3B12A

Crystal structure of the fluoroacetate dehalogenase d104 mutant from burkholderia sp. fa1 in complex with fluoroacetate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
294
structure length
294
Chain Sequence
MFEGFERRLVDVGDVTINCVVGGSGPALLLLHGFPQNLHMWARVAPLLANEYTVVCADLRGYGGSSKPVGAPDHANYSFRAMASDQRELMRTLGFERFHLVGHARGGRTGHRMALDHPDSVLSLAVLDIIPTYVMFEEVDRFVARAYWHWYFLQQPAPYPEKVIGADPDTFYEGCLFGWGATGADGFDPEQLEEYRKQWRDPAAIHGSCCDYRAGGTIDFELDHGDLGRQVQCPALVFSGSAGLMHSLFEMQVVWAPRLANMRFASLPGGHFFVDRFPDDTARILREFLSDARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate specificity of fluoroacetate dehalogenase: an insight from crystallographic analysis, fluorescence spectroscopy, and theoretical computations
pubmed doi rcsb
source organism Burkholderia sp.
molecule tags Hydrolase
molecule keywords Fluoroacetate dehalogenase
total genus 113
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3b12A00
3DYIA 1CUHA 1CQZA 3C8DA 2PSJA 2HU7A 3GUUA 2E3JA 4K6KA 1LNSA 2Y2UA 2Y6UA 1QOZA 4PO3X 3BL8A 3P2MA 3HLKA 4QLOA 3I2JA 5EGNA 2W6CX 3V9AA 3W06A 2QTBA 4KRYA 1EVQA 4FBMA 4MEBA 4OYLA 1XQYA 1XZEA 4LIPD 5CURA 3K9BA 3STUA 1IUPA 2PX6A 4KR0A 3FCYA 1ZD3A 1W75A 2JEZA 3WMRA 4AO6A 2FUKA 5AICA 5ALDA 1LZLA 2ACEA 2PM8A 5ALPA 2Z3WA 1QIMA 4EBBA 5AM4A 1BS9A 4JH0A 2H7CA 2RIPA 4NS4A 1QO9A 4PV7A 4FTWA 4QDUA 5JD6A 1R4ZA 3HJUA 3E1GA 5AIAA 4KE9A 4OCZA 1SC9A 1ZIXA 4FLFA 3WK9A 5ISMA 1MX1A 2BKLA 3DD5A 4BP8A 1CUYA 3T4UA 1ZGCA 5E4TA 3D2AA 3EQ8A 5DJ5A 5AI6A 2JEYA 3LIIA 1UK9A 2YXPX 4BE9A 1TIBA 5JARA 3R3ZA 5JADA 1IVYA 4KRXA 2Z3ZA 2VF2A 4JNCA 1WB6A 4Y2XA 5JAOA 1J1IA 4FDMA 3OM8A 2GBIA 2WJ3A 3I2FA 2XUAA 2EDAA 1XZLA 2XMSA 5JYCA 4PSCA 3ANSA 3OPMA 3U1TA 3DEAA 1U4NA 3LLCA 1H2XA 2V97A 4MEAA 2WFZA 4JYPA 3DOHA 2J3QA 4G8BA 2PSEA 5I8PA 2QRUA 2HA6A 3O9VA 3AZPA 1F6WA 1Q83A 5CMLA 3VJMA 2HA2A 3WYDA 3L1HA 4W1RA 1DINA 2ZVDA 4TPKA 3A6ZA 5JZBA 3ZPXA 4MJ3A 3W04A 4GDMA 1EDDA 1GKKA 3IA2A 2XT0A 4QDTA 4UHCA 5E4YA 5T4HA 4RPCA 4BCCA 2XMCA 4E46A 3WK6A 2H1IA 3B3QA 3VJLA 3RK4A 4N5IX 4B6GA 4Y2RA 2D0DA 1EXWA 1HLGA 3TJMA 3LCRA 2XUHA 3WIBA 1DTEA 1PV1A 1FFCA 1BEZA 2VQ6A 5HQ3B 5LZ4A 5DTJA 5LZ7A 1LBSA 3F97A 3O4GA 5HKAA 2GZSA 4FHZA 2WUEA 4OPMA 1QIHA 4KE8A 2DCMA 3HACA 1EK1A 2QJRA 2ONCA 1QIGA 3VJKA 3YASA 3ANTA 3GROA 3ED1A 5C8XA 1MAAA 3QMVA 1DWQA 5CXXA 5AK3A 3FAKA 4FLEA 1CUWA 5LLSA 5LYYA 2JGMA 4X94A 3T52A 1PJAA 1H23A 1CR6A 3C6BA 1XRMA 2XQJA 3FYUA 4KE6A 2R8BA 5ALIA 3WKDA 3I2GA 1XLVA 3I6MA 3UUEA 2B61A 4CG1A 3SC2A 3MUOA 2J3DA 5AI5A 3VVLA 2PSFA 1UT6A 2ZSHA 4QWMA 5HK9A 2XUGA 1EB9A 5H3HA 3CN7A 2BAGA 3TEJA 1J07A 5LIPA 3ILSA 3H17A 1DQZA 4BCBA 4OB7A 4MWTA 2NW6A 3A70A 5BWCA 4K6HA 3HSSA 1U65A 3BDVA 1Y7IA 2QOEA 3OG9A 2WHPA 2WUFA 1JJFA 3G9XA 1GQSA 3ESAA 3I6YA 2OPHA 4KYVA 4OU4A 4OB8A 1FFEA 4BZZA 3SK0A 1UXOA 2QUBA 2XMGA 4Q3KA 4B0PA 3NGMA 4BDSA 4PSUA 2QJWA 4EY4A 1XRNA 1UKAA 5K3DA 3FCXA 1THGA 2DQZA 1MNAA 5ALHA 4A5SA 2JIDA 5A7HA 4UUQA 3WKBA 2CJPA 3IBTA 3D7RA 2G5PA 3ESDA 1DU4A 3Q8WA 4WDQA 4ZRDA 2B20A 2PU5A 3ESCA 3E0XA 2ZYIA 1CUXA 1EI9A 5ALZA 3ZLUA 4C88A 3FYUB 2I03A 2FX5A 5E4JA 5A62A 4QDOA 5LZ9A 4L9AA 5DYWA 3D5EA 2WFLA 5DWDA 4FFVA 4NZZA 3WL5A 1G66A 1KU0A 4UHDA 5DNVA 2C5FA 4BDTA 2BCEA 3OTQA 4IH1A 4HRXA 5IVHA 1QTIA 5D3KA 4IO0A 1XRRA 5AO9A 5AI8A 5AOBA 5AKXA 3IB3A 3G9UA 4BCDA 3HZOA 2EEPA 3PUHA 2I3ZA 4U2EA 2QM0A 4OU5A 1XFDA 2GYVA 3F8SA 1XZAA 1CFJA 5CT8A 1QZ3A 1ZJ4A 1ZD5A 3G0DA 2WUDA 2RGUA 4NMWA 1EB8A 5T4BA 2AJ8A 5AI0A 4MXDA 4I4CA 1XLUA 3A2NA 2O7RA 4ETWA 2HU8A 5ALKA 4C01A 1YR2A 1SCKA 2G63A 3FWHA 1BCRA 4HAIA 1ZIYA 1XRLA 5AM3A 2WIJA 5HFAA 3BJRA 4LKOA 4Y2YA 1W1IA 3BF7A 1HBJA 3F9CA 4FLMA 4A23A 5LZ8A 1Q84A 5FXMA 2B4KA 5AM0A 5CT4A 4DNQA 5JAPA 4X92A 2XQGA 4MQLA 2JGEA 3BDIA 4B85A 2BFNA 2C7BA 3IURA 5AKIA 4Y9SA 1BE0A 3C87A 1GGVA 3H0CA 3HEAA 5K3BA 5AIBA 2WM2A 1ZJ5A 1W52X 5AM1A 3TGLA 4V2IA 2FJ0A 3WA7A 2BUBA 4QLAA 4W1PA 4EHBA 4W1SA 2ACKA 3KWFA 2WIGA 1JU3A 3CCBA 4ZXFA 3DYVA 2HA4A 2HIHA 4UHBA 1DX4A 3H04A 4H0CA 1CQWA 2XMBA 4P9NA 2X8BA 1HPLA 4H7KA 3W9BA 3BIWA 4XIIA 3WK8A 3DCNA 5JZSA 4X3CA 1VZ2A 3C6XA 5FV4A 4X00A 2WILA 3M3DA 5FDFA 3C8HA 2PSHA 3DL7A 1VKHA 4DMKA 2Y2VA 2QZPA 1WB4A 2Y1KA 4UBOA 2Z8ZA 5FPPA 4BB0A 1EDEA 2BGNA 1XZGA 1CEXA 2XUPA 3R3UA 2CBGA 1TQHA 3I1YA 2QMQA 3WWEA 4B82A 4BAZA 1Q0RA 4QZVA 4B9EA 2VA9A 3R40A 3D2BA 1LGYA 1T4MA 4N5HX 5DNUA 2HA3A 3PI6A 1IUNA 4Y2JA 2GBFA 2QS9A 2CKMA 2OQVA 3FVRA 4BRZA 2OCIA 2HM7A 1O6FA 1QFMA 1XQWA 2V98A 3D3NA 3BJMA 4W63A 3ZLTA 1EH5A 4U2BA 3AZQA 2XUDA 5AOCA 3VXKA 4PF1A 3WKEA 4AN0A 1VA5A 5IVDA 4C4ZA 3IUNA 3AINA 1ACLA 5K3FA 1UKBA 2OLEA 1XZMA 3C45A 4Q1VA 2WHQA 3W9UA 1JFRA 1NU8A 4HXEB 4DMHA 1GXSA 1GKLA 2HRRA 3OC0A 4AQDA 2WIKA 4CI9A 1CUSA 1HKHA 1J06A 1R3DA 2I3DA 2CUTA 1GZ7A 2H7XA 3ICWA 3DS8A 3GFFA 3LP5A 4CIAA 4BVKA 4BVJA 5ALSA 4X95A 3KDAA 3O95A 5HF9A 1E66A 5KREA 3DLTA 4YASA 1A8QA 2QXUA 2Z8XA 2XQKA 3UMJA 4F60A 1A88A 1XZFA 5EHQA 2PU7A 4KEAA 1UWCA 1VZ3A 3VKFA 5ALWA 2HHAA 1CUDA 3PICA 4YPVA 1BN6A 5IVKA 2XUQA 1DT5A 1CUVA 4OB6A 2CB9A 2BUCA 1SCIA 3IULA 4K5QA 3I2KA 4U2GA 4QDXA 3NWOA 2BJHA 3G02A 4UBNA 1HQDA 1Y7HA 1D07A 3LS2A 1ZGBA 1ETHA 2RI6A 1KEZA 5C81A 1QFSA 4L0CA 4D9JA 4GXNA 5AM2A 4U2CA 5AHXA 3MUNA 2XLCA 3ESBA 1JI3A 4C4XA 3HRHA 1JT2A 1LPBB 5HFNA 2XLBA 4AN1A 1GT6A 3WZLA 2ECFA 2PPLA 3WIOA 3QPAA 1MNQA 1CUIA 1DT3A 2VJBA 3WL8A 2O7VA 5CXUA 1X2EA 1AKNA 1DQYA 3RM3A 2GYWA 1N5RA 2DHDA 4B84A 1R9MA 5AKHA 2C0PA 4AO8A 1XZDA 2WJ6A 1XZJA 4DMCA 3RARA 3I2IA 1EVEA 1XQXA 2OAGA 2IITA 5FOQA 1OXMA 4GECA 2Y6VA 4KAFA 4DNFA 3G7NA 1CUEA 4J0HA 1IZ8A 5CH5A 1DWPA 3QH4A 4X85A 3C6ZA 3WJ1A 2VSQA 2QUAA 3H19A 1GQRA 1X2BA 2I78A 3QMMA 2H7YA 3D59A 2J4CA 1ISPA 2AXEA 3PE6A 3W05A 5AM5A 4G5XA 3QBJA 3I2HA 1UK8A 2WHRA 5DLPA 2GZRA 2AJBA 2PVSA 3FBWA 3I28A 1R88A 4X6XA 3C6YA 4G4IA 3A2MA 5ALNA 4UBMA 3H2KA 4DSZA 2GYUA 2UZ0A 1TAHA 3NOXA 2BUAA 1DWOA 4H7HA 3GELA 4U2DA 3PFBA 3AILA 1CV2A 5AOAA 5E2IA 2IX9A 1FJ2A 3WI7A 4BE4A 3FLEA 1AGYA 5FRDA 2WUGA 4CCWA 4FMPA 2OCKA 1FFAA 1LPNA 2J4FA 1VXOA 2XUKA 1ORVA 4UBIA 1LPPA 5J3JA 4KACA 4BP9A 4H7IA 2ZYHA 1XRPA 1BROA 2WG2A 3DOIA 1R9NA 1JMYA 4EY6A 3FSGD 1TRHA 2OAEA 5BV7A 3KOOA 3SX4A 1TKRA 2JGJA 5T4FA 4X6UA 1XKTA 2JGLA 5DYYA 3ZLVA 5FKJA 4BAGA 1E8DA 1THTA 4UPDA 1Z68A 2YYSA 2JGKA 3RKSA 1USWA 1R50A 1ZI9A 1R1DA 5ALFA 2JGIA 4RE6A 3IDAA 5AKEA 2XQFA 1CPYA 4WY5A 5AK4A 4FKBA 3EIOA 2XDWA 5JD4A 5JANA 1ODTC 5AK5A 1VXRA 4J7AA 1BN7A 1AX9A 2WFLB 1XRQA 3CXUA 1E8NA 2WSLA 4CCYA 3KXPA 4FNGA 1WHSA 4PSDA 5ALOA 4AO7A 1XKLA 4BBZA 1N5MA 3WK7A 3H1AA 4AMZA 4G4GA 1MN6A 4P92A 1RYYA 3G8YA 2YASA 4S0XA 4OYYA 5K3EA 5BOVA 3AIMA 5A71A 3H2HA 5EHXA 5EIHA 5ALEA 3O4HA 3DDUA 4U2FA 3D2CA 2ZYRA 1SOMA 3WKCA 4TVKA 4NVRA 4YX9A 4J03A 2DFPA 3F67A 3HI4A 4UHEA 1CUBA 1MX5A 4B0OA 2HFKA 3FVTA 5ALTA 3HABA 1QIEA 4LXIA 4X90A 4H18A 5K3AA 5JATA 1XZIA 1XLWA 2R11A 2B9VA 1ACJA 1IZ7A 1UOPA 4GLBA 1BEEA 2DQYA 5CRIA 1VLQA 1YA8A 4H7DA 2JBWA 3H18A 1BCSA 5EHZA 3HYSA 4XJVA 4N8DA 1AUOA 4E14A 4KJXA 4AX4A 3DQZA 1FFBA 4OSEA 2G5TA 3STTA 4INZA 3FOBA 5AH0A 4P08A 1LLFA 3F98A 1QONA 5F4ZA 5KBYA 1BU8A 5K3FB 4WJLA 5I9IA 5C8VA 2XMRA 3F96A 4WY8A 5ALVA 4LXGA 3X3HA 3QPCA 1OCEA 2RONA 1Q0ZA 4OD0A 2ZJFA 5LZ2A 2WTMA 2P8SA 2JGFA 2H9YA 5ALJA 1WPXA 2C58A 4GI1A 2X5XA 5FUMA 3WKAA 4ZGBA 3WA6A 5YASA 2HL6A 4BZWA 5KWIA 4UBKA 4X97A 1H2YA 2HA0A 3LIPA 4ARBA 4GBGA 2AJDA 1MO2A 4Y7DA 4UBJA 3AIOA 3PF9A 1QTRA 1UK7A 4J3JA 4J0GA 4HRYA 4GW3A 3ICVA 1C4XA 1W4LA 3H2JA 2QVBA 4A16A 3IUMA 2HFJA 3O9MA 1F8UA 2RAUA 3EQ7A 1JMKC 5JALA 2AJLI 4J0IA 3FLBA 1O6GA 4X71A 4Z49A 1P0MA 4UHHA 5T4EA 3GZJA 3FYUC 3H2GA 1E5TA 5AP9A 2OCLA 2CEKA 1YCDA 3QPDA 3C5WP 1OILA 1EINA 5A7GA 1K63A 2XMDA 4F5ZA 3STYA 3W2TA 2XUIA 1UOQA 1CUUA 3BF8A 3H2IA 3S8YA 3G0IA 2IIVA 1FSSA 4DSAA 3IUJA 2GBCA 4G1FA 5AJHA 1VE7A 5EHNA 1LBTA 4GHWA 1UK6A 1YB7A 5CH8A 7YASA 1GPNA 3A2LA 3G0GA 3TRDA 4FNMA 1IUOA 1KU6A 2OQIA 2XUOA 3QZUA 4H7FA 3WWDA 2WIFA 5A2GA 3KSRA 2VTVA 2HRQA 4DM7A 4DLNA 3IIIA 1SFRA 3JYHA 5HCUA 4I3FA 4C89A 2WG1A 3BWXA 3ZWQA 4BYMA 4QNNA 2HA7A 3G9TA 2FJPA 5CW2A 3L1IA 1WB5A 3DJYA 1HL7A 4MYSA 3MVEA 2DHCA 1F0NA 4CG2A 4AB1A 1C7JA 2WIDA 3FLAA 1S8OA 5FPQA 1MTZA 2XUFA 2ZJ7A 4IQ4A 1WM1A 2HU5A 5LP1A 1A8SA 2VAVA 4PQEA 5ALUA 3G9ZA 4ROTA 3CCCA 4HXFB 2XE4A 5EI5A 2G4LA 4LYDA 3G0BA 1P0PA 4DNPA 1YS2X 4WCVA 1VJ5A 5FP0A 1A8UA 1C7IA 4DIUA 1I6WA 3DNMA 1IMJA 5DNWA 4B83A 5HZGA 1QJ4A 4LYEA 5AKJA 4UFPA 2PUJA 4JEIA 1K8QA 1AURA 2VJCA 2WKWA 4MWSA 4WFIA 1ZI6A 3G0CA 4F21A 3K6KA 3R3WA 4RGYA 1XROA 4C4YA 3JW8A 5CBKA 2HADA 1RWQA 1BRTA 3WL7A 3V1LA 1CUAA 1YAHA 2VAXA 4H77A 4ZV7A 1Y37A 4E15A 1SCQA 4X93A 3C70A 2ZYSA 1K4YA 2K2QB 3V1MA 1XZCA 1L7QA 5DYTA 4PW0A 3E4DA 4N8SA 4Y2PA 3WJ2A 1GPKA 3R41A 2BGRA 1LPAB 2OGZA 4WDRA 2PUHA 4UBLA 1XZBA 2XI4A 3DL4A 1AC5A 4BTVA 5A6VA 5K5EA 3WL6A 4JYMA 1LZKA 1TCBA 3C5VA 4BVLA 5C7YA 4E11A 1CLEA 1CUZA 5ALGA 1EA5A 5KWJA 2RHWA 3PDCA 2CZQA 3E3AA 5HF5A 1ODSA 2X76A 3I1IA 2WFMA 5IH7A 3WK5A 2YH2A 4RNCA 2VEOA 4BATA 3O4IA 1DX6A 6YASA 1W6RA 4EZIA 4EY7A 4JUIA 1CRLA 4HXGA 5D7BA 2QR5A 1AMNA 1ZD4A 2ZSIA 1N8SA 4P93A 2CMFA 4ZI5A 1QLWA 1W76A 1PFQA 3RLIA 5ALQA 3WWCA 2ROQA 2XMQA 3DKKA 4C87A 1RP1A 1WPRA 4FFWA 3M81A 2PL5A 3FSGA 5JAUA 2OCGA 4G9GA 3KWJA 2DSNA 3EF3A 3AFIA 5I7UA 3N0TA 3STWA 4Y2UA 2QT9A 1K5PA 5DTIA 4EA6A 2XUJA 3OURA 1YSCA 1JJIA 3IVMA 4BRSA 1H22A 1WHTA 1H2ZA 5A7FA 1E3QA 4DGQA 4AXBA 4Q34A 4B7ZA 2VJDA 1MT3A 5SYNA 4MYDA 1MJ5A 3N2ZB 5AKLA 1P0IA 2OXEA 3R3XA 4FOLA 5AI4A 1AZWA 3WLAA 3WZMA 2Z5GA 1ORWA 1CUGA 1QGED 3HXKA 4GWLA 2JF0A 4HVTA 1G4HA 2QKYA 1YA4A 2XQIA 4TGLA 3I6ZA 2PSDA 4X6YA 4BTLA 5BWBA 5D3ZA 5EIAA 3AJAA 4HTAA 3R0VA 2WTNA 1AQLA 5HF8A 2O2GA 1NX9A 4CIBA 1B41A 1XQVA 1LPOA 2WG0A 1ZICA 1EDBA 1MU0A 4WFKA 1H2WA 4B9AA 4W9RA 3HC7A 3R3YA 1VOTA 4UHFA 4UFNA 4W1QA 4ZREA 3FYTA 2W22A 4QWWA 4Q3OA 4H7EA 4X7BA 5CT9A 3L1JA 1ZD2P 5CT6A 1E8MA 2C4HA 4BC1A 5JASA 2HDWA 4Y2TA 2VATA 2VT6A 5K3CA 3QM1A 1QO7A 4G8DA 1QIDA 4KAJA 1XZHA 4Y2QA 5ALLA 3V48A 3NUZA 3QITA 1T2NA 4DTCA 3AIKA 2C0QA 4ITVA 2DHEA 4G4JA 3AZOA 5CH3A 2HA5A 3PF8A 4XX1A 2EDCA 4AZ0A 3WK4A 3D0KA 4J0KA 1UFOA 1CUJA 4J0CA 1YB6A 2V96A 4WFJA 4XWGA 5HK8A 1NU6A 3GBSA 4Y2SA 4K6GA 3O4JA 4ARAA 5AI9A 1N1MA 4BC0A 1CUFA 4KAAA 3Q0TA 2ORYA 1JU4A 1MAHA 1XZKA 4H7JA 3SWWA 3DKRA 2O2IA 2VJAA 4QDZA 5ALRA 5C8ZA 5LZ5A 5EFZA 3UUFA 1JJBA 4ZV9A 1GPLA 4Q82A 1TCAA 4M0MA 1F0PA 3AUKA 5JAHA 1E89A 5CTAA 1U2EA 3B5EA 5HQ3A 3WQHA 3CN9A 3R3VA 1G5FA 3BIXA 4AZ3A 4CCYB 1CVLA 1LPSA 4DYHA 5AKZA 1EK2A 2WU3A 4I19A 4J0JA 1M33A 2AJCA 2OGSA 3BXPA 2GBGA 3B12A 4QEKA 4EUSA 1UOOA 4LXHA 4G8CA 4QE3A 2D5LA 1P0QA 3C43A 5ESRA 5LKAA 2WJ4A 4L72A 2C5GA 3STXA 1CIJA 2QXTA 4B80A 4C6HA 2DR0A 5AKGA 1QIKA 4HS9A 3QVMA 3BE8A 2Q0XA 1TCCA 1TK3A 4AMYA 1JKMA 2PBLA 4IHAA 2PKYX 3U0VA 4O08A 2RHTA 4L3WA 3ZV7A 1B6GA 3KD2A 5FLKA 4ZWNA 4MQMA 3VDXA 1J2EA 4Y2VA 2LIPA 2XB6A 3OOSA 4UFOA 4N8EA 1QE3A 5AKYA 3K2IA 5D6OA 4CFSA 2VT7A 4FWBA 1ODCA 4OUKX 3QYJA 3O0DA 2OGTA 1FFDA 1WOMA 2WHPB 3D4LA 1LPMA 1EX9A 4HZGA 5ALMA 2XMZA 3S2ZA 1G42A 1QIFA 1HDEA 1K6EA 4X91A 4IH4A 2WQZA 5EIEA 5JD5A 3VVMA 2O2HA 3M83A 3PUIA 1VA4A 4EY5A 1MPXA 1WCYA 3JWEA 4M0EA 4DMFA 5HKBA 3WYNA 1UZAA 4J0DA 4YK7A 3STVA 4IH9A 3FNBA 1VE6A 5IVIA 4KE7A 1ZI8A 3V1KA 5ALYA 3WWPA 4M0FA 4XVCA 3PFCA 4DNOA 3MGAA 3EBLA 1L7AA 4H35A 5AKKA 1A7UA 5CT5A 4K2AA 1YS1X 4RE5A 1L7RA 3M82A 4B81A 4Q05A 5AK6A 2ZJ6A 1EHYA 2WLSA 4EB0A 3ZI7A 1CUCA 5LKRA 5IKXA 1U8EA 1UKCA 5JZ9A 2ES4A 1MX9A 2OG1A 5JIBA 1YASA 3V1NA 4BAUA 4F0JA 5ALXA 5SYMA 4G9EA 1QIJA 4LHEA 2WU4A 3QMWA 1QIIA 4QA9A 3VISA 4PNZA 3EQ9A 3WWOA 4GEGA 5HF6A 4Q3LA 4EY8A 3GA7A 1YAJA 3IUQA 1ZOIA 3H1BA 1X70A 2V9ZA 4CG3A 4FBLA
chains in the Genus database with same CATH superfamily
2O59A 1KVSA 2DUMA 4ZO4A 1G9TA 3NC4A 1E0KA 4H31A 3OQVA 3I61A 4GZ6A 1JQJC 3EXEB 2YIVX 3N1UA 1OWNA 4CL2A 3PGLA 3Q85A 3V8PA 3G8AA 2PD3A 3WGNA 2H3EA 5BRJA 3N6RA 2AQIA 1M75A 2AC4A 4PO3X 3Q7PA 1MIOA 1TTPB 3CMCO 2JLAA 1JEYA 2G04A 4GOND 1SCUA 1WW8A 5KQLA 4NZYA 2AFIA 1C0KA 1NI5A 4YMGA 1TJYA 4R98A 1K6IA 4PANA 4US1R 1G8PA 2WA1A 2CL5A 2OKGA 3BJEA 2W6CX 3OCYA 3DG9A 3DDWA 1IMOA 2NZJA 3AHGA 3HB9A 2OHJA 4Q4JB 1ZPDA 3S5JA 3A4MA 2BSAA 2WD9A 2O50A 3DZKA 1RIFA 3IBCA 4GNRA 5E3IA 4YV1A 3B1XA 4MEBA 1E2MA 1THZA 4OYLA 4GQAA 3MAJA 1XZEA 1FTNA 1OTYA 4OXNA 4QPNA 4CV2A 3ZHSA 5CURA 2E4VA 3UT6A 1BVRA 4EG5A 1XZNA 4CL3A 3DOFA 1W0KD 5F7OA 1W4AA 3NRBA 4LZZA 1O95C 5IAEA 3I58A 5H70A 3STUA 4NBNA 4ATNA 1IB6A 3E5RA 1EVLA 4EG7A 5J2UA 1ZD3A 4QRHA 2JEZA 3QFHA 4AO6A 5H4HA 2F64A 1NF3A 1SGWA 1D6NA 1PV2A 5LYJA 3VU9A 4ZYLA 1V1JA 1UM8A 2RBGA 3L1KA 4MWGA 2WWVD 4BX8A 1R0YA 2Z3WA 3NTRA 4GS5A 2QN9A 2CBZA 5HUJA 1CNFA 2V58A 4L8FA 1DAFA 1EFRD 5AFSA 2YFYA 4JH0A 2CXTA 4EUFA 4DZTA 3WRXA 4FSHA 4W9NC 2ZFUA 3WLOA 4INOA 2W2VA 3RSOA 4O63O 1C0PA 1GU7A 1RQ2A 1ILEA 4WD3A 1C0IA 2X5OA 4B76A 3DLAA 3PC7A 4UD6A 4B3FX 2W5UA 5FBVB 4HLNA 1NUHA 1P4GA 3DE7X 3OO0A 3RT1A 3JXEA 3ND5A 1AKRA 3DQPA 4HWKA 4UVIA 5ER6A 5THQA 1B3BA 1NL3A 1NG1A 1NFQA 4EIWA 1NNEA 1P91A 2D7JA 2FP3A 1R4ZA 3FHOA 4DCTA 2YIDA 4PEVA 2R00C 3R3HA 2JLQA 4KE9A 2VRCA 4I2VA 5FT9A 5B6IA 4ND1A 4OCZA 2IQIA 1NSFA 3EF1A 4LJLA 4BP8A 1CUYA 3OP1A 1D04A 4B6SA 4UAGA 2KBEA 4AZSA 2G06A 2B4QA 1XD2B 2C2YA 2CNWD 2JBHA 3TZHA 5C5CA 5C51B 1ZGCA 4A91A 3ISTA 1U3GA 1U28A 4ENSA 3D2AA 1ORDA 2PJZA 4LMBA 4M60A 1PP4A 3GFPA 3CWZA 1WABA 1HZZA 3A1WA 1YR3A 4YJ3A 2P5YA 2HDHA 1RLJA 2NUPA 1X9IA 4E4TA 3H9CA 4PX3A 3RVSA 1SBIA 2W4IA 4NENB 4F3NA 3SI7A 1TIBA 3PPVA 5JARA 3R3ZA 5JADA 3RF6A 3BWYA 2B3DA 4YCSA 2Q4OA 3PQFA 2YCLA 1X1QA 5KTRA 1PJRA 5CLQA 3WX0A 4RPLA 3IV7A 3V2UA 2JFQA 4AKGA 1JDBC 2QJTA 5JAOA 2A58A 2SCUB 4PSAA 1FMJA 1SCUB 4M55A 2WJ3A 3FE2A 4FYXA 4KG7A 1ZMTA 2BSXA 4N54A 3U17A 5FUQA 5KMGA 4NXMB 2EDAA 4WK6A 1FUYB 1SBHA 1HRKA 4W5RA 2ZXUA 1U8ZA 3L8EA 2R1ZA 4BKMA 1QRAA 1QM5A 1V41E 1L7OA 5E6SB 3W3AD 1CC1S 3GG9A 3HWRA 3OPMA 3FZNA 4JCCA 3H5AA 4OSPA 3UF0A 1ZM2A 1KK3A 3CLKA 1XMJA 2PO5A 2XADA 4RULA 3EGXA 1KMIY 5AJYA 4B3HA 4RLQA 4DRZA 5JCPA 2B25A 2V97A 3I9V1 4GEKA 4GOMD 2KW5A 4OHOA 4RHFA 3ZE1B 4DDHA 2I2DA 1DCMA 2P0YA 3DOHA 5IJ0A 5DFAA 5EKXA 2ZE8A 2C00A 3PJDA 3VYTB 1G98A 1Y7LA 3ROZA 1PEYA 3M6MD 4MQFA 2D8AA 5AXCA 2H2DA 1YFKA 4RLFA 2HA6A 2AF3C 3DTYA 2JFFA 3NRJA 3K0HA 3DZBA 2VPTA 3TLXA 4R9VA 2I87A 2PMFA 2UVPB 5FWYB 4PC7A 3TRFA 4G67A 3CNNA 2MINA 1DO0A 4KH0A 4OQNA 4TPKA 4BNFA 2FW8A 1P29A 3Q1LA 5L4SA 4KO2S 2XIJA 1SOVA 3D1VA 4LZWA 2PUDA 3LC1O 1Z17A 1IN8A 1IBLB 3WLMA 4E08A 2QVCA 4OQXA 2O20A 2HXYA 4GDMA 3GRVA 1LH0A 1CS0A 1E3MA 1ZU5A 3IA2A 4W99A 2VVTA 3QXSA 4QHSA 2O4CA 1UMCA 1XLTA 2XT0A 3OO1A 3QHPA 4OBXA 4QDTA 3AY0A 1FDVA 4UHCA 5T4HA 1RR6A 3HYLA 3KQOA 4OHKA 3BCUA 1YBHA 2H1IA 5HHTA 3A1FA 3ACBA 3B3QA 2L17A 4RFLA 1P9OA 5AVQA 3D7LA 1O4WA 1GQQA 2HHLA 3BL5A 3L46A 2IYFA 3SG0A 4JBNA 2YN4A 4ABTA 2WT9A 4UW9A 2EP5A 1SAYA 2REXB 1ID1A 3BSWA 2IXBA 1QB7A 2F8MA 3LCRA 3AW8A 1DIOB 1YQWA 3OZGA 3UMSA 2AGVA 1PV1A 1Z4LA 1FFCA 5K3SA 1IQUA 4D7AA 2JHFA 1DKRA 4A0SA 3K70C 1BEZA 3COSA 1NULA 2FRDA 4DJEC 5DTJA 2Y1XA 1ESNA 3EGEA 4UU8A 1PQYA 1LBSA 1PFUA 1TEHA 2H4YA 3NBAA 4RZHA 5IN4A 5LMNB 1QVZA 1SURA 4P32A 5DNYB 1N0VC 2XYVA 3ODPA 2HK6A 2QD5A 2GZSA 5KVQA 1JALA 1TEXA 4FHZA 5B2FA 4HOYA 4E12A 1X7DA 5AW2A 1TUEA 1V1RA 1EESA 1VTKA 1PX2A 3JQGB 3GEEA 2H1FA 2FZ4A 1V6CA 3ZWNA 1NLMA 3BM5A 2ZUSA 3KYDB 4WZ6A 3SHFA 1XK7A 1WUJS 2QORA 5JT1A 4RF3A 3I42A 4OH1A 5A9SA 2PBZA 4TWBA 5CDTA 5KTYA 2ODWA 1NPTO 4O0MA 4AJEA 5C8XA 3ONDA 1MAAA 2RK6A 3QMVA 1BXKA 3H7AA 4E5YA 2MMGA 4IXMA 4G07A 1GFSA 2JHCA 1E1YA 3OVMA 4B1FA 1K7SN 4E1AA 1LDGA 3VHQA 1PQPA 4Q4DA 5FWAA 3FAKA 4ADSG 3LTNC 1EIWA 3C24A 4OHPA 5LLSA 3BORA 2ST1A 1QRRA 2WAOA 4FKZA 3U3JA 3KB1A 5DHTA 4EHDA 1C9MA 3ME5A 1DHRA 1ZXLA 4HBGA 1W5TA 2Z5FA 4BEVA 3JPWA 3BDAA 1UDBA 3C1OA 2COUA 2JFZA 2J48A 3HDVA 4G1UC 4BMOB 1PZMA 3F2VA 4Q00A 2W43A 5D2CA 3RTEA 3V7WA 4RHCA 4CM9D 2GFQA 2E7ZA 3TWOA 4KE6A 3PHBE 5FBHA 1QWSA 2I6QA 3RBVA 3TEFA 4DWWA 2YVAA 1DEOA 1H2HA 4YJHA 2J9ZB 4DC9A 2ZUVA 3VTAA 2CNBA 4KW7A 1OU4A 3AFHA 4V03A 4F9EA 4NXNB 1R8XA 3OE7A 2BEJA 2B61A 1BE1A 4GRAA 5GQSA 3REQA 4ENUA 4IFTA 2AXPA 3C74A 4ZCQA 2CWDA 2FKNA 2J3DA 4ENRA 1YH3A 2J3IA 5AI5A 2W58A 1OD6A 3VPHA 3VVLA 4B31A 2PSFA 1JJ7A 1JQAA 5ECGC 3TFWA 2ZSHA 5DCLA 3WRWA 1G64A 1E9CA 1AOXA 3H7IA 5MGBA 4RLHA 4IZHA 5JS7A 3RS0A 2HMUA 3GVIA 3H4IA 4OMUA 4KQGA 5LIPA 4XCVA 3UPUA 2EW2A 1GYPA 2HMAA 3OJFA 2QZJA 1VMKA 3K1AA 4M9RA 1GAEO 5EERA 2C5AA 2QAGA 3IELA 1Z16A 3PEFA 1W49A 1JNXX 4AL4A 2VQ3A 3TKLA 5CGQB 4EKGA 1I4TD 1R6AA 3A70A 3G85A 3HRKA 3SSMA 4C0HA 5BWCA 2NT3A 3RD5A 5LP6B 4ARCA 4K6HA 3K92A 3WWZA 1OC2A 1SXJA 1TJPB 3ZV4A 1GCGA 1UP6A 2VDRB 3JQFA 3NS7A 4MCIA 1XK6A 4KPUB 2C07A 4UULA 4R2JA 1NHWA 1XU9A 4DR5B 1Y7IA 3FOCA 2OXTA 1ZH2A 2O06A 3OG9A 1GNSA 2WUFA 3B2EA 2NN3C 3DZHA 4QRDA 3GGGA 1NF8A 1R66A 2DRIA 3MWDB 5F7JA 2R6CA 3ESAA 2GCIA 2QZ9A 1JYFA 5D1HA 2V8BA 3Q88A 2FP4A 1AO3A 3MQFA 4IMRA 4OYHA 1SHKA 4A8HA 5E6UA 2OPHA 4KYVA 4CQLA 4P0QB 4IDEA 2ZSJA 1RBMA 1Z45A 1JLMA 3PD1A 3BK2A 3Q6MA 3KJEA 2XXAA 3T5GA 4FMCB 4GOLD 1WNFA 1OYVA 3PJGA 3W79A 4O1MA 3U4GA 4D8TA 3FUTA 5IJXA 3THRA 2C95A 4RC9A 1J9GA 1GRCA 5TF0A 5F9HA 1FUUA 5EZYB 3NKFA 1ISMA 4B0PA 2Q6TA 5HIIA 4PSUA 5FADA 3H75A 1KQOA 5CLLA 2QJWA 1AY0A 1P4SA 2OOKA 2Z9DA 4QFMA 3X44A 4JJEA 4N7RA 1XRNA 5K2MA 4EG4A 5CFLA 4NFHA 1XDZA 3M6XA 3ABSB 3DMGA 2WWFA 4D9GA 4HDCA 4KXYA 3SBDA 3CPHA 1M2VB 3QWIA 2CXXA 4H4DA 3GLGB 4PAMA 3TCXB 2D74A 5ALHA 3QVJA 1VPWA 3DKPA 3JQAD 1MZPA 4BNGA 4C0AC 1FY2A 3T1NA 3T3GA 1DFIA 3AM4A 1K9SA 3R4CA 5AHKA 4UUQA 4HDNA 4A03A 3IBTA 3F4BA 3QHQA 2OV1A 4NYIR 5DIFA 3T1QA 4UC0A 4KIWA 4YRLA 2YJGA 3A6DA 3KR0A 3BMCA 5HSGA 2C31A 3KP1A 3RUDA 2XGOA 3WGMA 3D6FA 4X0EA 4CM1A 5J2TB 5KYWA 4ZRDA 2EGHA 1MB3A 2YZ7A 2W11A 1WZCA 3ITEA 2DY0A 1E3LA 2B20A 3KKZA 1KA9H 4FQ7A 5KVSA 1VIAA 4FJ0A 1HGXA 2GNAA 3DKVA 1J8VA 1WHTB 3T4XA 3R7DA 4HEA1 4LWPA 1CUXA 4N41A 4NU0A 2FMHA 1AV6A 4C88A 1L6IA 3CB4A 3P27A 2WOOA 4EJ2A 2Y68A 3CFYA 4MW6A 3IAEA 2W6QA 2ZREA 3WBFA 4FCWA 5BT8A 5I7RA 1DBRA 4QDOA 7MDHA 1NMQA 5DXAA 4YRRA 3WIUA 4WX2B 5B55A 2HX1A 4IOKA 2XYHA 4U0JA 5DYWA 3GMTA 4JYZA 2HF2A 2FI1A 3OKCA 3L0SA 4XA8A 2HZ7A 1C9KA 1PV4A 5LUBA 4NZZA 3WL5A 1N6HA 2FB9A 1G66A 2NSYA 4NFYA 4UHDA 3CH7A 3GGJA 2HLDA 2A92A 3OUUA 5I4CA 1RBYA 2G80A 2WICA 3D4BA 2X7XA 3L49A 3A8TA 4HYEA 4JA2A 4JHLA 4R8RA 4KFTA 4DV4B 4FYJA 1EFVA 1E9RA 1TT5A 1AKWA 4M38A 4MGEA 5F1OA 4DQLA 1KTIA 4ZAVA 3R9KA 1OC4A 1N33B 2V5AA 2A1IA 3V46A 1DZIA 3L05A 4IGEA 2PT5A 5IVHA 1QTIA 5AXAA 1YKGA 1A77A 4Z9XA 4OJMX 3VR6A 2AN4A 5HTOA 2D1SA 1J1UA 4YJFB 4DNXA 2QXYA 5AO9A 4D9FA 3J7TA 1L5SA 3IQZA 3O75A 3ZQKA 2J8ZA 2RI0A 3FOWA 1DAEA 1HLDA 4R1NA 4BGIA 4RTMA 2FUNB 1O5OA 4OHMA 1HORA 2ZUDA 3SIRA 5LYJF 3I9V6 5TB5A 3EZLA 3C15C 2BJWA 3L4SO 4HDNB 5AKXA 5SZIA 1PZEA 1LWOA 3QP9A 2DWPA 3E9DA 821PA 1J97A 4Z9YA 4QIHA 1T8TA 1EGAA 4RD0A 1JSXA 2BF4A 3MQ2A 1GITA 4G89A 1D7AA 4GOXA 5FO1A 4BO2A 4WN9B 3U7JA 2WJZB 3JWJA 4DTIA 4Q18A 3RVBA 3GJRA 3VNRA 3UATA 5LQUA 1U1DA 1PF7E 1GDHA 1XFDA 2PMBA 3I9FA 4KSBA 3FRJA 1AJEA 3TDMA 5FL7D 3L1UA 3AUSA 2IHZA 1VFPA 3WQSB 1ZJ4A 3G0DA 1IOZA 3UCFA 3G2MA 5LCXA 2RGUA 2BGLA 4HY3A 2A9OA 1QYCA 2LXNA 4GPZA 4M8NE 2E89A 3B3AA 3NIFB 4O4HB 4GSLA 1VHWA 3DMFA 5IT0A 3L01A 1GVHA 2ECPA 2X0DA 4KRFA 3MS7A 1Y9DA 4LYJA 4Q48A 2AJ8A 4XYEA 1JX6A 2HUPA 3KSMA 2OHXA 5AJTA 1E7SA 1E3IA 4Q7EA 3WYGA 1YZ3A 4N0EA 2MTBA 3ZCPA 4MXDA 4F4FA 4Z1OA 2JFOA 6PFKA 3A2NA 3JPYA 3N7UA 2V7GA 3K0CC 3WSWA 4I55F 4MZXA 1SCKA 4LE2A 1WSBA 4TL8A 3MWDA 4D8XA 4ZJUA 3QE3A 3T0IA 4EECA 3C2QA 3IUYA 3I45A 4BQPA 3MTQA 1P4JA 2P6MA 1SD5A 1U1FA 2QTNA 4HFRA 3OPNA 2CLOB 1L5LA 3ZVKA 5AM3A 3SN6A 1UKVY 3CE9A 3P9NA 2NXEA 2EKZA 2J9YB 2SKEA 1E77A 3A6FA 3HCRA 1L9XA 3C4JA 3OJWA 4IHJA 4R1OA 4HRAA 3MG9A 4ON9A 3JD2A 4B7CA 4F9FA 5CP8A 2XZPA 3THOA 4L50A 1U11A 1KDZA 2XGMA 3BF7A 1HBJA 4IUCS 3K0BA 5HGXA 4LGYA 3T9CA 1N2JA 5CX4A 3ELYA 2JJ2A 4OLFA 1RHKA 5IT9A 4Q1FA 3WRVA 3H4VA 2B1QA 4DQUA 1QU2A 4J1NA 3AU9A 4AULA 1Q84A 4D56A 1B8PA 1MTOA 4PSKA 1SBQA 1MOPA 2WTUA 1CNMA 3S8MA 1MJFA 3EIQA 2UZ1A 4LNAA 3ZK9A 3AJ9A 3UGQA 4JYCA 1NNLA 3QVGA 4N5LA 4CTOA 1JFFA 1KI8A 3VPDA 5JAPA 3LHIA 4WERA 4Q1BA 3JWIA 4BLUA 4Q93A 5FBWB 3A04A 1ONNA 3OEHD 3C7KA 1KHHA 1S02A 4ND3A 2O2DA 2ZB7A 4BO6A 1G16A 1E6UA 2E5FA 3H0CA 1QHYA 4KQFA 4MVJE 5K3BA 1FRVA 5EE0A 3H6KA 1GRRA 3B1KA 3F5MA 1QC5A 4CV0A 4XWOA 2Q5QA 3F1LA 5L40A 1TTTA 2O54A 4RHUA 3V2GA 4WXEA 1KMHB 3QOYA 3BGIA 3TGLA 1NIJA 1W85B 1Y5LA 1JTEA 2JCYA 4V2IA 4WKNA 4EW1A 5TGTA 2P3QA 4Q9AA 4PQGA 4NEGA 2JGRA 2FEXA 3IEKA 3FN4A 4J2HA 3QYAA 4W1PA 1TX4B 1L4UA 3G13A 4OLBA 1PQ4A 3ZBQA 4BLVA 2L42A 1G6KA 1G20B 2ACKA 4ZT7A 1J33A 2ZZMA 1DC3A 3INRA 5IFLA 4O4JA 1EP1B 1FX0B 3LY7A 4GYJA 4OGLA 4WKBA 4Q1DA 3PUZA 4ER5A 4FU0A 1TCUA 1DX4A 4WZBA 3PFKA 1XI2A 1WD5A 1CQWA 3FTPA 2NSHA 1FDIA 3C1UA 3NI2A 4G25A 4TTAA 4TT3A 4P9NA 2V8OA 5G4KB 3BSYA 4BRUA 1R0SA 3NBYC 1NI4A 3KYCA 3QU4A 4FMBB 4A6DA 1R6VA 1DIBA 3MTIA 1AN9A 2P9ZA 1VZ2A 1LRKA 3C6XA 4B3MB 4M9QA 5FV4A 3Q6IA 1P6UA 2H1LA 2GBLC 2GUGA 2B1JA 1FBTA 1A0OA 1O94A 2XVZA 1KZ9A 2Y05A 2Y4OA 2J7PD 2JK0A 2W98A 1BWSA 1IHXA 2PSHA 3DB1A 3GJZA 1WZNA 3L79A 1WE2A 2HSDA 1SOAA 3DL7A 4MW1A 5K0GA 2P6NA 2Q5LA 2W42A 3CUEF 4DL9A 4ZD6A 3B20A 2ZI7A 5B1YA 2V74B 3JQRA 5FJJA 2N0SA 3MT8A 1NZDA 2Y1KA 3W3AH 2ZYWX 3B9QA 1CDEA 1M74A 2PQ6A 5FPPA 3I0MA 2Q5OA 3QYPA 1E4EB 1EDEA 4NCKA 3WGYA 2WVGA 4Y1GA 2WHEA 2QTRA 3LT2A 5EE9A 5JRJA 3A9WA 3RU9A 2XWJI 1UFRA 2HPVA 1PZHA 3LPNA 4B82A 4BAZA 4RAQA 4OGGA 4MAFA 3N2GA 1M1XB 1NJ2A 4Z0PA 5FWDA 1EJBA 2AZMA 2QN2A 3KSZO 1YDGA 3MMZA 4KOEC 1ZMXA 3TTTA 5IBQA 4P36A 4KXWA 1HYEA 3CS3A 4N5HX 3V5NA 1QGAA 3GRRA 2XYGA 1QDLB 1IZYA 3BGSA 3RV3A 2IZZA 2OBNA 2D7CA 4PZDA 2GF2A 2J9FA 4IJQA 4X61A 1IUNA 4GMKA 4RK7A 1JR6A 2Y3IA 2WE7A 4AJHA 4RVDA 4INAA 1D9XA 1N2BA 2CKMA 1XVAA 1B2RA 1XAGA 1QE0A 1Z8FA 3ZBPA 1ULHA 4BRZA 1OIXA 1P75A 3H8WA 2DT8A 1P74A 1O6FA 5G0SA 2PV0A 3RRMA 1ZSVA 2IGTA 2V45A 4R1QA 4ZI7A 4OMDA 3BJMA 2PKRA 2WWTA 3NHYA 4BJHB 5E9WA 2GDJA 1EUYA 1BMDA 3C8ZA 5B37A 3AF1A 3VDQA 4JQOA 2XVXA 4D9KA 1G3QA 4MVXA 3TIVA 4DJJA 4EMTA 2IDMA 5FWYA 3RRYA 1E6EA 3U3XA 5AOCA 2UXCB 4URYR 5D5PA 1HOTA 5CJJA 3WKEA 1TVMA 3G5LA 1WF6A 2B4RO 2QMHA 1VA5A 5M7EA 3GVPA 1LJLA 3G79A 3ZE2B 2HWKA 2PANA 2XVYA 2V3CC 1ACLA 3U7QB 3ACDA 4NJOA 3MD0A 4O2AF 3RRNA 1ENYA 3UK2A 2WHQA 4GI3A 3KHTA 4OF4A 3S7ZA 2MSWA 4U7TB 1E6KA 3MT0A 1BX1A 5HE8A 5REQA 1Z6PA 1QH0A 1V35A 2QENA 3DPIA 1RQGA 3JYQA 4NIMA 4XJTA 4CT5A 4NYJQ 5C8YA 4DMHA 3TTSA 1GXSA 3CC8A 1GKLA 2G7ZA 2JFNA 1USIA 4JOBA 1FDWA 1MH9A 2GO1A 1JG2A 1EWKA 1CJBA 2A9QA 3PQ2A 5BSEA 2QTFA 3AHDA 3F3SA 5H7XA 4V1CA 3GNLA 4PGGA 4AQDA 2R65A 4JL5A 3RGWS 2QRHA 2SCUA 3DE6X 4TKUA 4NQZA 4EHHA 3R9IA 5ESWA 1CUSA 3VHRA 4XSVA 4AU1A 1G17A 1KBZA 3JAWA 1WVGA 2RGEA 4LYAA 5JCZA 1AUVA 4XQGA 3ADBA 1J06A 1R3DA 1YBFA 3NOOA 4JA0A 5IJZA 2JVIA 3M1AA 4I5IA 4MV7A 2OXRA 4F12A 1FFYA 1GAQA 4V0SA 2RD2A 2I0FA 4QBHA 3LKVA 3OZDA 2W0MA 4DF3A 1I3OA 3GFFA 4E2FA 3FTQA 4BVKA 3UMVA 1SVUA 4YJ3B 1IG0A 2C97A 3JAWB 4BWVA 3GFQA 3HXQA 4HV4A 4DEYA 2ANBA 4KXXA 2FEPA 2GPAA 1VLVA 3H9UA 3KQKA 2BM0A 1N75A 1K66A 4G81A 2N1MA 1A8QA 3I73A 2HRCA 2A0KA 3CNQS 4MP6A 4CMEC 3SHTA 4W5OA 2AG6A 2XQKA 2H9AA 1CQPA 2MYTA 3NFRA 3UMJA 3ZZMA 5I7SA 5JR3A 1L8LA 1FOEB 3TSZA 2FU5C 2ZTVA 4R2XA 2JGDB 1P3Y1 4TSFA 3DL2A 1SCJA 4N40A 5EJFA 4ERXA 3PVCA 4JVMA 3HN2A 5I9LA 4HQFA 5KSYA 1GPMA 4OP3A 1JTFA 1CUDA 2HXGA 4CLRB 3MERA 3L1VA 5FQNA 2BEVB 4YPVA 2EJBA 3KHSA 5TC4A 1NYQA 3ELUA 4DR6B 2RBEA 1BN6A 1JILA 3QOWA 3NETA 1Z5WA 5IXYA 3NJ4A 3TM5A 3ED5A 4LBZA 1O0SA 3PUWA 4IRXA 4OB6A 1FVOA 5FFNA 5GMOA 3OCWA 3AO0B 1SCIA 2WMDA 2A1UA 1SHLA 3L4JA 2VSXA 3R6GA 3EAQA 1PK7A 3EMBA 4Y67A 3COJA 5FIUA 3BRWD 3IQIX 4XFJA 1DAPA 3O5AA 4IV5A 3WYAA 3FVWA 3PL5A 3RAFC 3PXEA 4TSKA 4YMWA 4GE0A 4ILKA 4ERNA 1BYUA 4B7UA 1HQDA 1Y7HA 2W2NA 3OZBA 4RHEA 3TNYA 4F92B 1GZ4A 2DWCA 2C5HA 2G72A 1Q2UA 3AONB 1F2TA 5I48A 5D86A 1GCOA 4FZ5A 3OAAA 5IK2A 1DVRA 4P38A 4PAQA 4RABA 2AE1A 4ZN6A 5BQXA 1KEEA 3FCUB 2VKQA 1P44A 3GLQA 4B6JA 1IBRA 1TYCA 2NTYC 4GXNA 3T7CA 3VBCA 4A2PA 1WY5A 5P21A 3VNUA 2JC3A 2BDTA 2RFLA 4JHXA 4KGXA 3EWAA 4NESA 4ZO7A 2ZUUA 4B4UA 2X2EA 3PNQA 4EPYA 1OBVA 4GZMA 5F9MA 2CXUA 1J0EA 1QX4A 1M5UA 3V2IA 5FR2A 3BWBA 3ZE9A 1R6TA 3MGCA 5TS3A 2AQKA 2H4WA 3ESBA 1JI3A 3T6KA 4REOA 3DVSX 3ZGNA 1IJEA 4BFWA 3H3XA 4QXRA 1OKKD 4JFRA 2HD4A 1QVAA 3ISVA 4KZKA 3O83A 1H5UA 4MI6A 1Z33A 4B6PA 1KFEB 3HUTA 1RHQA 1A27A 1N6PA 1TJ3A 2PPLA 5IP5A 3TQRA 1KY2A 1CUIA 5DI3B 4A0QA 3G88A 1UM9A 3ZY2A 3AKZA 2O7VA 1UDRA 5CXUA 3GLIE 3WGLA 4ZVMA 3WAKA 2IX3A 4FB5A 1CLUA 1DQYA 1OBCA 4L85A 3RM3A 5IZ4A 3FOEC 3WGQA 3QLUA 1N2XA 1G8KA 2GXQA 1DIGA 2DHDA 2ZYTX 3H4MA 3A7DA 1JIKA 3SMVA 4JBHA 3TD2A 4ICIA 1I33A 3UGJA 1OH5A 2DULA 3FI0A 3X2SA 3FCOA 1XZDA 2KWIA 2WJ6A 3C98A 4YXWA 3VSAA 2I6SA 6REQB 1XQXA 1CJVC 4GXTA 2ODPA 3GEDA 4LC1A 4KVFA 4ZIRA 4GC5A 1MC5A 5ENVA 3Q4GA 4Y0VA 4ZQCB 4MJ7A 3LT1A 3DXXA 3TBFA 2GZMA 5B58T 1FLNA 1GA4A 1MOZA 1Y9JA 2DFKB 2Y66A 3HUFA 3OZTA 3NTQA 2H65A 4Y6QA 3D3KA 1VJ0A 4BN4A 1MV8A 4DNFA 3AU8A 5FI1B 4X5OA 4RK5A 1JG6A 3IAS6 1I30A 4EYSA 3GO4A 3LUHA 1JPVA 4HCJA 4M49A 5CH5A 3TL3A 1VPLA 2H1VA 3GQBA 1UT8A 1IH8A 2NGRA 1CQXA 2Y9PB 3PDJA 2WE8A 3RFTA 3WJ1A 5IAKA 1X7YB 4YP9A 4DBVO 3LX4A 3NAZA 2I2AA 1JHUA 1O77A 4JU9A 3UZUA 3GA5A 2KS6A 5BNFA 3RKRA 1GTG1 1X2BA 2I78A 4MA4A 3OE1A 1AQ6A 2P6PA 3MCTA 3MS2A 4L7VA 3R7FA 1ISPA 1TB4A 3KL2A 5A4AA 1J70A 1UH5A 2ZULA 1ZNWA 1L5MA 1M2HA 4BMDA 2HLDD 4HEQA 4MIEA 1FXUA 3ZUGA 1ZUWA 4G5XA 1JFFB 1XV5A 4TL9A 4GGPA 2G88A 2MR6A 4DCOA 3FZQA 1KE2A 3EEQA 2HTEA 2KJQA 1IXKA 3TAUA 1LX6A 1UK8A 2WHRA 3G2OA 3OPYB 1C1XA 3HM2A 3IERA 3JARA 5DLPA 5TQ0A 3E18A 1HT0A 4MKHA 1V11B 2C2XA 2EBWA 3DDHA 3I28A 1E63A 3KVNA 3N2LA 3QU7A 4X6XA 3INGA 4B09A 1K08A 1W93A 4JI8B 1SJ9A 1X1AA 4YRQA 2JLUA 2R7KA 3AKCA 3CH6A 4BWFB 1FEZA 4UBMA 4YPOA 5BORA 2GZ2A 3A37A 4YA6A 5FWXA 4I5GA 2WEKA 3JAKA 3FYHA 5DK4A 2BTEA 1G8FA 4FEGA 1BVYF 2UZ0A 1KBOA 1USVA 1TAHA 1TUBA 4IBOA 1QGUA 4L0QA 3NYIA 2B0JA 2X5JO 3IE1A 5DE3A 2PVCA 2VHEA 2H8KA 3FYCA 2C88A 2PWAA 5KVAA 5KMGB 1GU0A 1KP2A 2OE2A 3CM0A 4OY3A 3WXMA 2BFEA 3PNKA 4P4SA 4RD2A 3HWSA 4AUEA 3FPHA 3SBXA 2O3JA 1Z4MA 2YXLA 1NDUA 2VZ9A 1CV2A 1HDGO 4GZ3A 4NULA 4RKQA 1IQ0A 1JWLA 1MEOA 2R1VA 4NL4H 5BN5A 1ESZA 5E2IA 1KVTA 1GEGA 4TTTS 3U3MA 2YY7A 4KXMA 4CR6A 5ILQA 4HNUA 2PEZA 1XFAA 3LL7A 4OJQA 1VCHA 1G2QA 2HMVA 3COZA 8OHMA 1AGYA 3SS9X 3AG5A 3WHIA 4KN9S 1GAWA 1OU0A 3AF0A 4FMPA 2OCKA 4KO8A 3GFTA 4EQZA 1I2ZA 2IYRA 1ONBA 4M7PA 3SZOA 4TXMA 3U3ZA 3LTEA 3QELA 4XGKA 2XMPA 4OI0A 3ZS9A 2CV1A 1LPNA 2WC1A 1XJWA 1Z3CA 2JZOA 2A0WA 2XUKA 2YY6A 3Q72A 3RSCA 1JT9A 4EG8A 3GLFA 1MW8X 4XM2A 4KACA 5BWOA 1J24A 3V8NA 1N4DA 3G2IA 3WLLA 4E6EA 4BP9A 1K0FA 1EXVA 1A9YA 2E6UX 3EXIA 3KQSA 3NHBA 2W2LA 1XRPA 4JLSA 5DTMA 2WG2A 3ZEIA 3DOIA 1R9NA 4NATA 5EWJA 1EQUA 1BC5A 2QAJA 2VHJA 3EXG2 3FSGD 1EUZA 2OAEA 1LSUA 2RGDA 3IP9A 4CMIA 4DCSA 1POWA 1LF0A 5GVSA 3RYCA 1OAOA 3SX4A 1GSAA 5T4FA 1X1EA 1MB9A 5SZHB 4CKCB 1CY6A 1OAKA 2Z8YM 1SWWA 2OB2A 1U5BA 2NACA 4G01B 5E9AA 5JSZA 3RUEA 4HQOA 1UADA 3UVEA 1YRYE 5DYYA 1O7JA 2BMAA 2V6GA 3KBOA 4YNBA 2IU3A 4PXAA 1BOOA 1Z75A 1OH7A 2ACWA 1CHDA 3D3JA 4ND8A 1NUTA 1E8DA 1P7ZA 3OCVA 4ALIA 1THTA 5JQGB 3HI6A 3NBKA 4AUNA 2XCQA 3CZAA 1R4MB 2NQ2C 5JPIA 1Z68A 1MJGM 2CGEA 2NP6A 4ND5A 4YRDA 2G07A 5TVKA 4PN7A 3VU9B 5LYJB 1ZI9A 1EM8B 4FYKA 3COVA 2R4TA 1VI5A 1MRNA 4FCVA 4RE6A 1UBEA 1FYWA 1PBNA 2XQFA 5K0BA 2C2HA 2OO7A 1EZ1A 3QUQA 5K4GA 1Z7GA 1HE8B 2FPPB 1PJQA 2GJ8A 3GLIA 4UCFA 1GYRA 2C96A 2R9VA 3NW9A 1WPQA 1V16B 2ZVPX 3H0KA 3OE4A 1MBZA 2XODA 2HXSA 2OUIA 1BN7A 2IVFA 4PXSA 4G63A 1PK8A 3KXLA 3C7DB 3CXUA 3HFGA 3D7MA 4EQ6B 2X4IA 1T2DA 3C5HA 4O2LA 1Z56C 2WSLA 4L6IA 1LVHA 1BYIA 2Q3DA 1K88A 3FKJA 1YIDA 5AMXA 1SZCA 2UYQA 4L8LA 4QXPA 2C9CA 1ISIA 3MJVA 3IOYA 3QX8A 3A3NA 4L73A 4D4IA 1KJNA 1RAAA 1WHSA 4G0YA 3AL2A 1CHNA 1WU8A 1XKLA 3IC5A 4Q1EA 3W5VA 5DNDA 3RJ5A 1MO4A 4WOJA 3K73O 4DILA 1E6LA 1LFDB 2X40A 4I4NA 5CPFA 5F2NA 2ZR9A 4CJXA 2HT1A 2G36A 4QFDA 1OX5A 2FJUA 3FHLA 4DIEA 2YICA 1W5BA 3K8QA 1BFDA 3IBGA 2JANA 1NGSA 4LSZA 4YXFA 1S96A 2HCBA 4DY6A 1DAOA 5D00A 1IXZA 3LECA 4BLPA 4BP3A 1TPYA 2WTAA 2C2OA 4JKYA 1MLDA 3G8YA 5DOVA 4DMRA 2HU2A 3PNOA 4JBWA 3TNJA 5K3EA 1DKOA 1KYVA 5EVJA 3SCZA 2AK3A 4KK3A 1ST3A 3OMXA 3LYAA 4ARVA 3HCWA 1S9DA 4H4CA 1Q92A 1E6MA 2EYUA 2WJAA 3TGWA 5JNSA 3RQIA 2FFQA 4P33A 4C76A 2I4MA 4E5NA 4DMLA 5CA1B 3SU8A 1JIJA 4LK3A 1NJGA 1NUSA 3BXZA 4Z5XA 5IUNC 2X0RA 5ECYA 4JI7B 2CFTA 3O4HA 4IDAA 5ECWA 2RI1A 3B6IA 4U2FA 3K35A 4W4TA 5DF1A 4RV4A 3OEHA 2UXDB 1QCYA 5TQ0B 1Q0LA 3CKLA 1AHNA 3KQYA 3UV6A 4ETIA 5B12A 3LFUA 3LQ2A 2CXOA 3ZWBA 1AXRA 2HF7A 1ZVMA 1YZVA 4JXJA 1RAEA 1CIPA 4LC0A 1YZHA 1IIBA 2WJIA 3CJTA 5ARCA 1UPAA 3GCXA 1PYGA 2HFKA 4BOYA 2QX7A 5I3ZA 3C8MA 3IIEA 3GUZA 4LXIA 2YZKA 3SYRA 2R68A 4X90A 1AE1A 3PRKE 4IWXA 3RUAA 5E0KB 3P9KA 5C7LO 1NQXA 1XZIA 4XARA 5BURA 2C7QA 3GEBA 1KZ6A 2G9ZA 4BS9A 2LNDA 2XOXA 4CXMA 2CFSA 2FNAA 4WK4B 2G9NA 3OESA 4QVGA 1ACJA 4DVGA 3TS1A 1ZKMA 1VL1A 4TLEA 2D13A 4FGKA 5FOWA 3PJFA 1JKJB 1VI2A 4QGBA 4UVEA 2JJYA 4AG3A 2BP7B 4AJ4A 1E5VA 3KXKA 3RS3A 2FLKA 4H2DA 2DQYA 3I3OA 2X4DA 4B45A 3OA0A 5TT1A 3R5KA 1UBSB 1UBKS 1YZUA 2FSSA 3HYSA 3M5WA 2VK8A 4DT1B 4N8DA 1UPXA 4KJXA 4E14A 3PWSA 2WF5A 3KFXA 1PEDA 1T4DA 2QTHA 3GIDA 4AX4A 2AQ8A 3Q3HA 2CDAA 4RCYA 3DQZA 4BO0A 3S70A 2P69A 3JATB 2Q99A 1XX6A 1IOVA 2F9MA 3VZSA 5AH0A 2OV3A 2FLVA 2XYQA 1LLFA 1G63A 1QONA 3QUAA 5F4ZA 1M83A 5C31A 4QQFA 4Y6GB 1BU8A 4BB5A 2QX9A 1X9GA 3N5KA 4HDMB 3UBMA 2WSSD 2PTGA 1DDOA 3W3AA 3ZV6A 1P0FA 2D1QA 5C1IA 1C1YA 3RFUA 3OTOB 3E3NA 2P4SA 1V9LA 2JNWA 4IOLA 1T10A 1M2NA 1MVNA 1RXUA 1KAEA 3H9BA 2Q6IA 2VDLB 4I2NA 4OEHA 1T0PA 1VLHA 3D81A 1Y48E 5FX2A 3F4KA 4DMKA 5ALVA 1MO6A 1JLHA 1PT7A 3E3OA 3OQMA 1WV0A 1QR6A 2JLBA 1L5OA 3O7WA 4IUYA 3W5CA 1XNRB 3P9PA 2OKCA 3UWSA 3NV7A 4DADA 4D0GA 5ARBA 3SVLA 4UDOA 3DDCA 1GUYA 3C3YA 5HRAA 3OQIB 1H8ED 4RESA 3FBGA 3SIXA 5LZ2A 4JEUA 2WTMA 2WTXA 3AIIA 1QORA 1ISRA 4J8PA 5JY6A 3V7NA 3FIUA 3RRZA 3GDHA 4HSGA 3GJ8A 4M0LA 3QFTA 4GMHA 3RG2A 1H9CA 1Z5VA 1QDEA 1RXCA 3I76A 3T9BA 2ZBRA 1WPXA 3I92A 1GR1A 1A2BA 3CGWA 2CVZA 2AS0A 2H1RA 1X1BA 1KK0A 2CJWA 4IP0A 3WKAA 2M9MA 1CZKA 3DBLA 4N5MA 4RMNA 3FZGA 4ZQGA 4ZGBA 5HR5A 3KYDA 2W00A 1ZRMA 1COZA 1FDSA 1P6XA 3WTCA 4C7XA 3WA6A 4YP1A 4K1XA 4F72A 4DR3B 4J7CA 3O6VA 1JHDA 2NXCA 4EEXA 3UYKA 4KDRA 3SKVA 2C61A 1F9AA 3IVXA 2QRVA 1KZYC 2PIDA 1PD1A 4MVJP 3IJ5A 3EA5A 1XTZA 4GBGA 3MK31 1ZBDA 5DM4A 3DZ8A 1AT1A 5JV5A 2OG2A 3DVRX 4IEFB 5J4KA 3VR5A 1VIVA 3GVCA 3E61A 3ZXUB 1QP7A 4UBJA 1EHIA 4GKBA 1QGDA 3ZS8A 3MMSA 2R5FA 4AYWA 4BNWA 4LPSA 2E5WA 1R4NA 4J3JA 1GDDA 3CZ4A 2F1HA 1JHPA 1VKRA 1EFLA 1N2SA 4GW3A 1USGA 2CL0X 5BR1A 5FNZA 5B7GA 1IWBB 3TCKA 1W4LA 4YAJA 1KVRA 3E2PA 3A1VA 3H2JA 4TM8A 2NADA 2Q2OA 4JLDA 4C43A 1CY1A 2FZEA 4IDFA 1JG4A 3BH6A 3IUMA 1RE1A 3NM4A 2WM3A 4H15A 3O9MA 1Y34E 2VYNA 2RAUA 2BTQB 3ER8A 1M8GA 1EYZA 3IMKA 1JMKC 2QMOA 1I6KA 3CRW1 3QW2A 2GJSA 1NONA 3W5HA 3EE6A 5BRNA 4AKIA 4O4LB 1PDOA 2YWRA 3FLBA 2ESRA 1L7NA 2YYAA 2HGZA 2PFGA 3UXHA 1MFPA 4EKYA 1LRJA 4MRRA 1Y7PA 1Y6FA 3S2IA 2LPMA 2UVDA 3EX7C 4U7GA 1G5HA 3ITNA 4LXQA 1TNDA 3H2GA 4CKYA 5BUCA 5GZ6A 4C2UA 2W6NA 1II9A 4ZT3A 4EHIA 3FOFC 1RNLA 2J09A 3WISA 2FLWA 3O94A 3VC7A 3I23A 3QPDA 4FFPA 2J5KA 1RPJA 1O3YA 2P5UA 3TQSA 5FOUA 5CVEA 3OLCX 3R5SA 3TLGB 1U2RA 4E70A 1K63A 3JZMA 5CM8B 3CUVA 3LXXA 4TRRA 4B4DA 4HGZA 2XMDA 4TZ0A 3QLUC 1F2DA 4I5EA 2GCOA 2VSFA 4TTSA 5ANRB 2PLNA 2P8JA 3STYA 5LU9A 4LF8B 1ZMBA 4KMRA 2FN8A 1E2FA 4TL6A 1Z62A 2JARA 4X6LA 4NCHA 1LRLA 5KU7A 2QX4A 4U6SA 4IDBA 2ZWIA 4IXWA 2QD1A 1X8JA 2X0EA 3EGXB 3H2IA 3QVKA 5K6RA 4H17A 1X15A 3G0IA 3UAOA 1YCFA 1BIFA 4PTYA 4TMFA 1MQAA 1RABA 2A84A 1RADA 3JR3A 4UM8B 1K0UA 3HA5A 5CYFA 4HDSA 2IS6A 4KODA 4DSAA 3FFBA 3BEDA 2D5BA 4G1FA 1KFKB 1DJQA 5AJHA 2FF5A 3FCSB 1FC0A 2OZVA 2X86A 1S6YA 4BV2A 1GPH1 1NAIA 1UK6A 2VN8A 7YASA 4FX5A 4KZPA 4M98A 1GPNA 4U3JA 5CB8A 2VHVA 2WRZA 3T5PA 4U0KA 3AKDA 3TRDA 1QK5A 3EH2A 4LVOA 3IEIA 4YAFA 5CFPA 5LIRA 3UJDA 2I91A 1QWOA 1ZHFA 2EW1A 2OQIA 4UXHA 2GD1O 1BE8A 3QZUA 3EPRA 2XECA 4L8GA 3SLKA 2H0QA 4BNLA 4W5TA 1KH1A 2X15A 1OSNA 3KSRA 1P5ZB 1T1SA 3U4CA 3MJDA 2VTVA 2WNHA 1I2AA 1RYEA 3LGAA 3QVVA 2NUPB 2IXDA 3EDQA 4NDZA 2N9UA 1SFRA 3CJQA 1KDYA 3TVTA 2BJVA 4FUQA 3PP8A 3ZE8A 5BSTA 1LTQA 2OHVA 5HCUA 4K9MA 4MEJA 1PFWA 3OZCA 4C89A 1O9HA 1X7GA 4RPHA 4URUR 3BWXA 3ZWQA 4ER7A 4HC4A 3EQZA 4TQAA 3IT0A 4BYMA 3IEVA 3OJOA 2XD4A 3B38A 1L4LA 3BQ9A 1Z2PX 4WUVA 2FN3A 5I7FA 2A94A 2GAOA 1MB2A 2PT9A 1V7PC 1E9VA 3LHSA 1WB5A 4OUDB 2CLEB 3HKDA 5JFTA 2JIRA 3DJYA 3R7SA 4P7KA 2ZR7A 1HL7A 1QOPB 4HWOA 4F5WA 1L4MA 2VP2A 3UFBA 4QJ3A 1QXSA 4IDNA 3LFHA 4K9RA 1E7WA 3MVEA 3B7GA 3OT1A 3LKBA 1KAGA 3UJBA 2P4EA 1AMOA 3QF7A 4AB1A 1M6HA 4OQ4A 2IGBA 4KL8S 2A35A 1C7JA 5I51A 1AQIA 4FFNA 2XCUA 4U8GA 4XPIB 2WWHA 2LBPA 2P9GA 3HVHA 2C7VA 5A02A 1EUDB 4JT8A 5LQDA 1RAIA 3JVDA 3DC7A 5DX0A 3B53X 4CMEA 3ENWA 4IDPA 3ICCA 2VAVA 3QKRA 4WA8A 5ALUA 2IK8A 3PVSA 3RUPA 2QY6A 3TYXA 4OTZA 1GL7A 4KVAA 1Q7GA 3KV3O 1ISHA 4O4JB 1FTSA 5FR1A 2A9KA 3TSWA 1YL5A 4HXFB 1JHYA 4RJKA 4Q24A 1ZUNB 3AEQA 3FCEA 1QLJA 1XU7A 4KWTA 1Z8DA 2QIOA 3M2TA 3T9AA 2HK8A 5LA6F 3ZVLA 4LQLA 2ZG6A 1YHZA 2FG5A 5GP1A 4DNPA 4RTJA 1SD2A 4YT2A 2YXEA 1U3UA 4ZI3A 2EOAA 3CR8A 1UXGA 4G3XA 2ACVA 3QSYA 2DETA 1VJ5A 1KGSA 1QHHB 4WVLA 3OX4A 1C7IA 2AR0A 3QA9A 4LV5B 4RUKA 3V4PB 1P5HA 4GKJB 5M3BA 3HFSA 4KC0A 2FRVA 4CVNA 2BW0A 2XTMA 3OQJA 4ID3A 4LYEA 1B6TA 1NUUA 3B1ZA 4M36A 5B1IA 2MHCA 2ZSFA 4MW4A 4N9WA 4F3TA 2A86A 2YFHA 4U9IS 5EYPB 1NZJA 4JWKA 3C3DA 2UYHA 4JUFA 3IEPA 5GADl 3L6RA 2C78A 1D2EA 4CUZA 4WFIA 4C29A 5HZHA 1DQPA 1QP8A 5LB2A 4F21A 3K6KA 2B7BA 1H6CA 4RJ2A 5J2TF 1YQ9A 3M6AA 3OCXA 1KC3A 3A4VA 5JNVA 1HZZC 2X9NA 2B2NA 4RJTA 1PIWA 5COBA 2WVAA 3NT2A 3UH1A 2R6FA 3MMPA 3WL7A 2W93A 5JLJA 3V1LA 4UEOA 1LDBA 4H77A 1TLTA 4E15A 1BD3A 1U6IA 4D97A 5MN6A 2NVUA 3MAGA 5DHQA 1VGVA 2ZKIA 4YS6A 1KAQA 1JQ5A 1RJEA 3HCFA 1QB8A 3PXUA 1QS0B 3BXEA 4FT2A 4WASA 2ECKA 1E92A 2JGAA 2C5EA 1VJRA 4D99A 2IOQA 1YBMA 4WXHA 4DDMA 5HJEA 3FOAA 5EMJA 2L0XA 1B8UA 2F00A 3B82A 4JC0A 3K4HA 4IVRA 2ZRNA 5A5DA 3AUXA 3UAGA 3WJ2A 1AS0A 4EG3A 4DLYA 1IATA 3R41A 4TKVA 1YVRA 2DJIA 4OH7A 1PBTA 3TZLA 5IYZA 4W8GA 2XI4A 1QHNA 2V65A 1SOWA 1WCIB 3H5TA 3QBVA 5FULA 1N9ZA 1PNVA 1L5NA 3WRXC 3W6ZA 3IBFA 1PR3A 3HA3A 2P30A 1Y8AA 5FTLA 4MCHA 4HGQA 5K8UA 4OIMA 3RC2A 2RH4A 3C5VA 3FGPA 5FUWA 1W96A 3BE4A 1TE2A 2OT3B 3ZOKA 5C7YA 1RS0A 4E11A 4DOMA 1A1SA 1CUZA 1DQSA 2I65A 2QU8A 2VBIA 4ZOAA 1STOA 4W5QA 1Z5GA 4RKFA 1UQRA 1ITZA 2BEWB 2RHWA 4HAOA 4JODA 4YALA 1YCHA 1C8BA 4WGGA 1EFRA 3L6CA 1HF3A 2NO4A 2QUHA 4GKAA 3TDKA 3WGZA 4WBNA 1O95A 4ZJZA 4DA9A 2HLHA 2BLLA 2F3UA 3D3QA 4S1NA 2I4TA 1PN3A 2UUPA 3MGGA 4WCDA 4MTCA 4PRKA 2FQQA 1DCFA 5DX1A 5GZ3A 1XTQA 2O1WA 4B3IA 2VT3A 3C3BA 4URZR 1V9SA 1XZ8A 2AN1A 2ZJ4A 3WK5A 4BO5A 1ISSA 4EUHA 3OJXA 2VEOA 2ZJ5A 4BATA 3O4IA 4X7RA 6YASA 4O0LA 4OL9A 5JMTA 4AJ2A 3LXUX 1K8ZB 4LBWA 3NHLA 1EVJA 1HURA 3DEYX 3EPKA 1N8SA 2RK3A 2LKDA 2O3SA 3ES9A 1UBUS 3ML1A 3PIIA 4BQRA 5CA1A 1YZGA 2XXBA 1JIQA 3C3XA 4OHXA 4YB8A 3L0YA 4IIFA 1T0IA 5HW0A 4YQZA 3OUTA 1NA5A 1Z0DA 4UJ5A 3WWCA 1DO8A 1YVDA 2CT8A 2O8BB 2YJTD 4GR4A 1YQQA 3CSSA 3CEHA 4R5HA 1W2WB 1WWKA 4KXVA 3QVSA 1JLLA 1DC4A 4IIXA 5JOQA 1RP1A 2YINC 1WPRA 3CRZA 4FFWA 4P4UA 2PL5A 2WI8A 4ODIA 1JBQA 4G9BA 1HKUA 3T5TA 1SCBA 4HUQB 4R3WA 3WNVA 5FBQB 4MV9A 1NNSA 2EJVA 3FNRA 4D0LB 2DSNA 3NKVA 2DKNA 1PTKA 4M53A 5GM1A 2C7PA 1ZWKA 1MOSA 4ZXPA 2ZB8A 2JRLA 3ZZ1A 4WZBB 4LFAB 3L3BA 1PR9A 1Z47A 2QT9A 1ESEA 4A27A 1MRSA 1RWXA 3TZ6A 2AYYA 4BLTA 1TT5B 1SVWA 1BMFD 3DHNA 3HO6A 3FOZA 4AS2A 3U1BA 4C3VA 4H59A 3W9SA 2Q1SA 721PA 3F0TA 3HDTA 3LLVA 3OURA 1DPFA 1JJIA 1II8A 1ZIOA 1D5CA 1LLQA 2GXSA 2FWRA 2Q8QA 3F5DA 3A9SA 5DYNA 3BQMB 3I53A 4TUYF 1IQPA 1TA9A 1ZVJA 1NV9A 2DPHA 2GH1A 2VCHA 1MABB 1TUIA 1NWCA 3N7AA 3QFCA 4HRVA 4IGFA 5DI9A 1U0BB 4ZK2A 1N7GA 4KHZA 1WHTA 5CB0A 2EFCB 3BULA 4WXYB 1SHZA 3VSDA 1NN1A 5HMMA 3GWGA 2VZEA 4FCTA 4I9GA 4EVIA 3KFLA 3ZHVA 4DGQA 4UD2A 2F8SA 3LKZA 1U0JA 1WO8A 3CZQA 3K16A 4A7PA 4HDOB 4E07A 2V03A 4RMJA 3P32A 4YCBA 1LDNA 1Z12A 4JVNA 3QJGA 1AH2A 3WIEA 3JD0A 1PT6A 1I1OA 3WIDA 3IEXA 3W2FA 3KE8A 2DY1A 2QX6A 2BT4A 4RZUA 4OGKA 1ZOSA 3IOMA 4FWIB 1RQLA 2Z0MA 3EASA 5JWHA 3TOCA 4EJMA 1EE2A 2O2EA 3H3JA 5AKLA 1M8FA 1P0IA 4GVLA 2OHFA 4DA7A 1DDGA 1P2VA 3A1TA 1ISGA 2PH1A 2HR1A 2IZ0A 5AI4A 1AZWA 4L02A 3WLAA 3U48A 1HQKA 2PS3A 2ENWA 3WGTA 1EKXA 2HHHB 3ZJTA 1RM5A 4YAEA 4RY9A 3HVIA 2QN3A 1O95D 5H3LA 2C9ZA 2JF0A 2RH9B 3S99A 2OC4A 4RKEA 3IBSA 3WB9A 3G5UA 2EJWA 5C2JB 4R69A 4BUJA 4MKRA 1Y4SA 3K0CA 3VSEA 4F9GA 5EAIA 4XH9B 4O3MA 2JIBA 3DMHA 2ZEJA 4NBSA 4JGIA 1H8EA 1WZUA 3A1UA 2DE0X 3G6WA 3N2YA 1E3EA 3H8VA 4Q7LA 4UTZA 1M2VA 4AP9A 4CN9A 4PFJA 3UKJA 4D82A 1I5EA 2HSJA 4DQDA 2BMWA 2O8EA 3OJCA 3R75A 2X6RA 5EVCA 3FSJX 1RKQA 2EHJA 3BFVA 5AW4A 4F11A 5KINB 5C18A 1XDWA 1VHQA 2WP8J 4C5AA 1SKMA 3C8UA 5HMLA 1NKVA 5FNVF 4ZTZB 4TMYA 1GAJA 2A9JA 2I1WA 1Y8QB 1VE9A 3SLGA 4DR2B 4KCGA 1MMFB 2RH5A 5AW1A 4ZZ1A 2O2GA 4CLDA 1OXKB 4TVOA 5EESA 4TXHA 3P2KA 4OXXA 1F5SA 2V9PA 1C7EA 4WGFA 3WBKA 3LSTA 5BN4B 2Q7DA 1I36A 1C3XA 3T38A 5GM2A 2FPUA 1U0RA 3KB6A 5K8JB 1NXXA 4JQZA 2B35A 1F8FA 1Z5ZA 4OXKA 4EB6B 3VO1A 1F17A 2WYHA 1EDBA 4PHFA 2NO6A 5H9WA 2JVJA 3CPJB 4U00A 2FWBA 5A6SB 4WFKA 1U2QA 4MHTA 4GZ5A 4B9AA 3K9CA 3HC7A 5HKKD 2YDXA 5JNRA 1JPJA 2NO7A 2CLMB 2NV0A 3FYTA 3CEPB 2W22A 2ADOA 4EDFA 3W5JA 4MVJM 1EFAA 4LY6A 4Q3OA 4JOSA 1TM4E 1M5TA 2AVNA 3PNSA 3QRWA 3BRSA 3C0KA 4HZIA 1QAQA 2EX1A 3L1JA 3TI9A 4F71A 2YV4A 3Q40A 5TLSA 3AGQA 3ROQA 1BVUA 1E8MA 2OV2A 3K6SA 3KJQA 2PGOA 4AVYA 3A9CA 2VATA 3AQIA 3BB4A 3UJNA 1E1LA 1S2GA 2BI8A 3JQQA 1G8GA 3ONWA 5DRYA 5K3CA 5EWMB 3ZGZA 5LWHA 2H31A 4L9WA 3A7EA 1A3CA 4KAJA 4J1SA 3S1SA 1V11A 3ZWAA 1MPTA 1GV0A 3Q41A 5BO5A 4Y2QA 3DKIA 1EP3B 3W2IA 1U8XX 1CY7A 3KXDA 5ALLA 2QD2A 1UIRA 2VZLA 4QO8A 3N0XA 2XT9A 2BMDA 2QU7A 4G24A 4YHHB 1QZUA 2IT1A 3ESXA 4P5EA 1TU4A 3IT2A 1C2TA 2PMDA 3WBJA 4ZOLA 1CZOA 4E2XA 1PJZA 2DHEA 2X13A 1OZ0A 3EBOA 3I9JA 4G4JA 4QZVA 4UEQA 1KKLA 1M6YA 4ED9A 5CH3A 2VYND 2I2FA 4ACAA 3RSLA 2J7PA 1OOEA 5G0WA 4NZOA 4J0KA 4NBWA 1U7TA 3BZBA 2E0IA 1EA7A 1X7ZA 1YB6A 1XRSB 3FUXA 1MABA 4XWGA 2DUNA 3U4HA 2QLBA 5EYPA 2JI8A 1MD9A 5ES4B 2PT6A 3OKFA 4Q39A 1AQUA 5LR6A 3HBMA 2MYNA 3V3TA 2Y0PA 2KPOA 4GM1A 2P0EA 3CKYA 1QU3A 1W19A 2RSLA 4K40A 4Z4HA 3OU6A 3G49A 1RCUA 1Z4JA 2LR0A 1EBBA 2PKWA 2EZUA 3A1SA 1DO2A 3ZYCA 2L82A 4AY4A 2JKYA 5DHSA 3F6CA 1HTBA 1W0CA 1EXNA 1V96A 1MENA 4HLDA 3I37X 3UMBA 4DSNA 4AWXA 1BJTA 1LXCA 1ZHHA 4E51A 1XXHE 3U7FB 1VKNA 2P4QA 2ZKLA 4X62B 2CUNA 3RF7A 2PEYA 1SG6A 2G76A 5A4DA 6REQA 3DBHB 3BMCB 1OHHA 4M0KA 3ORYA 3B7PA 1Z0IA 2K2WA 4GP9A 1FF9A 3JASB 3U4DA 2IZ6A 4K9NA 2HI0A 5GY7A 2NUTB 5EFZA 3V34A 2NXJA 1S7GA 3AVPA 5EZQA 1NPYA 5B3KA 1T0UA 4NDAA 2W6ZA 2PYDA 4M0MA 4GPIB 4XSGA 5I4IA 3BMQA 1TUGA 1KEWA 3BN3A 1UPFA 3FJOA 1T9BA 4I1SA 3UFXA 4I4TF 1YMUA 2NZXA 1YI0A 3HR4A 3VJRA 2FSVA 5C7IO 3BVPA 1MB0A 1UXHA 2NU7A 2OBBA 3A9TA 3BGDA 4IIVA 3WV4A 5GINE 4MINA 1KH3A 3SD7A 1NSTA 4DLTA 1YE3A 5COQA 4RA9A 4F4DA 1JHOA 1OYYA 1QKJA 4URXR 1PR0A 1XD9A 5FL3A 2D0PB 5EKTA 3BRWA 1W9HA 1I5OA 4AD8A 4ZMSA 1ZK2A 7REQA 4UM9D 1R7RA 4ITRC 2H07A 4OBEA 3BWVA 1KJJA 3BMXA 1MA0A 3JQFC 1U7ZA 2QYOA 4J0JA 2AJCA 3BXPA 1DLJA 3CUKA 4Y1FA 3DBRA 1V0JA 2GBGA 1KO7A 2P9YA 3KUUA 5KYYB 4L57A 5EIOA 2BFWA 4UJ3A 1KQPA 4JP2A 1TW3A 4E21A 4LXHA 4QE3A 4PBSA 4C0LA 1CJSA 1DADA 1ZCBA 2OD2A 1ATZA 2CZGA 4I46A 3BTSA 2DPMA 1WXGA 2BMJA 1Z28A 1V37A 4N6OA 1QQ6A 3KJGA 3WLIA 3IAXA 4B71A 1TFRA 4PPQA 4W5JA 5ESRA 5L7YA 1Y9EA 5EWMA 5KNLA 4L72A 4IJVA 1KIFA 1OTHA 4KMOA 3K2QA 2C5GA 1NSYA 1KR2A 3K2EA 2BKAA 1KY3A 4O4IB 3SHOA 1H8HD 2AG0A 3STXA 4DJFC 3RIXA 2FXVA 5AKGA 1ZCZA 4ACBA 3Q5DA 4BFXA 4TZTA 4XEHA 2V7QA 1TCCA 2A0YA 3NX4A 3I4CA 3BX1A 4O59O 4UNQA 4AMYA 1LCIA 4K05A 4BNIA 4IHAA 1NFRA 3ENKA 1KGDA 3L8HA 3F6RA 1DKMA 1Z74A 5FF9A 2G25A 3U0VA 3CRMA 4BJ5A 4DHWA 5MN5A 3ZV7A 5TX7A 2O8DB 3L77A 3ZU5A 2FFHA 1KPGA 3H5OA 4QHYA 4G1MB 1US8A 3M5DA 4HO1X 1N2EA 4MDYA 2J41A 3GLVA 1W8DA 1OTXA 3D1LA 4NC9A 4PQRA 4R0NA 4RD4A 1Z0JA 1I5RA 1Z7YA 1ZH8A 3MJSA 2WDZA 4YUVA 4D9EA 1EFKA 4FYPA 4YXWD 3L5KA 3P9XA 1J2EA 1XA3A 1O96B 4PNPA 3BKWA 2XDYA 3DTVD 1YR1A 3H8SA 2QTVB 3NIBA 2EATA 2FQ1A 2NOAA 3HA7A 3MTEA 1WQ4A 1EQAA 2PGXA 3SR3A 3NEYA 2ID4A 4N8EA 1QE3A 3HJBA 3T9DA 1I7QB 2GLUA 4RD6A 4KDEA 5DTRA 2XVAA 2ZI4A 5D6OA 1W0JD 4YJ2B 1U5CA 5B7QA 2HUNA 5BT9A 1TQDA 3LD9A 3KKMA 1H5NA 4EX6A 3VHLB 2GEBA 4BV8A 1MV5A 1WR8A 2J3LA 3R5JA 2OGTA 5CJ2A 1WOMA 4W5WA 1V2GA 2EKBA 5AT1A 1HNNA 2J1LA 5ALMA 3QVTA 5EMHA 3ZIUA 3OSZA 4KYTA 1BD4A 1M1NB 4ZC8A 3TGPA 5I3CA 3GOQA 1FQOA 3HP1A 2Y0DA 4F5YA 3RHSA 1XCGB 4G5RA 1HDEA 4D3SA 3RC7A 5IBCA 2FRDC 3I1JA 4D6YA 5CDSA 3OAAD 1NDHA 4C7VA 2C42A 3CVYA 5JJKA 4P3KA 1U9IA 4TRNA 5K20A 3VVMA 4MQ6A 3T7SA 1XL0A 3PUIA 4RTSA 1PZXA 3F6BX 3JWEA 1UFQA 3IR5A 3MFYA 4Z2YA 3F4LA 3RBZA 3VR6H 3WGVA 1GCUA 1RRMA 2ZSBA 4IH9A 3RCBA 3AXTA 1ZI8A 2PLAA 2BLNA 4P98A 2VBCA 4Q37A 3MTJA 4X8OA 1AKVA 2BMFA 4LRXA 5CCXA 2FGKA 3PFCA 4ARSA 1P3JA 1J5XA 4FGSA 4IF6A 2QN7A 5KCMA 1Z2CA 2YYYA 2BHSA 3MGAA 1C9YA 1TU3A 1YE5A 1HEYA 1G9XA 1RACA 2Q1TA 5AKKA 5KYVA 1G7TA 4F04A 5HNKA 2ZU0C 1L6RA 2ZATA 2WIAA 4CI0B 2J46A 4RH3A 5JPCA 4QD3A 2QSYA 1S4MA 1YS1X 4YJHB 1L7RA 4GLFA 1OI7A 3GCGA 1PNTA 3K1JA 3M82A 5BXYA 4Z4QA 5E95A 2HRZA 4PO8A 1KRHA 4TV9A 3IKMB 1M0TA 1XE3A 1UPBA 4MQ5A 1E59A 1TL7C 4L9RA 1E5LA 3FUCA 3V80A 4R2IA 4HTFA 4CIWA 4OAOA 1CK4A 3BB1A 5JSUA 5IKXA 1N8KA 3BWMA 4ZDWA 4TTPA 1GZDA 1NQUA 2A1TR 3MBKA 5JIBA 4DKJA 3FDXA 1Q91A 1YASA 5JBIA 4F46A 3ESZA 5KJCA 1LQUA 1R15A 3KZXA 2R8ZA 1G291 5EJMA 4BV3A 5DNAA