H3OA 5B2IA 5B0ZC 5BO0A 5AVBC 3A6NC 1F66A 2FJ7C 4QLCB 4AWLC 3AYWA 3AYWB 1U35D 3H0RC 5B33C 5E5AD 4EO5B 3REKC 1KU5A 5AV5A 5AV5B 3AN2A 5F99D 4KUDB 4KUDA 3WKJB 2Y2OA 3AZLC 3WKJA 3WAAB 3AZMC 3AZJC 2NZDD 5BS7A 4YM6D 3KXBC 2CWEA 3REHC 1P3FC 4KHAA 5BT1D 5CP6C 1M18C 3MGSD 3VH6T 3MGQD 3X1TB 3X1TA 2CV5A 2CV5B 3AZFC 5GSUD 3A1KA 2PYOB 2PYOA 2Y2LA 1ZLAC 3AFAD 3O62D 2HIOD 3B6FD 2XD5A 4J8XB 4J8XA 1BFMA 5AV6D 5B31D 3UTBC 1M1AC 4WJ3C 1P3OB 1B6WA 5B40D 3A6NA 5AVBB 5AVBA 5DNMD 4AWLB 3W99D 4J8VC 3WA9D 5B33A 3REKA 3REKB 4Z2MH 3C1CB 4KGCD 1P3MC 5B1MC 1KX5C 3AZJB 3AZJA 2F8NA 2XD1A 3KXBB 3KXBA 4J8WC 4E44A 4HGAC 5JRGB 5CP6B 5CP6A 4XZQC 4YS3D 3EPLA 3VH5W 5GXQC 3AZFA 3AZFB 3MVDD 5B24C 3AZGC 3TU4C 1ZLAB 1ZLAA 5B1LB 5B1LA 1P34D 3NQUA 2Y2QA 1AOIC 4J8UC 1M1AB 1M1AA 3W97D 5B2JB 5B2JA 2Y2KA 3AV2C 3LZ1D 3B6GC 3C1BC 5GT0C 5AV8D 4ZUXC 4ZBJC 5CPJC 1P3KA 1P3KB 4J8VA 3LELC 1P3GC 2NQBB 1HQ3C 4Z66C 1P3AC 1P3MB 1PZRA 1P3MA 5B1MA 2AROC 1KX5A 5DNND 5AY8D 5AVCC 4J8WB 4J8WA 3AZEC 4HGAB 3LJAD 4XZQB 4XZQA 3RELD 1M19D 5GXQB 5GXQA 5B24B 5B24A 3TU4B 3TU4A 3AZGA 3AZGB 4H9RB 4H9RA 1BH9B 1BH9A 1AOIB 1AOIA 4J8UA 2F8NH 3AV1C 3AV2B 3AV2A 3REJD 3B6GB 3B6GA 3C1BA 5GT0B 5GT0A 1KX3D 2F2AC 4ZUXB 4ZUXA 4JJND 4R8PC 3X1VB 2JSSA 5CPJB 5CPJA 1S32B 3LELB 5AV9D 5GT3C 3LELA 1P3GB 1P3GA 3UT9B 1HQ3A 4Z66A 1P3AB 1P3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ARO B;  2ARO A;  1P3P D;  4NE6 A;  5AVC B;  5AVC A;  1P3L D;  3VH6 A;  3MNN C;  4WU9 C;  4QLC D;  3AYW D;  2HUE C;  3LZ0 D;  3MGP D;  5AV5 D;  2YFV B;  2YFV A;  5FUG A;  5FUG B;  3WKJ D;  3WAA D;  4CAY A;  3WTP C;  1P3B C;  4X23 B;  4X23 A;  4Z2M G;  3X1S C;  3AV1 B;  3AZI C;  3AV1 A;  1EQZ C;  3MGR C;  3KUY C;  4G91 B;  4WZS B;  5CPI D;  3AZN C;  1F66 B;  5BO0 B;  5GT3 B;  5GT3 A;  4J8X D;  3AZK C;  4LD9 C;  3AN2 B;  3W96 C;  1P3O D;  3AZH C;  4WU9 B;  3MNN B;  3MNN A;  4WU9 A;  1ID3 D;  4KHA B;  2L5A A;  3B0C W;  1U35 C;  3VH5 T;  5E5A C;  3C1C D;  5F99 C;  2LY8 A;  1WWS A;  3AZJ D;  3KWQ C;  2NZD C;  3WTP B;  3WTP A;  4YM6 C;  1P3B A;  3X1S B;  3X1S A;  3AZI B;  3AZI A;  5JRG D;  5CP6 D;  1EQZ A;  5BT1 C;  3MGS C;  3MGQ C;  3MGR B;  3MGR A;  5GSU C;  3KUY B;  3KUY A;  4H9O B;  4H9O A;  5B0Z B;  5B0Z A;  3AZN A;  5B1L D;  3A6N B;  3AZN B;  3AFA C;  3O62 C;  2HIO C;  2FJ7 B;  1WWI A;  5C3I C;  2FJ7 A;  3B6F C;  4G92 C;  3AZK A;  5B33 B;  5AV6 C;  5B31 C;  4LD9 A;  5B2J D;  3W96 A;  3AZL B;  5B0Y C;  5B40 C;  3AZL A;  3AZM B;  3AZM A;  2F8N B;  3AZH B;  3AZH A;  5DNM C;  2F8N G;  1P3K D;  3REH B;  3REH A;  1P3F A;  1P3F B;  4WNN B;  4WNN A;  3W99 C;  1U35 B;  1U35 A;  1M18 A;  1M18 B;  2NQB D;  5E5A A;  5JA4 A;  4KGC C;  5CPK C;  5F99 B;  5F99 A;  4WU8 D;  3KWQ B;  3KWQ A;  2NZD A;  5B32 D;  4YM6 A;  3NQU B;  1TZY D;  4YS3 C;  3MGS A;  3MGS B;  3MGQ A;  3MGQ B;  3UTB B;  5GXQ D;  3UTB A;  3W98 D;  5GSU B;  5GSU A;  3AZG D;  3MVD C;  4Z5T D;  3X1U C;  3O62 B;  3O62 A;  2HIO A;  3AFA A;  3B6F B;  3B6F A;  4H9Q B;  4H9Q A;  1B67 A;  4G92 B;  1P34 C;  4J8V B;  5AV6 B;  5AV6 A;  4H9N B;  4H9N A;  3W97 C;  3LZ1 C;  5B0Y B;  5B0Y A;  5B1M B;  5B40 A;  1R4V A;  1KX5 B;  2RVQ C;  5AV8 C;  5BNX B;  5BNX A;  5DNM A;  5DNM B;  3X1V D;  1S32 D;  3W99 B;  3REI D;  3W99 A;  5CPK B;  3UT9 D;  5CPK A;  1JFI A;  1JFI B;  4KGC A;  3UTA D;  1BH8 B;  1BH8 A;  2ARO D;  4H9S C;  4XUJ C;  5DNN C;  5AY8 C;  2YFW B;  2YFW A;  3LJA C;  4J8U B;  3REL C;  4YS3 A;  4YS3 B;  1M19 C;  1P3I D;  3MVD A;  3C1B B;  3X1U B;  3X1U A;  4ZBJ B;  5KDM B;  5KDM A;  1P34 A;  4X23 D;  3W97 B;  3W97 A;  1HQ3 B;  4Z66 B;  3REJ C;  3B0B A;  3LZ1 B;  3LZ1 A;  5AV8 B;  5AV8 A;  4JJN C;  4UUZ A;  3AZE B;  3AZE A;  1F66 D;  2BYM A;  5B2I D;  4NE5 A;  3VH5 A;  5AV9 C;  3B0C T;  1KX4 C;  3AN2 D;  4H9S A;  4XUJ A;  4XUJ B;  5DNN A;  5AY8 A;  1P3P C;  4KUD D;  1TAF B;  1TAF A;  4NE3 A;  4CAY B;  1P3L C;  4DRA A;  3LJA A;  3REL B;  3REL A;  1M19 B;  4QLC C;  1M19 A;  3X1T D;  2CV5 D;  3LZ0 C;  3MGP C;  4DRB A;  1N1J B;  1N1J A;  2PYO D;  4R8P B;  4R8P A;  3WKJ C;  3WAA C;  3REJ A;  4JJN A;  5B0Z D;  3A6N D;  5CPI C;  5AVB D;  2FJ7 D;  5AV9 A;  2HUE B;  4J8X C;  1KX4 B;  1KX4 A;  5B33 D;  2IO5 C;  3REK D;  1P3O C;  1P3P B;  1P3P A;  3AZL D;  3AZM D;  2F8N D;  1P3L B;  1P3L A;  3KXB D;  1P3B B;  1ID3 C;  4QLC A;  3REH D;  1P3F D;  4E45 A;  1EQZ B;  1M18 D;  3LZ0 B;  1A7W A;  3LZ0 A;  3MGP B;  3MGP A;  3C1C C;  3AZF D;  3WTP E;  1ZLA D;  3KWQ D;  3WAA A;  4H9P B;  4H9P A;  3V9R A;  3V9R B;  3AZK B;  5JRG C;  3UTB D;  1M1A D;  4LD9 B;  2BYK B;  2BYK A;  3W96 B;  5CPI B;  5CPI A;  5B1L C;  5BNV B;  5BNV A;  4J8V D;  2IO5 B;  3WA9 C;  5E5A B;  5JA4 B;  5B2J C;  1P3O A;  5B0Y D;  1P3M D;  5B1M D;  1KX5 D;  2NZD B;  4YM6 B;  1ID3 B;  1ID3 A;  4J8W D;  1P3K C;  4XZQ D;  3C1C A;  5CPK D;  2NQB C;  5B24 D;  3TU4 D;  4WU8 C;  3AFA B;  2HIO B;  5B32 C;  5C3I B;  1AOI D;  1TZY C;  5JRG A;  4J8U D;  5B31 B;  3VH6 W;  5B31 A;  3AV2 D;  3W98 C;  3B6G D;  5B31 G;  3C1B D;  4Z5T C;  5B40 B;  5GT0 D;  3X1U D;  4ZUX D;  5CPJ D;  3B0D C;  3LEL D;  1P3G D;  3WA9 B;  3WA9 A;  4KGC B;  1HQ3 D;  1Q9C A;  4Z66 D;  2F8N K;  1P3A D;  2RVQ D;  5AVC D;  3AZE D;  3X1V C;  1S32 C;  3REI C;  2NQB A;  3UT9 C;  3MVD B;  3UTA C;  4WU8 B;  4WU8 A;  4XUJ D;  5B32 B;  5B32 A;  1P34 B;  1TZY B;  1TZY A;  5B32 G;  4WV4 B;  3AV1 D;  3W98 B;  3W98 A;  1P3I C;  5CHL B;  3R45 B;  3R45 A;  4Z5T B;  4Z5T A;  1KX3 C;  4UUZ B;  4CSR B;  4CSR A;  4R8P D;  2BYM B;  3B0D B;  3KSY A;  5GT3 D;  4X23 C;  5G49 B;  5G49 A;  5DNN B;  5AY8 B;  4G91 C;  1HTA A;  3X1V A;  1S32 A;  4WU9 D;  5B2I C;  3MNN D;  3LJA B;  1F66 C;  3REI B;  3REI A;  3AYW C;  1KX4 D;  3UT9 A;  3UTA B;  4EO5 C;  3UTA A;  5AV5 C;  3AN2 C;  4NFT A;  4KUD C;  5BS7 C;  3WTP D;  1P3B D;  3X1S D;  3AZI D;  1EQZ D;  3REJ B;  1P3I A;  1P3I B;  3X1T C;  2CV5 C;  3MGR D;  1KX3 B;  1KX3 A;  3KUY D;  4JJN B;  2PYO C;  1F1E A;  3AZN D;  5AV9 B;  3AZK D;  4LD9 D;  4M6B A;  3W96 D;  3NQJ B;  3NQJ A;  1ULY A;  3AZH D;  5B0Z C;  5B2I B;  1H3O B;  1H3O A;  5B2I A;  5BO0 A;  5AVB C;  3A6N C;  1F66 A;  2FJ7 C;  4QLC B;  4AWL C;  3AYW A;  3AYW B;  1U35 D;  5B33 C;  5E5A D;  4EO5 B;  3REK C;  1KU5 A;  5AV5 A;  5AV5 B;  3AN2 A;  5F99 D;  4KUD B;  4KUD A;  3WKJ B;  3AZL C;  3WKJ A;  3WAA B;  2NZD D;  3AZM C;  3AZJ C;  5BS7 A;  4YM6 D;  3KXB C;  2CWE A;  3REH C;  1P3F C;  4KHA A;  5BT1 D;  5CP6 C;  1M18 C;  3MGS D;  3VH6 T;  3MGQ D;  3X1T B;  3X1T A;  2CV5 A;  2CV5 B;  3AZF C;  5GSU D;  2PYO B;  2PYO A;  1ZLA C;  3AFA D;  3O62 D;  2HIO D;  3B6F D;  4J8X B;  4J8X A;  1BFM A;  5AV6 D;  5B31 D;  3UTB C;  1M1A C;  1P3O B;  1B6W A;  5B40 D;  3A6N A;  5AVB B;  5AVB A;  5DNM D;  4AWL B;  3W99 D;  4J8V C;  3WA9 D;  5B33 A;  3REK A;  3REK B;  4Z2M H;  3C1C B;  4KGC D;  1P3M C;  5B1M C;  1KX5 C;  3AZJ B;  3AZJ A;  2F8N A;  3KXB B;  3KXB A;  4J8W C;  4E44 A;  4HGA C;  5JRG B;  5CP6 B;  5CP6 A;  4XZQ C;  4YS3 D;  3VH5 W;  5GXQ C;  3AZF A;  3AZF B;  3MVD D;  5B24 C;  3AZG C;  3TU4 C;  1ZLA B;  1ZLA A;  5B1L B;  5B1L A;  1P34 D;  3NQU A;  1AOI C;  4J8U C;  1M1A B;  1M1A A;  3W97 D;  5B2J B;  5B2J A;  3AV2 C;  3LZ1 D;  3B6G C;  3C1B C;  5GT0 C;  5AV8 D;  4ZUX C;  4ZBJ C;  5CPJ C;  1P3K A;  1P3K B;  4J8V A;  3LEL C;  1P3G C;  2NQB B;  1HQ3 C;  4Z66 C;  1P3A C;  1P3M B;  1P3M A;  5B1M A;  2ARO C;  1KX5 A;  5DNN D;  5AY8 D;  5AVC C;  4J8W B;  4J8W A;  3AZE C;  4HGA B;  3LJA D;  4XZQ B;  4XZQ A;  3REL D;  1M19 D;  5GXQ B;  5GXQ A;  5B24 B;  5B24 A;  3TU4 B;  3TU4 A;  3AZG A;  3AZG B;  4H9R B;  4H9R A;  1BH9 B;  1BH9 A;  1AOI B;  1AOI A;  4J8U A;  2F8N H;  3AV1 C;  3AV2 B;  3AV2 A;  3REJ D;  3B6G B;  3B6G A;  3C1B A;  5GT0 B;  5GT0 A;  1KX3 D;  4ZUX B;  4ZUX A;  4JJN D;  4R8P C;  3X1V B;  2JSS A;  5CPJ B;  5CPJ A;  1S32 B;  3LEL B;  5AV9 D;  5GT3 C;  3LEL A;  1P3G B;  1P3G A;  3UT9 B;  1HQ3 A;  4Z66 A;  1P3A B;  1P3A A; 
#chains in the Genus database with same CATH topology
 2ARO B;  2ARO A;  1P3P D;  2Y2J A;  4NE6 A;  5AVC B;  5AVC A;  2G5I C;  3A1I A;  1P3L D;  3VH6 A;  3MNN C;  4WU9 C;  2JE5 A;  4QLC D;  3AYW D;  2HUE C;  3LZ0 D;  3MGP D;  5AV5 D;  2YFV B;  2YFV A;  5FUG A;  5FUG B;  1Z2C B;  2RIQ A;  3WKJ D;  3IP4 C;  3WAA D;  4CAY A;  3H0M C;  3WTP C;  1P3B C;  4X23 B;  4X23 A;  4Z2M G;  3X1S C;  3AV1 B;  3AZI C;  3AV1 A;  1EQZ C;  3KFU G;  3MGR C;  3KUY C;  4G91 B;  4WZS B;  5CPI D;  3AZN C;  1F66 B;  5BO0 B;  5GT3 B;  5GT3 A;  4J8X D;  3AZK C;  4LD9 C;  3AN2 B;  3W96 C;  1P3O D;  1W2E A;  3AZH C;  4WU9 B;  3MNN B;  3MNN A;  4WU9 A;  1ID3 D;  4KHA B;  1T3U A;  2L5A A;  2VQR A;  3B0C W;  1U35 C;  3VH5 T;  5E5A C;  3C1C D;  5F99 C;  2LY8 A;  1WWS A;  3AZJ D;  3KWQ C;  2NZD C;  3WTP B;  4YM6 C;  3WTP A;  1P3B A;  3X1S B;  3X1S A;  3AZI B;  3AZI A;  5JRG D;  5CP6 D;  1EQZ A;  5BT1 C;  3MGS C;  3MGQ C;  3MGR B;  3MGR A;  5GSU C;  3KUY B;  3KUY A;  4H9O B;  4H9O A;  5B0Z B;  5B0Z A;  3AZN A;  5B1L D;  3A6N B;  3AZN B;  3AFA C;  3O62 C;  2HIO C;  2FJ7 B;  1WWI A;  5C3I C;  2FJ7 A;  3B6F C;  4G92 C;  3AZK A;  5B33 B;  5AV6 C;  3EPH A;  5B31 C;  4LD9 A;  5B2J D;  3W96 A;  3AZL B;  5B0Y C;  5B40 C;  3AZL A;  3AZM B;  3AZM A;  2F8N B;  3AZH B;  3AZH A;  5DNM C;  2F8N G;  1P3K D;  3REH B;  3REH A;  1P3F A;  1P3F B;  4WNN B;  4WNN A;  3W99 C;  1U35 B;  1U35 A;  1M18 A;  2Y2P A;  1M18 B;  2NQB D;  5E5A A;  3EPJ A;  5JA4 A;  4KGC C;  5CPK C;  5F99 B;  5F99 A;  4WU8 D;  3AL0 C;  3KWQ B;  3KWQ A;  2NZD A;  5B32 D;  4YM6 A;  3NQU B;  1TZY D;  4YS3 C;  3MGS A;  3MGS B;  3MGQ A;  3MGQ B;  3UTB B;  5GXQ D;  3UTB A;  3W98 D;  2Y2G A;  5GSU B;  5GSU A;  3AZG D;  3MVD C;  4Z5T D;  3X1U C;  3O62 B;  3O62 A;  2HIO A;  3AFA A;  4DQY B;  3B6F B;  4H9Q B;  4H9Q A;  1B67 A;  4G92 B;  1P34 C;  4J8V B;  3B6F A;  2Y2N A;  5AV6 B;  2DQN C;  5AV6 A;  4H9N B;  4H9N A;  3W97 C;  3LZ1 C;  5B0Y B;  5B0Y A;  5B1M B;  5B40 A;  1R4V A;  1KX5 B;  2RVQ C;  5AV8 C;  5BNX B;  5BNX A;  5DNM A;  5DNM B;  3X1V D;  1S32 D;  3W99 B;  3REI D;  3W99 A;  2Y2M A;  5CPK B;  3UT9 D;  5CPK A;  1JFI A;  1JFI B;  4KGC A;  3UTA D;  1BH8 B;  1BH8 A;  2ARO D;  4H9S C;  4XUJ C;  2G5H C;  5AY8 C;  5DNN C;  2W8S A;  2YFW B;  2YFW A;  2ZY3 A;  3LJA C;  4J8U B;  3REL C;  4YS3 A;  4YS3 B;  1M19 C;  3EPK A;  1P3I D;  3H0L C;  3MVD A;  3C1B B;  3X1U B;  3X1U A;  4ZBJ B;  5KDM B;  5KDM A;  1P34 A;  4X23 D;  3W97 B;  3W97 A;  1HQ3 B;  4Z66 B;  3REJ C;  3B0B A;  3LZ1 B;  3LZ1 A;  5AV8 B;  5AV8 A;  4JJN C;  4UUZ A;  3AZE B;  3AZE A;  1F66 D;  2BYM A;  5B2I D;  3P5J B;  4NE5 A;  3VH5 A;  5AV9 C;  3B0C T;  1KX4 C;  3AN2 D;  4H9S A;  4XUJ A;  4XUJ B;  5DNN A;  5AY8 A;  1P3P C;  4KUD D;  1TAF B;  1TAF A;  4NE3 A;  4CAY B;  1P3L C;  4DRA A;  3LJA A;  3REL B;  3REL A;  1M19 B;  4QLC C;  1M19 A;  3X1T D;  2CV5 D;  3LZ0 C;  3MGP C;  4DRB A;  1N1J B;  1N1J A;  2PYO D;  4R8P B;  4R8P A;  3WKJ C;  3WAA C;  2Y2I A;  3REJ A;  4JJN A;  5B0Z D;  3A6N D;  5CPI C;  5AVB D;  2FJ7 D;  3EG5 B;  5AV9 A;  2HUE B;  4J8X C;  1KX4 B;  1KX4 A;  5B33 D;  2IO5 C;  3REK D;  1P3O C;  1P3P B;  1P3P A;  3AZL D;  3AZM D;  2F8N D;  1P3L B;  1P3L A;  3KXB D;  1P3B B;  1ID3 C;  4QLC A;  3REH D;  1P3F D;  4E45 A;  1EQZ B;  1M18 D;  3LZ0 B;  1A7W A;  3LZ0 A;  3MGP B;  3MGP A;  3C1C C;  3AZF D;  2DF4 C;  3F6T A;  3WTP E;  1ZLA D;  3KWQ D;  3WAA A;  4H9P B;  4H9P A;  3V9R A;  3V9R B;  3AZK B;  5JRG C;  3UTB D;  1M1A D;  4LD9 B;  2BYK B;  2BYK A;  3W96 B;  2ZY4 A;  5CPI B;  5CPI A;  5B1L C;  5BNV B;  5BNV A;  4J8V D;  2IO5 B;  3WA9 C;  5E5A B;  5JA4 B;  5B2J C;  1P3O A;  5B0Y D;  1P3M D;  5B1M D;  1KX5 D;  2NZD B;  2ZY2 A;  4YM6 B;  1ID3 B;  1ID3 A;  4J8W D;  2JCH A;  1P3K C;  4XZQ D;  3C1C A;  5CPK D;  2NQB C;  5B24 D;  3TU4 D;  4WU8 C;  3AFA B;  2HIO B;  5B32 C;  5C3I B;  1AOI D;  1TZY C;  5JRG A;  4J8U D;  5B31 B;  3VH6 W;  5B31 A;  3AV2 D;  3W98 C;  3B6G D;  5B31 G;  3C1B D;  4Z5T C;  5B40 B;  5GT0 D;  3X1U D;  2BG1 A;  2ZY5 A;  4ZUX D;  5CPJ D;  3B0D C;  3LEL D;  1P3G D;  3WA9 B;  3WA9 A;  4KGC B;  1HQ3 D;  1Q9C A;  4Z66 D;  2F8N K;  1P3A D;  2RVQ D;  5AVC D;  2UWX A;  3AZE D;  3X1V C;  1S32 C;  3REI C;  2NQB A;  3UT9 C;  2FFF B;  3MVD B;  3UTA C;  4WU8 B;  4WU8 A;  4XUJ D;  5B32 B;  5B32 A;  1P34 B;  1TZY B;  1TZY A;  5B32 G;  4WV4 B;  3AV1 D;  3W98 B;  3W98 A;  1P3I C;  5CHL B;  3R45 B;  3R45 A;  4Z5T B;  4Z5T A;  1KX3 C;  4UUZ B;  4CSR B;  4CSR A;  4R8P D;  2BYM B;  3B0D B;  3KSY A;  5GT3 D;  4X23 C;  5G49 B;  5G49 A;  5DNN B;  5AY8 B;  4G91 C;  1HTA A;  3X1V A;  1S32 A;  4WU9 D;  5B2I C;  3MNN D;  3LJA B;  1F66 C;  3REI B;  3REI A;  3FDD A;  3AYW C;  1KX4 D;  3UT9 A;  3UTA B;  4EO5 C;  3UTA A;  5AV5 C;  3AN2 C;  2J8P A;  4NFT A;  4KUD C;  5BS7 C;  3WTP D;  1P3B D;  3X1S D;  3AZI D;  1EQZ D;  3REJ B;  1P3I A;  1P3I B;  2ZM5 A;  3X1T C;  2CV5 C;  4UPK A;  3MGR D;  1KX3 B;  1KX3 A;  3KUY D;  4JJN B;  2PYO C;  1F1E A;  3AZN D;  5AV9 B;  3AZK D;  2Y2H A;  4LD9 D;  4M6B A;  3W96 D;  3NQJ B;  3NQJ A;  1ULY A;  3AZH D;  1H3O B;  5B2I B;  1H3O A;  5B2I A;  5B0Z C;  5BO0 A;  5AVB C;  3A6N C;  1F66 A;  2FJ7 C;  4QLC B;  4AWL C;  3AYW A;  3AYW B;  1U35 D;  3H0R C;  5B33 C;  5E5A D;  4EO5 B;  3REK C;  1KU5 A;  5AV5 A;  5AV5 B;  3AN2 A;  5F99 D;  4KUD B;  4KUD A;  3WKJ B;  2Y2O A;  3AZL C;  3WKJ A;  3WAA B;  3AZM C;  3AZJ C;  2NZD D;  5BS7 A;  4YM6 D;  3KXB C;  2CWE A;  3REH C;  1P3F C;  4KHA A;  5BT1 D;  5CP6 C;  1M18 C;  3MGS D;  3VH6 T;  3MGQ D;  3X1T B;  3X1T A;  2CV5 A;  2CV5 B;  3AZF C;  5GSU D;  3A1K A;  2PYO B;  2PYO A;  2Y2L A;  1ZLA C;  3AFA D;  3O62 D;  2HIO D;  3B6F D;  2XD5 A;  4J8X B;  4J8X A;  1BFM A;  5AV6 D;  5B31 D;  3UTB C;  1M1A C;  4WJ3 C;  1P3O B;  1B6W A;  5B40 D;  3A6N A;  5AVB B;  5AVB A;  5DNM D;  4AWL B;  3W99 D;  4J8V C;  3WA9 D;  5B33 A;  3REK A;  3REK B;  4Z2M H;  3C1C B;  4KGC D;  1P3M C;  5B1M C;  1KX5 C;  3AZJ B;  3AZJ A;  2F8N A;  2XD1 A;  3KXB B;  3KXB A;  4J8W C;  4E44 A;  4HGA C;  5JRG B;  5CP6 B;  5CP6 A;  4XZQ C;  4YS3 D;  3EPL A;  3VH5 W;  5GXQ C;  3AZF A;  3AZF B;  3MVD D;  5B24 C;  3AZG C;  3TU4 C;  1ZLA B;  1ZLA A;  5B1L B;  5B1L A;  1P34 D;  3NQU A;  2Y2Q A;  1AOI C;  4J8U C;  1M1A B;  1M1A A;  3W97 D;  5B2J B;  5B2J A;  2Y2K A;  3AV2 C;  3LZ1 D;  3B6G C;  3C1B C;  5GT0 C;  5AV8 D;  4ZUX C;  4ZBJ C;  5CPJ C;  1P3K A;  1P3K B;  4J8V A;  3LEL C;  1P3G C;  2NQB B;  1HQ3 C;  4Z66 C;  1P3A C;  1P3M B;  1PZR A;  1P3M A;  5B1M A;  2ARO C;  1KX5 A;  5DNN D;  5AY8 D;  5AVC C;  4J8W B;  4J8W A;  3AZE C;  4HGA B;  3LJA D;  4XZQ B;  4XZQ A;  3REL D;  1M19 D;  5GXQ B;  5GXQ A;  5B24 B;  5B24 A;  3TU4 B;  3TU4 A;  3AZG A;  3AZG B;  4H9R B;  4H9R A;  1BH9 B;  1BH9 A;  1AOI B;  1AOI A;  4J8U A;  2F8N H;  3AV1 C;  3AV2 B;  3AV2 A;  3REJ D;  3B6G B;  3B6G A;  3C1B A;  5GT0 B;  5GT0 A;  1KX3 D;  2F2A C;  4ZUX B;  4ZUX A;  4JJN D;  4R8P C;  3X1V B;  2JSS A;  5CPJ B;  5CPJ A;  1S32 B;  3LEL B;  5AV9 D;  5GT3 C;  3LEL A;  1P3G B;  1P3G A;  3UT9 B;  1HQ3 A;  4Z66 A;  1P3A B;  1P3A A; 
#chains in the Genus database with same CATH homology
 2ARO B;  2ARO A;  1P3P D;  2Y2J A;  4NE6 A;  5AVC B;  5AVC A;  2G5I C;  3A1I A;  1P3L D;  3VH6 A;  3MNN C;  4WU9 C;  2JE5 A;  4QLC D;  3AYW D;  2HUE C;  3LZ0 D;  3MGP D;  5AV5 D;  2YFV B;  2YFV A;  5FUG A;  5FUG B;  1Z2C B;  2RIQ A;  3WKJ D;  3IP4 C;  3WAA D;  4CAY A;  3H0M C;  3WTP C;  1P3B C;  4X23 B;  4X23 A;  4Z2M G;  3X1S C;  3AV1 B;  3AZI C;  3AV1 A;  1EQZ C;  3KFU G;  3MGR C;  3KUY C;  4G91 B;  4WZS B;  5CPI D;  3AZN C;  1F66 B;  5BO0 B;  5GT3 B;  5GT3 A;  4J8X D;  3AZK C;  4LD9 C;  3AN2 B;  3W96 C;  1P3O D;  1W2E A;  3AZH C;  4WU9 B;  3MNN B;  3MNN A;  4WU9 A;  1ID3 D;  4KHA B;  1T3U A;  2L5A A;  2VQR A;  3B0C W;  1U35 C;  3VH5 T;  5E5A C;  3C1C D;  5F99 C;  2LY8 A;  1WWS A;  3AZJ D;  3KWQ C;  2NZD C;  3WTP B;  4YM6 C;  3WTP A;  1P3B A;  3X1S B;  3X1S A;  3AZI B;  3AZI A;  5JRG D;  5CP6 D;  1EQZ A;  5BT1 C;  3MGS C;  3MGQ C;  3MGR B;  3MGR A;  5GSU C;  3KUY B;  3KUY A;  4H9O B;  4H9O A;  5B0Z B;  5B0Z A;  3AZN A;  5B1L D;  3A6N B;  3AZN B;  3AFA C;  3O62 C;  2HIO C;  2FJ7 B;  1WWI A;  5C3I C;  2FJ7 A;  3B6F C;  4G92 C;  3AZK A;  5B33 B;  5AV6 C;  3EPH A;  5B31 C;  4LD9 A;  5B2J D;  3W96 A;  3AZL B;  5B0Y C;  5B40 C;  3AZL A;  3AZM B;  3AZM A;  2F8N B;  3AZH B;  3AZH A;  5DNM C;  2F8N G;  1P3K D;  3REH B;  3REH A;  1P3F A;  1P3F B;  4WNN B;  4WNN A;  3W99 C;  1U35 B;  1U35 A;  1M18 A;  2Y2P A;  1M18 B;  2NQB D;  5E5A A;  3EPJ A;  5JA4 A;  4KGC C;  5CPK C;  5F99 B;  5F99 A;  4WU8 D;  3AL0 C;  3KWQ B;  3KWQ A;  2NZD A;  5B32 D;  4YM6 A;  3NQU B;  1TZY D;  4YS3 C;  3MGS A;  3MGS B;  3MGQ A;  3MGQ B;  3UTB B;  5GXQ D;  3UTB A;  3W98 D;  2Y2G A;  5GSU B;  5GSU A;  3AZG D;  3MVD C;  4Z5T D;  3X1U C;  3O62 B;  3O62 A;  2HIO A;  3AFA A;  4DQY B;  3B6F B;  4H9Q B;  4H9Q A;  1B67 A;  4G92 B;  1P34 C;  4J8V B;  3B6F A;  2Y2N A;  5AV6 B;  2DQN C;  5AV6 A;  4H9N B;  4H9N A;  3W97 C;  3LZ1 C;  5B0Y B;  5B0Y A;  5B1M B;  5B40 A;  1R4V A;  1KX5 B;  2RVQ C;  5AV8 C;  5BNX B;  5BNX A;  5DNM A;  5DNM B;  3X1V D;  1S32 D;  3W99 B;  3REI D;  3W99 A;  2Y2M A;  5CPK B;  3UT9 D;  5CPK A;  1JFI A;  1JFI B;  4KGC A;  3UTA D;  1BH8 B;  1BH8 A;  2ARO D;  4H9S C;  4XUJ C;  2G5H C;  5AY8 C;  5DNN C;  2W8S A;  2YFW B;  2YFW A;  2ZY3 A;  3LJA C;  4J8U B;  3REL C;  4YS3 A;  4YS3 B;  1M19 C;  3EPK A;  1P3I D;  3H0L C;  3MVD A;  3C1B B;  3X1U B;  3X1U A;  4ZBJ B;  5KDM B;  5KDM A;  1P34 A;  4X23 D;  3W97 B;  3W97 A;  1HQ3 B;  4Z66 B;  3REJ C;  3B0B A;  3LZ1 B;  3LZ1 A;  5AV8 B;  5AV8 A;  4JJN C;  4UUZ A;  3AZE B;  3AZE A;  1F66 D;  2BYM A;  5B2I D;  3P5J B;  4NE5 A;  3VH5 A;  5AV9 C;  3B0C T;  1KX4 C;  3AN2 D;  4H9S A;  4XUJ A;  4XUJ B;  5DNN A;  5AY8 A;  1P3P C;  4KUD D;  1TAF B;  1TAF A;  4NE3 A;  4CAY B;  1P3L C;  4DRA A;  3LJA A;  3REL B;  3REL A;  1M19 B;  4QLC C;  1M19 A;  3X1T D;  2CV5 D;  3LZ0 C;  3MGP C;  4DRB A;  1N1J B;  1N1J A;  2PYO D;  4R8P B;  4R8P A;  3WKJ C;  3WAA C;  2Y2I A;  3REJ A;  4JJN A;  5B0Z D;  3A6N D;  5CPI C;  5AVB D;  2FJ7 D;  3EG5 B;  5AV9 A;  2HUE B;  4J8X C;  1KX4 B;  1KX4 A;  5B33 D;  2IO5 C;  3REK D;  1P3O C;  1P3P B;  1P3P A;  3AZL D;  3AZM D;  2F8N D;  1P3L B;  1P3L A;  3KXB D;  1P3B B;  1ID3 C;  4QLC A;  3REH D;  1P3F D;  4E45 A;  1EQZ B;  1M18 D;  3LZ0 B;  1A7W A;  3LZ0 A;  3MGP B;  3MGP A;  3C1C C;  3AZF D;  2DF4 C;  3F6T A;  3WTP E;  1ZLA D;  3KWQ D;  3WAA A;  4H9P B;  4H9P A;  3V9R A;  3V9R B;  3AZK B;  5JRG C;  3UTB D;  1M1A D;  4LD9 B;  2BYK B;  2BYK A;  3W96 B;  2ZY4 A;  5CPI B;  5CPI A;  5B1L C;  5BNV B;  5BNV A;  4J8V D;  2IO5 B;  3WA9 C;  5E5A B;  5JA4 B;  5B2J C;  1P3O A;  5B0Y D;  1P3M D;  5B1M D;  1KX5 D;  2NZD B;  2ZY2 A;  4YM6 B;  1ID3 B;  1ID3 A;  4J8W D;  2JCH A;  1P3K C;  4XZQ D;  3C1C A;  5CPK D;  2NQB C;  5B24 D;  3TU4 D;  4WU8 C;  3AFA B;  2HIO B;  5B32 C;  5C3I B;  1AOI D;  1TZY C;  5JRG A;  4J8U D;  5B31 B;  3VH6 W;  5B31 A;  3AV2 D;  3W98 C;  3B6G D;  5B31 G;  3C1B D;  4Z5T C;  5B40 B;  5GT0 D;  3X1U D;  2BG1 A;  2ZY5 A;  4ZUX D;  5CPJ D;  3B0D C;  3LEL D;  1P3G D;  3WA9 B;  3WA9 A;  4KGC B;  1HQ3 D;  1Q9C A;  4Z66 D;  2F8N K;  1P3A D;  2RVQ D;  5AVC D;  2UWX A;  3AZE D;  3X1V C;  1S32 C;  3REI C;  2NQB A;  3UT9 C;  2FFF B;  3MVD B;  3UTA C;  4WU8 B;  4WU8 A;  4XUJ D;  5B32 B;  5B32 A;  1P34 B;  1TZY B;  1TZY A;  5B32 G;  4WV4 B;  3AV1 D;  3W98 B;  3W98 A;  1P3I C;  5CHL B;  3R45 B;  3R45 A;  4Z5T B;  4Z5T A;  1KX3 C;  4UUZ B;  4CSR B;  4CSR A;  4R8P D;  2BYM B;  3B0D B;  3KSY A;  5GT3 D;  4X23 C;  5G49 B;  5G49 A;  5DNN B;  5AY8 B;  4G91 C;  1HTA A;  3X1V A;  1S32 A;  4WU9 D;  5B2I C;  3MNN D;  3LJA B;  1F66 C;  3REI B;  3REI A;  3FDD A;  3AYW C;  1KX4 D;  3UT9 A;  3UTA B;  4EO5 C;  3UTA A;  5AV5 C;  3AN2 C;  2J8P A;  4NFT A;  4KUD C;  5BS7 C;  3WTP D;  1P3B D;  3X1S D;  3AZI D;  1EQZ D;  3REJ B;  1P3I A;  1P3I B;  2ZM5 A;  3X1T C;  2CV5 C;  4UPK A;  3MGR D;  1KX3 B;  1KX3 A;  3KUY D;  4JJN B;  2PYO C;  1F1E A;  3AZN D;  5AV9 B;  3AZK D;  2Y2H A;  4LD9 D;  4M6B A;  3W96 D;  3NQJ B;  3NQJ A;  1ULY A;  3AZH D;  1H3O B;  5B2I B;  1H3O A;  5B2I A;  5B0Z C;  5BO0 A;  5AVB C;  3A6N C;  1F66 A;  2FJ7 C;  4QLC B;  4AWL C;  3AYW A;  3AYW B;  1U35 D;  3H0R C;  5B33 C;  5E5A D;  4EO5 B;  3REK C;  1KU5 A;  5AV5 A;  5AV5 B;  3AN2 A;  5F99 D;  4KUD B;  4KUD A;  3WKJ B;  2Y2O A;  3AZL C;  3WKJ A;  3WAA B;  3AZM C;  3AZJ C;  2NZD D;  5BS7 A;  4YM6 D;  3KXB C;  2CWE A;  3REH C;  1P3F C;  4KHA A;  5BT1 D;  5CP6 C;  1M18 C;  3MGS D;  3VH6 T;  3MGQ D;  3X1T B;  3X1T A;  2CV5 A;  2CV5 B;  3AZF C;  5GSU D;  3A1K A;  2PYO B;  2PYO A;  2Y2L A;  1ZLA C;  3AFA D;  3O62 D;  2HIO D;  3B6F D;  2XD5 A;  4J8X B;  4J8X A;  1BFM A;  5AV6 D;  5B31 D;  3UTB C;  1M1A C;  4WJ3 C;  1P3O B;  1B6W A;  5B40 D;  3A6N A;  5AVB B;  5AVB A;  5DNM D;  4AWL B;  3W99 D;  4J8V C;  3WA9 D;  5B33 A;  3REK A;  3REK B;  4Z2M H;  3C1C B;  4KGC D;  1P3M C;  5B1M C;  1KX5 C;  3AZJ B;  3AZJ A;  2F8N A;  2XD1 A;  3KXB B;  3KXB A;  4J8W C;  4E44 A;  4HGA C;  5JRG B;  5CP6 B;  5CP6 A;  4XZQ C;  4YS3 D;  3EPL A;  3VH5 W;  5GXQ C;  3AZF A;  3AZF B;  3MVD D;  5B24 C;  3AZG C;  3TU4 C;  1ZLA B;  1ZLA A;  5B1L B;  5B1L A;  1P34 D;  3NQU A;  2Y2Q A;  1AOI C;  4J8U C;  1M1A B;  1M1A A;  3W97 D;  5B2J B;  5B2J A;  2Y2K A;  3AV2 C;  3LZ1 D;  3B6G C;  3C1B C;  5GT0 C;  5AV8 D;  4ZUX C;  4ZBJ C;  5CPJ C;  1P3K A;  1P3K B;  4J8V A;  3LEL C;  1P3G C;  2NQB B;  1HQ3 C;  4Z66 C;  1P3A C;  1P3M B;  1PZR A;  1P3M A;  5B1M A;  2ARO C;  1KX5 A;  5DNN D;  5AY8 D;  5AVC C;  4J8W B;  4J8W A;  3AZE C;  4HGA B;  3LJA D;  4XZQ B;  4XZQ A;  3REL D;  1M19 D;  5GXQ B;  5GXQ A;  5B24 B;  5B24 A;  3TU4 B;  3TU4 A;  3AZG A;  3AZG B;  4H9R B;  4H9R A;  1BH9 B;  1BH9 A;  1AOI B;  1AOI A;  4J8U A;  2F8N H;  3AV1 C;  3AV2 B;  3AV2 A;  3REJ D;  3B6G B;  3B6G A;  3C1B A;  5GT0 B;  5GT0 A;  1KX3 D;  2F2A C;  4ZUX B;  4ZUX A;  4JJN D;  4R8P C;  3X1V B;  2JSS A;  5CPJ B;  5CPJ A;  1S32 B;  3LEL B;  5AV9 D;  5GT3 C;  3LEL A;  1P3G B;  1P3G A;  3UT9 B;  1HQ3 A;  4Z66 A;  1P3A B;  1P3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...