3B12A

Crystal structure of the fluoroacetate dehalogenase d104 mutant from burkholderia sp. fa1 in complex with fluoroacetate
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
294
structure length
294
Chain Sequence
MFEGFERRLVDVGDVTINCVVGGSGPALLLLHGFPQNLHMWARVAPLLANEYTVVCADLRGYGGSSKPVGAPDHANYSFRAMASDQRELMRTLGFERFHLVGHARGGRTGHRMALDHPDSVLSLAVLDIIPTYVMFEEVDRFVARAYWHWYFLQQPAPYPEKVIGADPDTFYEGCLFGWGATGADGFDPEQLEEYRKQWRDPAAIHGSCCDYRAGGTIDFELDHGDLGRQVQCPALVFSGSAGLMHSLFEMQVVWAPRLANMRFASLPGGHFFVDRFPDDTARILREFLSDARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate specificity of fluoroacetate dehalogenase: an insight from crystallographic analysis, fluorescence spectroscopy, and theoretical computations
pubmed doi rcsb
source organism Burkholderia sp.
molecule tags Hydrolase
molecule keywords Fluoroacetate dehalogenase
total genus 113
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.8.1.3: Haloacetate dehalogenase.
pdb deposition date 2011-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3b12A00
1MN6A 3WWOA 4FHZA 2QXTA 3FBWA 1LBTA 1ETHA 2O2HA 1TRHA 3QMMA 3RK4A 4B85A 5AKXA 4N8SA 1W1IA 1GQRA 2XLBA 2DQZA 3WL7A 1RYYA 2VJCA 1CUFA 5FKJA 4H0CA 4X91A 5DTIA 2Y1KA 3DL7A 3T4UA 5DYTA 5K3FB 3CCBA 3G0DA 4N8EA 2CJPA 3G8YA 5HCUA 4BYMA 2OCLA 3WK5A 4AXBA 3GUUA 1MJ5A 3LLCA 1XROA 4B7ZA 5AHXA 4X95A 4KAAA 4L3WA 5ALJA 5ALRA 3ZPXA 3WZMA 4WFJA 2UZ0A 1TK3A 1T2NA 1R88A 3F67A 3WA7A 4QDXA 3PICA 3F97A 4C4ZA 3FCXA 1P0PA 4ZV9A 1PJAA 2OQIA 2YASA 4PSDA 4DMKA 3UMJA 2XQKA 4BC1A 5ALMA 4ZREA 4J0KA 4Y7DA 1QZ3A 5AP9A 5FDFA 3AFIA 3STUA 4X7BA 3H2IA 4JYMA 5AOAA 3DL4A 2QZPA 2CKMA 4QWMA 5CT5A 3D2CA 1GQSA 4GW3A 3E1GA 1CUZA 3SWWA 2WIFA 2XQJA 4CCYA 4RGYA 2HFKA 3FYUC 3IUNA 3FCYA 4X85A 2GBCA 4B9EA 4XVCA 3L1IA 3PF8A 4OSEA 5JAPA 3QYJA 1RP1A 1THGA 4MEAA 1ZICA 1XKLA 2Z3ZA 1H2YA 4LYDA 3YASA 2QOEA 4F0JA 4B0OA 4Q3OA 4AMYA 3W04A 2QVBA 1SFRA 2WG2A 3V1LA 2HRQA 4QEKA 3AIMA 2WUEA 1ZD4A 4BDSA 4G4JA 2AJDA 4GDMA 4FLFA 1VE7A 4HXEB 1SC9A 1B6GA 2C5FA 2WTNA 4C4XA 1PV1A 5DTJA 1ISPA 5EIEA 1XZAA 2VTVA 2VSQA 5A2GA 6YASA 3C8DA 3O9MA 2GZRA 3FLBA 3WIBA 1CUCA 5KREA 2GBFA 3WK7A 3VJMA 4OYLA 4ZXFA 1CUYA 1UOQA 1ZI9A 2VA9A 2WKWA 5ALNA 1VXOA 1GXSA 2OGSA 1Q83A 3OURA 1N1MA 2PL5A 2XI4A 4BCCA 3D7RA 5CW2A 2WHQA 5FPPA 4EB0A 2OPHA 3W9UA 4ZRDA 1WPRA 2PSHA 5DNVA 3QPDA 4EBBA 1CQZA 4Q34A 5CXUA 5ALEA 2J3QA 4XWGA 4HRXA 3R40A 5JD4A 1ZIXA 4K6KA 4P92A 4I3FA 1XKTA 5ALXA 4H7KA 2XB6A 5HQ3B 4U2FA 3HI4A 4PO3X 1EB8A 1CUWA 2H7CA 5JIBA 1GGVA 3GFFA 3IA2A 4RPCA 4E46A 2DQYA 3M81A 2WFLA 4G8BA 5DNUA 3BE8A 1CUSA 1YA4A 3IULA 1DWPA 1CPYA 1TKRA 5HF9A 1EDBA 1L7RA 4MXDA 5C81A 1C7IA 1QGED 3DQZA 4FKBA 4U2DA 1CFJA 4X90A 4I19A 4BAUA 2PU7A 1ZGBA 1J06A 4B9AA 2ACKA 3VISA 4BBZA 2WU4A 1UWCA 2FX5A 1XZHA 1XRQA 1CUXA 5AOBA 3M3DA 3R41A 5CBKA 1NU6A 1K5PA 4U2EA 2C58A 3G7NA 4WFKA 5EHXA 1EHYA 2C0QA 5EIAA 2XUHA 2XUJA 3FYTA 1GT6A 2OGTA 1ZI8A 1DX4A 2HHAA 4J0CA 1Z68A 2VT6A 2HRRA 3R3XA 4CCYB 3JYHA 2QT9A 5FPQA 3WKEA 3G0BA 1R3DA 3Q8WA 4GECA 5HFNA 3M82A 3HJUA 4G8DA 1NX9A 5AK3A 2Z5GA 5FV4A 1MPXA 4HVTA 1F6WA 4E11A 4BP8A 1MAHA 1EXWA 4GWLA 3PF9A 2VJAA 3ICWA 2HFJA 3WKAA 4FBLA 3OPMA 2HA7A 4ZWNA 2AJBA 2WUGA 3ESDA 5J3JA 3PFBA 4FOLA 1XQXA 3DNMA 4NMWA 1Q0ZA 2C5GA 1KEZA 4B80A 1JJFA 4Y2PA 1LLFA 3N2ZB 3SK0A 5HQ3A 4GEGA 4U2GA 1F0PA 4KAJA 5CURA 2WIGA 2H1IA 1E3QA 2FJ0A 1EI9A 4QDZA 3EQ9A 1USWA 1ZI6A 1X70A 4W1SA 3G0IA 3OM8A 2DHEA 4LXHA 2VATA 2WHRA 5AM0A 1AURA 1GZ7A 3V48A 4NVRA 3DOHA 5CMLA 4UHCA 3I1YA 1XRNA 3BF7A 1G66A 5DNWA 1XZFA 4BCBA 4PW0A 4YPVA 4AN1A 1SOMA 3L1JA 3I6MA 5AKHA 4AMZA 2PSJA 1XZJA 2XLCA 1YASA 3A2LA 4G1FA 3ANSA 1WB6A 4HXGA 1W52X 3O9VA 1QO7A 5ALWA 4J0GA 4H7IA 3VXKA 5A6VA 1N5RA 1G42A 2ZYSA 5LKRA 4OB6A 3DD5A 5JALA 1VZ3A 1MX1A 4F5ZA 5A7FA 3SX4A 1IUNA 4BC0A 1X2BA 5IVHA 3BDIA 2HU5A 5A71A 3I2IA 4DYHA 1K63A 1KU0A 5IVDA 5K5EA 1LPOA 5I8PA 1A7UA 1CUBA 3WI7A 4UHDA 3GBSA 5BWBA 3O0DA 2R8BA 4X93A 3C6YA 5LZ9A 4MQMA 4WFIA 2VQ6A 5HZGA 4Y2RA 3KOOA 2B20A 5ALQA 1XZEA 2X8BA 4U2CA 2B9VA 3G9XA 2XUOA 5EFZA 4INZA 5ALGA 3G0CA 5JD6A 4U2BA 4BVLA 4FBMA 5FOQA 4MQLA 4G5XA 3ZLUA 4FLEA 1YAHA 5K3DA 1XZMA 2OCGA 4Z49A 3BF8A 1BROA 3D59A 3TGLA 3FLAA 4FFWA 1QFSA 1WM1A 1XFDA 2XDWA 1XLUA 2RHTA 5JD5A 4X92A 4FNMA 4KYVA 3WL6A 2I03A 3VKFA 3AZOA 1BU8A 5ALDA 4ARAA 2WLSA 5JZ9A 1OILA 4EY6A 3F96A 4XIIA 4X6XA 4RE6A 4DNOA 1HBJA 1VA4A 4AB1A 4EHBA 2XUDA 1VKHA 3ZI7A 5E4YA 4OB8A 5HF6A 2IIVA 2O7VA 5KBYA 3A6ZA 5K3BA 3GA7A 1A8UA 3D5EA 2HADA 3ICVA 1XZIA 3WYNA 5AK5A 1NU8A 2XUQA 5EHQA 2YYSA 2ZJ6A 4OD0A 2XMBA 2CUTA 4H7FA 5C8VA 4NZZA 1UK7A 3RKSA 1UK6A 1ACLA 3V1MA 3F8SA 4FMPA 2CEKA 4MJ3A 3QPAA 1M33A 1E5TA 1UFOA 3K9BA 4AO8A 5JAOA 5LKAA 2BGNA 1UKBA 1XRMA 1QONA 1YR2A 2ZJFA 4Q1VA 1N5MA 1LZKA 4Y9SA 4WY8A 3QZUA 4AQDA 1W4LA 2Y6UA 2B61A 2QKYA 2DR0A 4DNPA 1VE6A 3K2IA 4P9NA 3AILA 4KE6A 2ONCA 1B41A 1E8NA 5ALVA 1H2XA 4G4GA 1AKNA 5EGNA 3DOIA 4L72A 2H7YA 4BTLA 2JEYA 4C88A 2I78A 3I1IA 2HA3A 3C8HA 1QIJA 1U8EA 2WG0A 4BCDA 3QITA 4KJXA 4D9JA 4BVKA 1R50A 1K4YA 2QR5A 4MWTA 1CUJA 3R0VA 1THTA 4CG3A 1C7JA 1EK2A 3O4HA 1A8QA 4K6GA 4WDRA 3WKCA 1BEZA 1XZCA 3ZLVA 5ALUA 1BCSA 3M83A 2HU7A 4RE5A 2ROQA 1YAJA 4KACA 3EIOA 3MVEA 3NOXA 3VDXA 3HZOA 5DYYA 2RGUA 4UBOA 5BOVA 4ETWA 2NW6A 5JASA 1BEEA 1TCCA 1EK1A 5IVIA 2QMQA 3AIOA 4J0IA 3U1TA 2XUIA 3H1AA 2PBLA 3DDUA 3G9UA 5AIBA 3FWHA 1VJ5A 2HM7A 2CZQA 4Y2YA 1H22A 2WILA 2HIHA 3U0VA 1FSSA 1CUGA 1R1DA 5H3HA 4Q05A 2J3DA 4C6HA 3S8YA 3TEJA 3FYUA 2CMFA 1XQWA 1MO2A 3ZLTA 4A16A 3STVA 4UFPA 1J07A 4J0DA 4CFSA 4Q3KA 1S8OA 5CH5A 3PUHA 3ZV7A 4BZWA 3I6ZA 2HU8A 1P0QA 5AKLA 3C5WP 4LXIA 4B0PA 1E66A 2XMCA 3O4JA 1EVEA 5CTAA 2PSEA 3FAKA 4X97A 3LCRA 5AM1A 5F4ZA 5AKJA 5FXMA 3FNBA 3JWEA 1FFCA 3D2BA 3H17A 1IVYA 1QE3A 2WM2A 4EY8A 5ALYA 2WHPB 1JMYA 2AJLI 3P2MA 3X3HA 4Y2SA 2XQFA 4ZGBA 3C6ZA 1XZBA 1HPLA 5JAUA 5JZSA 4CG2A 5LYYA 4Y2VA 1LPSA 4BE9A 3V9AA 2HA6A 1YSCA 4M0MA 3PFCA 5ALLA 1U65A 1P0MA 5D3KA 4LIPD 4KE9A 2XUKA 5AICA 5AH0A 1IMJA 3O4IA 1EDEA 5EIHA 4AN0A 1WCYA 1G5FA 3IVMA 2C4HA 2WUDA 2Z3WA 5I7UA 3ZWQA 2JF0A 4DMHA 4FFVA 1QFMA 3H19A 3C6XA 3E4DA 5E2IA 2XT0A 4IO0A 1F8UA 2OCIA 1DX6A 4ROTA 1ORVA 4S0XA 5AKIA 4QA9A 5JADA 3EQ8A 3BJMA 2BUBA 3AUKA 5FRDA 4A5SA 3GELA 3L1HA 1LGYA 3FSGD 5AJHA 4FDMA 1MNAA 4QDTA 4Y2QA 3W9BA 4H7EA 4JH0A 5HK9A 1XRLA 3AJAA 2PM8A 1QTIA 2JGLA 1MT3A 4BAGA 4EY4A 3WWEA 3H04A 4PNZA 3QBJA 3R3UA 3DYIA 1AUOA 2PSDA 4GHWA 2J4CA 1A8SA 3WK4A 2J4FA 2VJBA 3SC2A 4UHEA 1MX5A 3FVTA 4DSZA 3AZPA 2GBGA 4X6UA 3IUQA 2OQVA 2XUFA 3V1KA 4H7HA 3PUIA 5T4HA 2WJ4A 5JZBA 1DU4A 4P93A 2AJCA 2AXEA 4LKOA 2X5XA 3UUEA 1QLWA 3KDAA 3S2ZA 3F98A 4EUSA 2VAVA 1DWQA 1Y37A 3WKDA 1JI3A 3HLKA 4GXNA 2BJHA 1DT5A 2HDWA 5FUMA 1U2EA 5CXXA 2BKLA 1MX9A 2WFLB 3WKBA 1XZKA 4B6GA 2XMZA 4KAFA 3I2GA 1R9MA 2QXUA 4L0CA 3W05A 1Y7IA 4G4IA 5HF8A 3H2HA 3DLTA 3BL8A 1ZOIA 1GPKA 1AZWA 2BUAA 2EDCA 2R11A 2O7RA 1XRPA 1HQDA 5LP1A 1IZ8A 2X76A 4G9EA 2WU3A 5C8XA 5CT4A 5BV7A 5E4JA 2LIPA 4K6HA 2G4LA 3AZQA 5AIAA 2WJ3A 5AM3A 1J1IA 1XLWA 1CV2A 3CN7A 2RHWA 2ZVDA 5JYCA 1MNQA 4X94A 2JGIA 4OU5A 4X6YA 5SYNA 1H2WA 2XMQA 3A70A 1D07A 1IUPA 5T4BA 2V98A 1RWQA 4AO7A 2WHPA 4FWBA 1ACJA 4RNCA 1CUVA 2PKYX 3FSGA 3ILSA 4J7AA 4PV7A 3WL5A 4IH9A 2DSNA 4QWWA 1C4XA 3STYA 4BTVA 1XLVA 1CIJA 2XQIA 3DKKA 3R3WA 2WQZA 4Q82A 5DWDA 4M0FA 3WZLA 3W06A 2QRUA 2WJ6A 4UPDA 3OOSA 4H7JA 3GROA 4WDQA 2FUKA 4UBNA 5A7HA 5ALZA 3LS2A 3RARA 1TAHA 1O6GA 3N0TA 4C01A 1MAAA 3STWA 5JAHA 1VA5A 3MUNA 2XMSA 4UFOA 3KXPA 4IQ4A 2EDAA 2ACEA 3DS8A 1EA5A 1G4HA 1JU3A 1UT6A 2PVSA 1H2ZA 3I2JA 2QUBA 1XZDA 2GBIA 1DWOA 1EDDA 5ALHA 2Y2VA 4P08A 5C8ZA 2EEPA 1AC5A 1WPXA 2WIJA 4CIBA 3G02A 3G9ZA 4DNFA 2ZYIA 4JUIA 3IUJA 3MUOA 2YH2A 3VVLA 2I3ZA 4A23A 3H0CA 3C87A 4OYYA 4BRZA 5IH7A 4ARBA 3R3YA 5HKBA 1GPNA 1CUDA 2RIPA 4EY5A 3A2MA 5AI9A 5AI0A 1L7AA 1YB6A 4UBJA 3WL8A 5AKYA 1ODCA 1HKHA 4KR0A 2WTMA 4EZIA 2GZSA 4J3JA 5IKXA 2Y6VA 3KWJA 3QVMA 1ODTC 3BDVA 4H35A 2ZSHA 1QIKA 1Q84A 4BATA 4B84A 1AGYA 4OPMA 3I2HA 5CRIA 1K6EA 1ODSA 4JEIA 1K8QA 3JW8A 5AI5A 4C87A 1BRTA 2GYVA 3H2KA 1HDEA 3PE6A 4Y2JA 1CR6A 3BJRA 1LZLA 1EX9A 4BP9A 4WJLA 1ZJ5A 3RLIA 2ZYHA 3C6BA 4FLMA 4Y2TA 2WFZA 3T52A 3RM3A 4W1QA 4E15A 4GLBA 4BE4A 2P8SA 4QDOA 5DYWA 1UKAA 2G5TA 1DQZA 1VXRA 3WIOA 3FLEA 2JGJA 5HK8A 2QJRA 1CUAA 4EA6A 2XUAA 3I28A 2AJ8A 3I6YA 5HFAA 5CT9A 1BS9A 1QJ4A 1W75A 2JIDA 2ZYRA 3D3NA 5ALOA 5LIPA 4OB7A 2V9ZA 1N8SA 4H77A 3V1NA 3KWFA 2WIKA 3NUZA 1QIEA 3EF3A 4CCWA 2BAGA 4HXFB 4HAIA 4OUKX 5EHNA 5C7YA 4NS4A 3CN9A 4DGQA 2C7BA 5AK6A 3IUMA 1MU0A 2BCEA 2OLEA 3AINA 5AI4A 2HA4A 3VVMA 4DLNA 4XJVA 2QTBA 3H2JA 2K2QB 4KE7A 1FFBA 1JT2A 1CLEA 4HS9A 4V2IA 1F0NA 1Q0RA 1BE0A 1FFAA 3W2TA 3H1BA 3LIIA 2PPLA 2Q0XA 1O6FA 3EBLA 2XMRA 4I4CA 1WHSA 3TRDA 3E0XA 5CH3A 2DHCA 1MTZA 1YS2X 3HYSA 1CUUA 2D5LA 4UHFA 5D3ZA 4LHEA 1CUEA 4FNGA 1QIFA 5ALSA 2OAGA 4X00A 1AX9A 3FOBA 5AM4A 3D4LA 5AKGA 5E4TA 3K6KA 5LLSA 3CCCA 2VEOA 3Q0TA 1LNSA 4J0HA 1BN7A 2WFMA 4DIUA 5FP0A 4QLAA 3KD2A 4UBLA 1EB9A 3TJMA 4E14A 3WA6A 4UUQA 2QJWA 4J0JA 5D6OA 1Y7HA 5ESRA 1JJIA 2G5PA 4DMFA 3ESAA 3WMRA 1AQLA 2OG1A 5A62A 4OCZA 4HZGA 2PX6A 4TVKA 5JARA 1EINA 1TCBA 3WWPA 4PSUA 1ZD2P 4Q3LA 4FTWA 4N8DA 4Y2UA 3NGMA 2ZSIA 4DTCA 1H23A 2B4KA 2H7XA 4KRYA 2CB9A 3GZJA 1CEXA 3STTA 4PF1A 5AKKA 3HXKA 2D0DA 1QIIA 5EI5A 5ALIA 2CBGA 5D7BA 2XE4A 1R4ZA 4IH1A 1FJ2A 3WK8A 2QM0A 4K2AA 1JMKC 5FLKA 3C5VA 4GI1A 3I2FA 4DM7A 2O2GA 1LPMA 3WQHA 3D0KA 2JGKA 2JGFA 4WCVA 3VJLA 1VLQA 2IX9A 3R3VA 2FJPA 2RONA 3R3ZA 4JNCA 5HF5A 4B81A 2HA5A 2VAXA 1GKKA 5EHZA 3FYUB 2Z8ZA 4PSCA 5JANA 3UUFA 4UBMA 2I3DA 5AKZA 1FFDA 1JJBA 1OCEA 3OC0A 4MWSA 3WK6A 2H9YA 4DNQA 1W6RA 4AO6A 3BIWA 4AZ3A 4UHHA 1LPBB 4QLOA 2BUCA 4BB0A 1BN6A 5YASA 5CH8A 3WJ2A 2VJDA 1JKMA 4G9GA 5LZ8A 1SCKA 3PI6A 4BVJA 4EY7A 1AMNA 1UZAA 3H2GA 3G0GA 2WUFA 3IDAA 2ES4A 3DYVA 4F21A 4O08A 4QZVA 5AM2A 2C0PA 3G9TA 2ZJ7A 5I9IA 3O4GA 1CQWA 5BWCA 1EH5A 2QUAA 3WJ1A 3IURA 2E3JA 3HRHA 1UXOA 3QM1A 4W9RA 3BXPA 1DT3A 3WWCA 4Y2XA 5LZ4A 2XMDA 3C43A 3BIXA 5AI8A 3A2NA 5T4EA 3ANTA 4ITVA 3F9CA 4YX9A 5ALFA 1X2EA 2OGZA 4CG1A 4KE8A 3HACA 1E8DA 4UBKA 3I2KA 4ZI5A 1CVLA 1W76A 2PUJA 2HL6A 1CUIA 1ZJ4A 4JYPA 3EQ7A 1QO9A 4QDUA 4QNNA 1UK8A 2WIDA 3BWXA 1UK9A 5K3EA 3AIKA 3D2AA 1DTEA 1LBSA 4AZ0A 5LZ7A 4LYEA 4WY5A 1XZLA 4UBIA 2W6CX 2RAUA 1WB4A 2GYUA 4MYDA 2OCKA 2W22A 4IH4A 5LZ2A 5AKEA 5A7GA 5T4FA 5AOCA 1ZD3A 1SCIA 1VZ2A 2WSLA 5K3AA 1DQYA 3FVRA 4YK7A 4C4YA 5AI6A 3B12A 1ORWA 2BGRA 4BDTA 3WK9A 1PFQA 1J2EA 1QTRA 1VOTA 4C89A 5AK4A 3O95A 5K3FA 4L9AA 1HL7A 3IIIA 4QE3A 2VT7A 2ORYA 1BCRA 4ZV7A 3DKRA 4DSAA 2O2IA 2DHDA 3WWDA 7YASA 3DEAA 2G63A 3HC7A 5DLPA 2QS9A 2XUGA 3H18A 4H7DA 4BZZA 4DMCA 1JU4A 4XX1A 4KRXA 3WYDA 1UOPA 4B82A 1WB5A 4X3CA 1L7QA 1CRLA 1I6WA 4KEAA 4LXGA 1UOOA 1FFEA 2VF2A 3VJKA 4W1RA 1KU6A 1E8MA 3MGAA 3C45A 4UHBA 1WOMA 2V97A 1OXMA 3DJYA 1ZD5A 4HRYA 2PU5A 3STXA 2OAEA 2DFPA 4BAZA 1LPNA 5KWJA 2ECFA 3OG9A 1ZIYA 5JATA 4MEBA 1YA8A 3QMVA 1QIHA 3C70A 5K3CA 3E3AA 1T4MA 3KSRA 4M0EA 4CI9A 1WHTA 1YS1X 1XQYA 2XQGA 2IITA 2PUHA 1JFRA 1GKLA 1UKCA 2RI6A 4H18A 3NWOA 1P0IA 2HA0A 1YCDA 4W1PA 5CT6A 2Y2UA 2Z8XA 2XMGA 4N5HX 5ALPA 3HABA 4F60A 3QPCA 2PSFA 5KWIA 1LPAB 5DJ5A 2GYWA 1XRRA 4UFNA 4N5IX 4B83A 3IB3A 1TCAA 3HSSA 3PDCA 3WLAA 4W63A 4K5QA 1GPLA 2YXPX 4X71A 1IUOA 5ISMA 4PQEA 4HTAA 3CXUA 4J03A 1ZGCA 3ED1A 1XZGA 3LIPA 1A88A 2XUPA 4IHAA 1EVQA 5IVKA 5CT8A 3QH4A 2JGMA 3OTQA 2HA2A 4BRSA 1YB7A 1QIGA 3IBTA 2DCMA 1HLGA 1DINA 3B5EA 5ALTA 3HEAA 1CUHA 1IZ7A 2BFNA 1R9NA 3DCNA 1TQHA 3ESBA 1QIMA 2JGEA 3B3QA 4MYSA 4CIAA 5ALKA 1QOZA 5AM5A 1QIDA 5HKAA 1TIBA 2JBWA 1U4NA 1SCQA 4YASA 4G8CA 4GBGA 5LZ5A 4TGLA 5SYMA 2V96A 1E89A 1XQVA 3LP5A 4TPKA 2OXEA 4OU4A 3ESCA 3QMWA 5AO9A 4AX4A 2WG1A 2JEZA 1LPPA
chains in the Genus database with same CATH superfamily
1MN6A 2B1IA 4YDRA 1FDTA 1O97D 2NU8B 1I6KA 4L50A 3DBLB 5GZ6A 3IAS1 1P4RA 2NTNA 2OP0A 4OOEA 5KJEA 5EIWA 2BDUA 4Y6QA 1LBTA 5LNK6 2QZ4A 2O2HA 3HN6A 2G5GX 1TRHA 3CZRA 1GAWA 3NTOA 4UULA 1PVVA 3DMGA 5KPJA 3RU9A 1QPGA 1SU4A 4KDRA 4B85A 3A6JA 2VHWA 4N8SA 1Z2AA 1GQRA 2FSSA 2C5AA 5TPWB 1P5HA 4B3TB 3NOQA 4DA0A 3L7DA 3KTAB 1EFRA 1L7MA 3EQ2A 3M5WA 5MN6A 1L2TA 4GH5A 2C07A 4WINA 3ZQ4A 4Z4CA 3WL7A 5EXDA 4X0EA 1LVHA 1V1RB 3NHPA 1CUFA 3VR0A 4BC0A 1D2EA 3PLNA 4LMAA 5FKJA 4CMGA 1V3UA 2SKEA 3UHAA 4TWRA 2OUKA 3L0DA 1R9JA 3C8UA 3A4IA 4O4IB 4E51A 5MN4A 1GLVA 1P17A 2D4AA 5HJEA 5TS2A 1N0VC 3AUSA 4GPEA 4K2HA 1JAHA 1GDDA 2ZTHA 4JJ4A 4ZHQF 5A4MS 2J3IA 5B3LA 1FJGB 3HDYA 1MO6A 1V5FA 1KQNA 2ODAA 3BB4A 3NATA 4LYHA 3MBOA 4K9DA 1N2ZA 1NI3A 2QLFA 1WZNA 3IJRA 1OUMA 1D8TA 1DDGA 1XB2A 1CQXA 2GYYA 3H7IA 4KBYA 1N9KA 1RSZA 4C4SA 3N6XA 4C0HA 4EPYA 2CJPA 4U63A 3ZHBA 1FU7A 3PHLA 1OFHA 1QO0D 3ZV4A 1MAUA 2YINC 4ZAFA 1UAAA 4ZODA 5AUQA 1RBQA 4J90A 1A8IA 1JEYB 1LTQA 3AVYA 5BN3B 1M8JA 2ADOA 1XROA 3A3NA 5DRYA 2ZM5A 4G67A 1PQ4A 5ELMA 5KX5A 2YZNA 1GUZA 2A9OA 3H5WA 4LXQA 4U3JA 4B7CA 2FDRA 1TQ6A 3L8GA 1NUAA 5CDFA 4Y1RA 3Q2KA 4KAAA 4O4HB 3JS5A 1AV7A 4O2RA 4I5EA 5ER9A 3PA8A 4HAZA 3SKYA 4F1KA 2H7VA 1LK0A 5G3YA 4TTSA 1VYUA 2IYSA 5I5GA 1FFSA 3WGIA 4WA8A 3OU7A 3H99A 4R3WA 3OT1B 3SJZA 1T2NA 2N1MA 1UPXA 1LI4A 2WRZA 3HYNA 3VR5H 1N4AA 5REQB 4C4PA 3T5PA 1R0RE 2J6HA 1W6UA 1GTVA 4QUDA 3PICA 3F97A 3WLQA 1OFTA 2EJCA 2PFKA 1SC4A 2YYAA 5AK0A 3VHRA 5BUSA 1YGPA 1L4HA 4LOIA 4LGMA 4GM1A 2Q49A 3S1SA 2ZIAA 1MHPA 3RYTC 1H6BA 1RRGA 1NW6A 2MYUA 1Y8CA 4FMDB 5K0JA 4J0KA 3TSWA 4EG6A 3GVIA 3DE2X 1T9CA 1GSOA 4KVAA 5LB4A 5IUJC 1X14A 1O95C 3AFHA 4X7BA 3H2IA 3H87A 2QNIA 3S70A 1N3YA 1NXPA 2MSKA 1QLJA 4JYMA 4UMEA 5FOXA 2O7SA 1N1DA 2VHTA 1E4YA 1ZJJA 4DLVA 3EOAI 5KVSA 5LLDA 3CVVA 1YDEA 4D9BA 1DBIA 3K2EA 5CT5A 3CX7A 1CZUA 1YU9A 3D2CA 2WP0A 1JF8A 3FGOA 1XMVA 4GW3A 1UPAA 4RK6A 4W8GA 5LXTF 3ONFA 1LU9A 1Z2NX 4MA0A 4YP9A 2WIFA 3NEAA 4GOLD 4TQGA 2HFKA 1POXA 3HB5X 3FYUC 1JMVA 3NVDA 2HPVA 3BGSA 4FSXA 4AUNA 5I6DA 4GR5A 5J4LA 3IUYA 1ORIA 5IAOA 2V8OA 1CJUC 2RAVA 2CB0A 3OEYA 1QV7A 4H4EA 3ZQUA 4G0WA 1QHHB 3AYZB 4JQOA 5JAIA 3TW8B 2ODTX 3MWYW 3ND9A 3RS3A 3PF8A 5EN4A 3G88A 5JAPA 1Y0BA 3QSYA 4HLUC 4KUGA 1IQUA 5ARCA 3FTFA 1Z38A 3E3NA 4PZZA 4EQZA 3MWJA 2OLKA 1ZICA 1O58A 1Q74A 1XKLA 4MI9A 2Z3ZA 3AUAA 3FFXA 5H02A 2QL7A 3U39A 1I2MA 2NZUG 4QJBA 5FUVA 4BPRA 4F0JA 1OH8A 4ZQEA 5I7FA 2BN4A 3GZNA 2R44A 3DBOB 3MTIA 1UBMS 4F6RA 3NHFA 2H51A 4Q3OA 1JEEA 2D7JA 5TT0A 1K7YA 1V1RA 2CHQA 2EP5A 2HBZA 2JCSA 2WNHA 3FJYA 3GT3A 3S28A 1I7QB 3B2EA 4IY1A 1MEEA 4BFSA 5JLJA 4M38A 2A5DA 3DFIA 2WG2A 1HURA 2QLNA 4MRNA 3KTAA 2HRQA 2QQEA 4QG3A 5KOHA 4QEKA 3AIMA 4CUJA 2AG8A 2D1RA 4UU0A 2CVHA 2ZIXA 1WNTA 4PC3A 1C9YA 5CFRA 4KXYA 1T1JA 2F9LA 2BKXA 3MJ4A 1VE7A 3TLMA 3UMYA 1HRKA 4HXEB 2L42A 1SC9A 3TL3A 4ARZB 4B43A 2ENUA 1Z4IA 1S2OA 2C5FA 2ZBRA 5A06A 1DRUA 1T13A 3ZHQA 2EL9A 5CAEB 3GEMA 3OIVA 2OL4A 3JQFC 4YJ3F 4ER3A 3V2HA 3OF5A 3MT7A 4HF7A 1QRTA 1ZCZA 1KVRA 1XZAA 2VTVA 4RPGA 2FSHA 1ZD1A 4P3OA 4WESA 4BUJA 1DIRA 1Q92A 4RK5A 2R8PA 1FUIA 4MKFA 3FSJX 2WJIA 3D8RA 3ZE9A 3ZWYA 2FZGA 2OORC 1HKUA 2OM6A 2V3WA 3T3GA 3O9MA 5B3JC 1E5LA 4F86A 5AW3A 2FXVA 4MOWA 1Y3DE 3W3AH 3OQ6A 1ACMA 3ZE6A 4FM9A 5IC5A 4HMOA 4IFIA 5KTKA 1DHTA 1IHUA 4IP0A 3TNJA 4GL2A 1COZA 3FUWA 3ZE1B 3BXZA 1XA0A 5KREA 2XA9A 1Y8QA 4IQFA 5HTKA 1IZZA 4PBRA 2RHHA 3LBAA 3O93A 5MGBA 1YB1A 1GR0A 1H42A 4S0ZA 2GEFA 3WK7A 3H9BA 4RQTA 4ZXFA 1CUYA 3H97A 1KEWA 3PENA 3WMXA 2Z4RA 1M7BA 1MQ9A 5ITZB 4TYNA 3BB1A 3A25A 2A5GA 2V3VA 4RV4A 4KPFC 4CIXA 2DKNA 3D4PA 4BFUA 3VTAA 3HKCB 3OURA 3NCTA 3W1VA 5CPBA 2VP5A 3QKWA 2PL5A 1IN8A 4E5NA 3A1UA 4PICA 2R1UA 5FUWA 3PKZA 2VPYA 3PL1A 5FPPA 3K53A 4PGAA 3W9UA 3IFSA 1E3DA 4C2AA 1IPFA 2GCIA 4CEHA 3VR1A 3BRWD 1WPRA 4D44A 2Q1SA 3JD2A 5BXYA 3RRZA 3GGJA 1FP4A 1Z39A 4DL9A 4ZOQI 2VP3A 4XW2A 5FPHA 4MUAA 4EBBA 5E1DA 2ZUTA 3CNEA 3ZLBA 3HXOA 3AF0A 1FYFA 3K35A 1EX1A 2Y3IA 3RAFC 2ZZNA 2AKYA 4OA5A 2FZCA 4P32A 5CXUA 3BMQA 5CLJA 3LUDA 4MYRA 3W8NA 1GPJA 4XWGA 2IY7A 3N8IA 4Y18A 2MSNA 5JD4A 2OD2A 1TT5B 2O05A 1QHNA 2IPXA 1TO1E 2O8DA 1GZ3A 2C7RA 4ZI7B 2P9BA 4JASB 5FNVB 2FU5C 2AWOA 2J6BA 3JD1A 3C24A 4I3FA 3OQJA 1J4AA 1U5AA 2GOYA 2YCBA 3NAQA 4IL5A 4PSVA 1CZKA 2W37A 1WZIA 5T8KC 2C1XA 5IUNC 5HQ3B 3UPUA 1HYBA 1TT7A 1OJLA 2B99A 4HNHA 4MV9A 2FQWA 4U2FA 1ENYA 3C15C 3MAGA 4IHJA 4LQDA 3O1IC 3ZQKA 1CUWA 1IM5A 1YULA 2H7CA 3MMSA 5JIBA 1ODLA 1GGVA 1ZSNA 3GFFA 3VMFA 2ERXA 4DANA 3PXAA 3H9EO 4FPXA 4X5OA 5DSTA 1XDUA 4BNTA 3VO9A 1GSIA 1OVGA 4EAQA 5LOVB 2NSJA 1CF2O 3NHKA 2OUIA 3FMOB 1VPDA 5CA0B 1FU4A 2GM9A 4L5IA 4COOA 1ZRMA 2WFLA 3C14C 1M5UA 2IXEA 3WLEA 3DT6A 3HCAA 3PQ3A 5HCNA 3FDJA 3UW3A 2Q3EA 4BNLA 4HUQA 3G23A 1YA4A 2YJ6A 3FNQA 3GJSA 3KOZA 4S12A 1Z62A 3T41A 1HSZA 3L0YA 1G8KA 4NV3A 4A03A 4NE2A 4E33A 1OASA 3FYSA 4LJYA 2EYUA 4MUHA 4YYZA 3UG6A 1EDBA 3RVPA 3M6UA 5AYVA 4I8DA 5CB4B 2I22A 3BMQB 2JCYA 1SN7A 4ZKEA 1ZAKA 3MILA 5IW8A 2ZBDA 1Z4KA 2XRYA 1RU3A 1RQPA 1SWWA 3R2JA 3P9PA 4G24A 2OMEA 4X90A 3WNBA 4BAUA 1G5PA 3FRHA 5CYPA 3VYWA 1L6RA 1J06A 1Z5ZA 1HNZB 4EW2A 3CQ9A 3LUBA 4J76A 2ATEA 1SKUA 1ST3A 3HNOA 2PRKA 2WU4A 3AXTA 3IDFA 5GPBA 4B3CA 4JR0A 2F3SA 2R8YA 2EX0A 5EE1A 1ZGJA 5EJEA 1XZHA 3M1IA 3RTAA 3KBOA 3TOVA 2RGRA 5B55A 4NP6A 4BJ5A 1QH9A 2IH4A 1KFEB 4A9AA 3ON5A 1V35A 3LYUA 4AYWA 4OOFA 5CFQA 1KOFA 4FHGA 4Q19A 3R6GA 2G06A 4OHUA 4EMBA 4U2EA 1Q11A 2RCNA 3G7NA 2YXBA 4ZT4A 1NE2A 3LVQE 5EHXA 1XCPA 3CEHA 1JFVA 3NWBA 4DCVA 1EHYA 1RYBA 3KYDA 1JDZA 4GOJA 4DSTA 2CYBA 2EFYA 3TW4A 2XUHA 3AF2A 5JQWA 3VMMA 2A5LA 2OGTA 3PE3A 3H0EA 3WAGA 1ZI8A 4LGVA 1Z68A 4L76A 2EKQA 2ZE6A 4I9NA 4CCYB 3BX1A 3LWBA 3S7TA 3JYHA 4LRUA 1E5XA 3LPAA 5B5SA 1K1EA 1NX6A 2NUAA 4PPNA 4V0QA 1CZOA 2G04A 1R3DA 1BFDA 5HIKA 1GNTA 3EXHB 4LI3X 2O50A 2HZBA 3K8QA 1JILA 3N5KA 5CNJA 2WWWA 1E0SA 1JVSA 3HDTA 2JLWA 2P4QA 4BBPA 5IFKA 5AK3A 1IY1A 5BUZA 4M76B 4W6QA 5EP3A 3DZJA 1J2YA 3EXFA 3H84A 1J8YF 1R2QA 2QX4A 4XCXA 2VWGA 3VR2A 3I9KA 2QVGA 3F74A 3KWLA 3J80A 1RYMA 3FNGA 4QGHA 1PFUA 4CEJB 3VR4A 4D0NA 4F93B 2M1ZA 4BGEA 1E0JA 1MAHA 3DMDA 3L92A 1EXWA 1X7XA 3ISVA 2CJYA 3U37A 1DDIA 2YMPA 3CUYA 1CS0B 1TJ5A 4K9KA 1CF9A 2HFJA 2A7XA 2GSDA 4AY6A 3MWEB 3EA0A 3IAAA 5HM6A 2FVYA 1N5JA 3EGVA 3WKAA 4JP8A 1WBBA 1MABB 1V5GA 5FPTA 5DT2A 2F17A 4ZWNA 2IIBA 2AJBA 4I1OA 2X4GA 4TKUB 1MOPA 5ES3A 3HM2A 1OW3B 2GHRA 3I3SR 2GBLC 3AY3A 3U40A 1BE6A 2XGMA 5IAGA 1BFKA 1XQXA 1E7SA 3KEQA 4KHPB 1U5BB 4U0JA 3CX3A 4KOAA 5FT9A 2QT1A 3PGJA 1HQYE 4B80A 1JJFA 2C1EA 4CMEA 1LLFA 2JCXA 1DEKA 1F0PA 2C9CA 2B8WA 3H8VA 1DAEA 2GPNA 5FFFA 2PQ0A 1IPHA 1DHRA 2H1IA 4FQ8A 4MIYA 4Y6RA 3EZFA 3Q6MA 5B6JA 5BSVA 2GD2A 1Z5WA 4BUZA 1YHNA 3LQQA 2XX3A 4L8WB 4O4IF 5B1SA 4EVRA 2PRIA 4MUKA 5I01A 9MHTA 1D1QA 1TCUA 4JKYA 4YTEA 4HLQB 4YV2A 4N47A 3MWGA 2XGJA 1IATA 1SMKA 1U1FA 2M32A 3ZBTA 3HXTA 1PGQA 2PLRA 4TVSA 3A8TA 3RSOA 4EGQA 3OM8A 4UTXA 5JWRA 2DHEA 3BS4A 2RE8A 4US1R 4RBNA 4D8XA 4OFWA 3WADA 1UJ4A 1AURA 2ZRKA 3V48A 2J31A 4M7RA 1LK7A 4AZVA 1N36B 1WCIA 3I9MA 3UMRA 2AZ4A 1H0KA 3SYRA 2W6JD 1PFWA 1XVVA 4BXOA 1DBSA 3DMPA 1E3WB 5DNWA 1XZFA 3SC6A 4BCBA 4YPVA 4L6AA 3ZR4B 1Q1GA 1YKFA 3TOSA 3KCQA 1OXXK 3FCCA 1J22A 1SY7A 2XQVA 4Q3NA 2F8SA 1QYVA 1SVLA 1N3LA 2ZSDA 1T4CB 4QBHA 4XIGS 1B3RA 4OXYA 1X1CA 1I1QB 3W6OA 2QU8A 4MR8A 3ZY4A 2G77B 3MIIA 1AKYA 4IVPA 5B7NA 2H2FA 3IV9A 1J2TA 4FGSA 1YASA 3MW8A 4W5RA 3A2LA 4G1FA 3QVTA 3GZ4A 1IXSB 2J9FB 2HIGA 3DOOA 1YJ5A 4E1VA 1XEXB 1BJTA 1Q14A 5DU2A 2C7VA 1I0LA 1ZCAA 3JTMA 1REQA 5TQVA 1ZESA 4TVBA 2JJQA 4J0GA 3TM4A 3ESRA 4BV8A 3VXKA 1T3HA 1NQTA 3GP5A 2OSVA 4PN3A 1LC0A 5A6VA 1UXHA 2G36A 5EKDA 1FMCA 3UOAB 3VV3A 3W2HA 4RTSA 3VR5A 4B34A 4Q1EA 1D0IA 1AE1A 1N5RA 3BE6A 1UXJA 2E37A 2IHZA 2ODPA 4OL9A 3KQOA 1E6EA 4XM2A 3HU2A 4DDWA 4PNPA 3D7NA 3JYLA 4RSHA 3A7EA 1S2IA 1WPGA 3L0PA 4TTJA 3WO1A 5AHKA 5ILOA 1UF9A 5K9ZA 4GI2A 4ZU1X 2AFIE 3BSWA 1NBMA 4AZWA 1CRQA 1MFZA 5KNCA 4FGZA 1B16A 4RF4A 1BJRE 5FOTA 1DG9A 2BFCA 4Z9YA 3MG9A 3K1JA 2RGEA 1DL5A 4H3HB 2OEPA 4JMLA 2I6XA 2PX3A 3B53X 4FOTA 1IWPB 2OV6A 2H5JA 4ZOLA 2HK8A 4XSVA 1CYDA 2HU5A 1G20E 1H93A 4MW4A 3BTUA 3VPDA 2PMDA 1N6IA 3HU3A 4XDHA 7MHTA 1RZVA 3P9XA 2VAWA 3RRMA 3IAM1 1ISIA 3QELB 1IH8A 1LPOA 4M7PA 1CUBA 3CU5A 4EITA 2WYVA 3WI7A 5EJ6A 2XNSA 1IK4A 4UHDA 2M98A 3GBSA 5BWBA 1T2UA 2NIPA 1ULUA 1WS6A 1WCXA 3O0DA 3T7IA 3C6YA 2QMYA 4H6XA 4LY6A 2YFYA 1A2KC 1BXRA 4WFIA 1KRXA 1PD1A 3KBBA 1JQDA 4UVDA 4Y2RA 3BYZA 1UDRA 5ALQA 2X8BA 4DIBA 1JIQA 1JG2A 4RZ3A 4L0DA 4CF3A 2FPKA 3LL4A 1KQ3A 1SVUA 2ZUCA 4PHHA 4ZQHA 5G02A 2B9VA 4E3WA 3IUPA 1V3TA 4UM9D 5D84A 4V0MA 4UASA 5J5AA 4INZA 4RWEA 2P4HX 4WGFA 3NT2A 5ALGA 4C6TA 3H9CA 5JD6A 4G5FA 5FWNA 2OO7A 4UMVA 5GTDA 3V8VA 4BVLA 3MS2A 1EFPB 1KI6A 1P80A 1SHJA 1T4GA 1VB3A 3SXJA 3WL3A 3I39X 4C0QC 5I7EA 2FF5A 4RNDB 3FCEA 2MJLA 1YAHA 1Z8FA 2MSCB 2ZUWA 3H5TA 2QWXA 3OHPA 4B4DA 1ZIOA 2YDYA 4ARCA 1J20A 2EBFX 4F6RB 5AW6A 1KMCA 3TGLA 4IFTA 2EP7A 1P8AA 2B5WA 1E96A 3RO7A 1UWKA 2FWPA 1QZUA 5U4XA 1NAIA 2IYPA 3AEYA 4A5OA 2RK4A 4D9IA 1P4HA 3AH8A 1M2EA 4UUOA 2I0FA 3BH0A 3NUQA 4LOHA 3SIPA 1X9HA 1WM1A 1G8SA 5BN5B 3U56A 3FB1A 4Y6OA 3U13A 2NPOA 2XDWA 3VI3B 1VKRA 4DILA 2JKYA 5C51B 1U7TA 3D6AA 3LC0A 5FA8A 1RKQA 3IMKA 4TS4A 3VPBA 2GVDC 5DGCA 1JPUA 2O06A 3IP8A 5KDOA 3EUAA 3M7IA 3GEDA 1JEJA 1NJ1A 5FF9A 2BGWA 2Z5FA 1FNSA 4OFXA 1BU8A 2WVAA 5ALDA 1X8JA 3AESA 3FD8A 3N6RA 4KKVA 1OILA 2W98A 2ZRNA 3NBZC 4XEHA 2EAUA 3NM4A 4HJXA 5CA1A 4QQKA 4CLDA 1X7DA 1NLYA 5GOTA 2P3SA 4Y9TA 5DCUA 1DBPA 3PUYA 4MQBA 4CBVA 1F2VA 3EVFA 2WZCA 2IW1A 3P9ZA 4AROA 4CHGA 1DFGA 2X8LA 4TT8A 1VA4A 1PT6A 5EIOA 1JPNA 2NV2B 3D8HA 4HPXB 3HEMA 1A9TA 2YY6A 1VKHA 1UBHS 2AX3A 3T1OA 1G291 4P22A 3CW9A 1F7UA 1VG0B 5E4YA 4RX1A 3JATA 2GXUA 2OILA 4KLAA 1NKVA 1JV2B 1OA0A 5HF6A 3SKXA 3Q3JB 4L9WA 2P9HA 4DCSA 1E4EA 2IIVA 1Y5RA 3OZXA 4JCOA 3P2EA 1M2KA 2IHYA 2IVFA 2D06A 2R6DA 4N01A 3FTEA 4HMPA 4NJMB 2C5HA 3UWSA 4LY9A 3HVIA 3IVCA 3TG2A 4Z53A 1ZN9A 5BN4B 2WZQA 3ZWCA 3KC2A 1KDOA 2HMWA 4WK6A 5AXCA 2ZRQA 4DQVA 1P1KA 3NCHA 2WZDA 4QPNA 1T0JB 2CUNA 5HVNA 1JDBB 5F73A 2XRFA 4WCFB 3IVXA 4V0SA 1NU8A 2GN1A 4YBZA 1Z5UA 2E2WA 1WTCA 4IIBA 3N86A 4ZCSA 1GHTA 4A23A 3AY6A 3L46A 4AMUA 2FY8A 2PGXA 2XT6A 3CH4B 4GI3A 3ULKA 3EVDA 4IUYA 4WUVA 4DCJA 4Z7QB 3HUUA 4EKDA 3LT1A 4KMMA 2Q0SA 2G71A 1CY2A 4JOSA 1LCIA 3D1LA 4S05A 4QOHA 4TM8A 5JS6A 3AL2A 3HKEA 4R81A 3TVTA 5C8VA 1T5SA 4NZZA 2PZFA 2VPTA 3DVLA 4F84A 5HNKA 4S04A 4JMPA 3SM9A 2FOXA 2RBGA 1ZOPA 3AOEC 3EE6A 5B2EA 1OBFO 3TPCA 5I7SA 4GAEA 1SQFA 1ACLA 1ODFA 2WKQA 1OAAA 3SHWA 3FOZA 1DZ3A 1E7QA 4PQRA 5F12A 2J7PA 5EPUA 3D5QA 4MGEA 1IY2A 3QPAA 4AJNA 2ZRLA 5TX7A 5LDDC 3UA4A 4KPEC 3CVJA 3PJDA 2I7TA 3WNDA 1BA3A 4B47A 4AO8A 3W6PA 4QBFA 4PSKA 2I8LA 1K4MA 2QVYX 2BY4A 3HKBB 3VX3A 3WIDA 4BKQA 3G6WA 4BMYA 5LKAA 4ND1A 1LF0A 2WE7A 3WYFA 5KYKA 3E7XA 2GCOA 1NF3A 2FAXA 5FFNA 3GPLA 2ZJFA 3MXOA 3AIIA 1VHDA 3GV0A 4OY3A 3WDLA 5C1PA 3BIJA 2VVTA 5JD3A 3N58A 5A3VA 3H4MA 2QPTA 4M1SA 3TFOA 4ENQA 2I34A 3DV0B 3R7NA 3F6CA 1MVNA 4HC4A 2VWPA 4JIMA 3OQVA 2DBZA 2NOAA 2COUA 2WE8A 3F6RA 3KB2A 4BP3A 2DR0A 2Z6VA 4PC6A 1VE6A 1BHQ1 4GLFA 1YQXA 1CY8A 3K2IA 4CMBA 1ONSA 4KXMA 3WYEA 3DZKA 4K0RA 5CFMA 3WO0A 4K6MA 1B41A 2MMCA 1QQ7A 1H2XA 2EKPA 1AKNA 2ISCA 3DOIA 3F1LA 1PJ8A 4G4GA 4L72A 4UEKA 3L8ZA 2H7YA 4QTUB 4CQMD 1CG6A 4RK1A 2W2XA 5EQTA 4NYJR 5FTJA 3ICCA 3PR3A 1YL5A 1N2IA 1SUBA 3C8HA 1U9YA 2IZ0A 4NC9A 4KN5A 4L5JA 4B7UA 2Y1GA 1R0SA 1HTWA 4K8RB 2WG0A 4BCDA 4HB2A 1BMFA 3HL0A 3QITA 4D9JA 1X1SA 3PFKA 1I7SB 3KYJB 3ILYA 1IZYA 5HS4A 4TMYA 1GA4A 4HN9A 3N0XA 1X1BA 3BSFA 3WIEA 5KVAA 1THTA 3EHEA 4I9HA 2BF4A 4JLNA 1R8QA 2FB9A 5J9FA 1KYYA 1C7JA 1LDEA 1WXWA 2ONYA 2A9QA 5IKPA 3ZU4A 3GNQA 1O8BA 1EK2A 3LPMA 4I5IA 3O4HA 5J2UA 2FSGA 3VU9A 1Z3CA 3EVBA 1E6KA 3QBEA 1TFRA 1YS4A 1SVSA 3IKTA 1VLVA 1XZCA 4QL3A 1NDUA 2L2QA 3C2QA 1O3YA 1E2KA 1BCSA 3X2SA 3OZDA 2JI7A 3AERA 1Q0TA 2IUSA 3ZCVA 4KDCA 4DB2A 2FKAA 2CLMB 3FCUB 4X20A 1WUHS 3QWFA 5B12A 1ZOLA 4V3BA 1HQCA 3LTNC 2WIAA 3VAZA 4UPEA 4YR9A 3HKBA 4P34A 2IPMA 3QY9A 3PI7A 1V5EA 2VG8A 3VH2A 4D9FA 5BOVA 4YRNA 1FSGA 1NWHA 1U7DA 2NW6A 3LLVA 3PXXA 2XKAA 4FCCA 4CLOB 4K9QA 4UTNA 1EHIA 1HETA 1EK1A 3GRVA 3I72A 2W2PA 3P5SA 2QD2A 4WLVA 4AMBA 1JWBB 4CLXA 2WTXA 4ECAA 5C8DA 4OJKA 3DW1X 4DLZA 3OF3A 1R8SA 4EHNA 3AVVA 3KUKA 1QGOA 1YXMA 4B79A 2H3HA 2PBLA 1C7ZA 3DDUA 2X40A 5AIBA 1JHRA 1NONA 2L19A 1MJHA 4HB3A 4JJ6A 1K6IA 5UKDA 1AXGA 4UJ3A 2FG7C 4LRWA 4B8WA 2F3TA 5E7JA 4DG5A 2GN9A 2VSOA 2VHCA 3QFHA 4A2CA 4IUCS 2YIMA 3ITKA 1GNPA 4KOEC 2DFDA 4O5AA 3QLUA 2HIHA 4MNTA 3ZWWA 4B4VA 1GL6A 1YO6A 4U6NA 2QN7A 3NBYC 5BR1A 3JYOA 4YRPA 1CUGA 1JX6A 3LFUA 5AW2A 4JDUA 2X0IA 5JS1A 1VDZA 2TRSB 2ZJ4A 3VU8A 4MVYA 2A88A 1W7AA 3D1VA 4TL7A 1IJEA 5DGDA 3LD9A 4A4DA 3O75A 3Q11A 2OV3A 4HXYA 1YD7A 2QX6A 2CMFA 3GRPA 3TMYA 4KNYA 1MO2A 1SCAA 2G8LA 3ESXA 4YJ3A 3RTDA 3GCDA 3STVA 3ZLTA 1TCVA 2BTOA 3QSGA 4J0DA 1C9JA 1HDYA 3PNYA 1BQ3A 4I50F 3E8MA 4NU6A 5CEEA 2YVQA 4EP1A 4Q3KA 2YYYA 2H4WA 1S8OA 5E8RA 1MIHA 1RQLA 3BB3A 4BZWA 1MW8X 1MV5A 2X9LA 4JEHA 3DF9A 1L1EA 4HDOB 1U4OA 1ZCBA 4N0DA 3HVUA 3EGWA 4KXFB 3TUZC 1LBQA 5DM1A 2YW9A 1U8AA 4LMPA 1SUAA 4R2WA 1HZZC 2EZ4A 3AOEA 1GARA 5FADA 2R84A 2NTEA 2V7UA 4KYTA 3T6KA 3HA7A 3DXZA 3QKRA 4OHWA 4C0SA 1LF5A 2F43B 1TE2A 5DK6A 1NIPA 1EVEA 5CTAA 3UCXA 4PRKA 1G6HA 1IVSA 3SQXA 2ZKLA 3VHXB 1CJKC 4YT2A 4ZN6A 2A0FA 1KTIA 4P4SB 1E1RA 1L4UA 2FR8C 3KYCB 5GINE 1FRNA 5CDYA 3CF2A 3FNBA 3JWEA 4ZEMA 4NXMB 1I51A 1DAHA 1GJRA 2GQ0A 4YAOA 1VKJA 3EW9A 3F3MA 3HKCA 3NORA 5K0LA 3D2BA 1Z0FA 4M9QA 1P45A 4UDXX 4C05A 4CM7A 3H17A 4NCBA 2WM2A 4EY8A 3VKVA 2HU2A 4TOIA 1FS6A 3OPNA 3QJGA 4OGKA 2X15A 2X6RA 3C3EA 3CIOA 5JPCA 5J2TA 4LRXA 1K3TA 1UBNA 2AJLI 5HOEA 3A6KA 1ZH8A 1WP9A 1C81A 3TRJA 1T2FA 1HPLA 3OEHA 4KO3S 1XAHA 3BTOA 4CG2A 2ANBA 4PN7A 3DMNA 4Y2VA 3TCNA 1XTUA 4BE9A 1JWLA 2XXAB 4XIYA 1TNDA 1AS0A 3UA3A 1E2EA 1QK3A 4H6VA 4BQNA 2GTPA 4R40A 1T9BA 1GPH1 1PJSA 3M6VA 1U65A 2ZJZA 3BFKA 1WU7A 3GVPA 1JB9A 1P0MA 3JAKB 3PWZA 5EEHA 1ZYUA 5BYKA 4JLDA 2PAAA 3COSA 3LFHA 3TF5A 2NYAA 3QIAA 5L3SB 3R3HA 1CRPA 3HQ4O 4I7EA 2WW8A 1ULHA 1EQUA 2IODA 4IAOA 1GGHA 1EDEA 1IBMB 2WYUA 4D1YA 3AI7A 1CEEA 5HDQA 4H2DA 1OIVA 1WCYA 4MVJP 4AP9A 4HV4A 1G5FA 4GL4A 3KOUA 3PA6A 2DB3A 3ZY5A 1RYDA 2WUDA 3U4MA 2N9UA 1RJ9B 2YTZA 3ELWA 4URZR 3BMCA 2EGHA 3MWDA 4JOCA 5G3ZA 5AVSA 2Y4NA 3K71B 2IZ7A 2V7XA 1U2SA 1OPRA 2IYUA 3O8BA 4DMLA 1DELA 3U3KA 1DO0A 4I99A 3UKJA 3V5NA 2G0AA 2XT0A 2GWHA 1F8UA 1IIRA 3IODA 3L6CA 4ROTA 1CE8A 5KYVA 3TXXA 5GMOA 4ACBA 2WV9A 1N6NA 1ZNWA 1RNLA 2PKRA 2X7HA 4LBZA 3T38A 4DXHA 5A0FA 1F48A 1UKZA 1ZJYA 4FMCF 3I45A 5JADA 1OXVA 1O89A 3LUKA 1ULBA 5F3RA 4MVJM 1W5BA 3NJRA 4DCMA 2O20A 4YRZA 4XTRA 3D31A 3F5FA 2WJZB 4AJ1A 1M5TA 3GELA 1X1TA 2D1SA 2YV3A 3L1HA 3OH8A 4LQCA 1LGYA 4RHCA 3CCFA 3M0EA 3NOVA 4CT5A 3LPCA 2WHXA 1ZNQO 2W0MA 3PLRA 4M8NE 5BN1A 3HFSA 2BI8A 4P4LA 3KUCA 1HM5A 1P6UA 2ZCVA 2QUHA 4JH0A 5A3SA 2BIFA 1Y81A 3U49A 1P3JA 4ZTBA 1DXOA 5JDIA 1MT3A 4Q9AA 4COKA 2Q3JA 2V4UA 3EBOA 4HDKA 4Q4CA 3BWVA 3HDGA 4F5EA 4J29A 2AI2A 4ZANA 1FLDA 3NW9A 3ROFA 1ZSVA 5FX2A 1XD2B 1PQPA 4N4AA 4DWOA 5F1OA 4XVUA 3GPIA 2OBFA 4UTPA 1G8AA 3A4TA 3TWOA 4A7PA 3PDUA 3EAFA 4L8YA 4Q00A 4KN9S 4B48A 4C6TB 4MB6A 5BMOA 2HMSA 3LKVA 5EJGA 3RLFA 1OWOA 2A7QA 2XNHA 2BFPA 5C34B 5LFAA 2NXNA 3EZYA 3GDWA 2I71A 4TN5A 3V8NA 1KSHA 1C3OA 2J4CA 4QUBA 3WK4A 2J4FA 4OGFA 5TXGA 5L3SA 1LNQA 4UHEA 2O8EB 3M4XA 3FVTA 4C7VA 2NO5A 1WUYA 3AZPA 4HNAA 4EB3A 5FTWA 4I36A 1KQFA 3COZA 1J0DA 3WGVA 3IUQA 2CLLB 3DH0A 3M6IA 4HWOA 4NJOA 5EIBD 1XJWA 3KPWA 3V1TC 2G0NA 1LNZA 5EQDA 1C0PA 3REFA 3U7RA 2DTXA 1QK4A 5E3HA 3EIUA 2AVDA 3QXGA 4YT8A 1RKUA 5JZBA 1NNEA 2RHGB 1J5XA 5CLIA 2D7CA 4BZQA 3FPBA 3PIIA 4KQ9A 1IN4A 2WY2D 4W5QA 4L02A 2G4CA 4LKOA 1J09A 2X0FA 4EVSA 1QLWA 5EJAA 3ZKWB 5JY1A 3FWNA 3VNAA 3VZRA 2QN1A 3F98A 5H4HA 3IOMA 2ZB8A 2PK3A 1DUIA 1ZK3A 1NQUA 4XR4A 3ZDXB 4OQZA 4YLYA 4D25A 1KDVA 1RWXA 2DGDA 2C3UA 4GXNA 4LI0A 3ND6A 3HP1A 4OM7A 3T4XA 1QG4A 1Q2UA 2Z1MA 3IQHX 3UT6A 5E95A 1EVIA 2HDWA 1O9HA 2OZVA 4E70A 3N7TA 2ORIA 3LQFA 4EW1A 1I6MA 3THWA 5FUMA 5LUBA 3T5GA 1E63A 4MW0A 5CXXA 4OHRA 2VOJA 3MT8A 1M6NA 4FYKA 1G8HA 4NI5A 1Z26A 2HHJA 4UDOA 3B1KA 1U7UA 3HLYA 2IHUA 2AHOA 2G25A 3JQ9A 1O1YA 3PFHA 3Q9UA 1GTSA 1PR3A 1WABA 3B9PA 4E2XA 3MMNA 3MTJA 4IKPA 1U3VA 4XVQA 4CGYA 1NG1A 3GJ4A 1WHTB 3OP4A 2XMZA 3SSMA 4KAFA 1T29A 1VE3A 3JV7A 3ZDQA 4YPOA 3E9CA 1V6SA 1ZCJA 5JYEA 3PKIA 5COBA 1C50A 3KKNA 1G0NA 1PW5A 2WSSA 1IB6A 2Q28A 3NV7A 3W05A 2LDXA 1I3OA 3E03A 4G4IA 3JQRA 1G8YA 3D0RA 1TZCA 3P4YA 3QNUA 1DJPA 4G0ZA 1GKYA 3BL8A 1NQAO 2NNLD 4Q3DA 1ISSA 1SOWA 3INYA 4OM8A 4Q01A 3S2EA 3F5SA 1V7QA 2WJPA 4IDFA 1RYZA 4JITA 1W1UA 3GL9A 3SIXA 4DRZA 4YCCA 2BFBA 2QY9A 3KR2A 5EPEA 3ZI0A 1N2SA 2HBYA 2BUAA 4D9KA 2XWSA 5DNAA 1G4AE 4P53A 1VYVA 4KH0A 3VR6A 2R11A 4PY2A 5BV1A 3RUFA 1AVTA 1UODA 4BNFA 2DJIA 4ND3A 1RR6A 1S5PA 4HADA 4WBNF 1XRPA 1HQDA 2B5OA 4GMDA 2B1RA 5TMBA 5JLAA 2ZS7A 3NBAA 5PGMA 4MRSA 2WU3A 5AXBA 3Q15C 3KQKA 3AJ9A 4GO1A 1CNEA 2CDAA 1NMYA 3H4IA 3SFVA 3K5IA 5CT4A 4R98A 1MD9A 4RZXA 4XYMA 2WF8A 1XTQA 2ZJOA 5E4JA 2ZPTX 3CTPA 4LMBA 2W70A 1S01A 5EXPA 2FFBA 2LIPA 3Q41A 4DG8A 1EFTA 5KSWB 4KHZA 4HDKB 3W1WA 1JR3E 1OXUA 4LCBA 1O9GA 3LPNA 5AIAA 1XJ0A 2WJ3A 1PJ2A 3VRHA 2JLUA 2VYND 2R66A 1VIVA 4DGSA 4D92A 1GRCA 1T8TA 1Q50A 4B3XA 4O2BA 1JPJA 5DLYA 2UUOA 4F06A 3ORQA 4GIBA 4PGGA 1N2CB 4BIMA 1U8UA 1A97A 5CIWA 2FMTA 4CMJA 1FVHA 1JKJB 2ZB2A 4AS3A 4EYOA 5CDHA 4XX0A 4BFCA 2PT5A 3LA8A 2CHEA 3GEIA 2H11A 3CZMA 1SWVA 2G08A 4RHXA 2PS3A 4KBFA 2B8NA 4C76A 2PGOA 1MNQA 4K26A 1SQ6A 2ZP1A 1EUZA 4O2AB 1VJ1A 3L0BA 5IDVA 1GPUA 4GX2A 2FWIA 2R8RA 1OYOA 3DTVD 1M2HA 4UAJA 5K6RA 4LDZA 5E7QA 3UHJA 4JT4A 1PW7A 4DR3B 5L4LA 4EY6A 4OHXA 2GJ8A 2HDOA 1U0RA 5KDDA 3C1AA 4QEDA 3H42B 4M0KA 1S7GA 1X7YA 3GJZA 4LG1A 4ZEVA 5KQRA 2WFAA 1Y6FA 1M72A 3TFWA 3T9BA 3FNHA 2JLSA 2OZEA 4JC0A 5TSDA 4JUAA 3NRJA 1NNUA 3GLGA 2G1KA 1CUVA 4Q7LA 2FZLA 4W9NA 4EMTA 3ANNA 4WSOA 1Y8RA 3HK2A 1B2RA 2HCRA 4HNTA 3ILSA 2ZITA 1N1EA 3ZJVA 4O0MA 4IH9A 3FZQA 1I4EB 2X5OA 3H11B 2PUDA 2DSNA 3D7KA 1C4XA 1IJFA 2IS2A 1G7SA 3E1SA 1GRNA 3QKIA 4ILKA 2AE2A 1QOQB 1HDCA 3KL2A 5FL3A 1GG2A 3CVWA 1W4ZA 5HPYB 4MAMA 1PP4A 2WQZA 2AFRA 5HBGA 1KIMA 4D8TA 3GGPA 1B0ZA 5C7OO 3DA8A 5LMNB 2CF6A 1JXOA 2P2YA 2QLMA 3DTNA 3R4CA 3T5CA 1HC7A 4HZUB 2Q3BA 3OOSA 1N75A 2TMYA 1VP3A 2FG6C 1D2MA 2CNLA 3DVAA 3JQ7A 5K3SA 3SXUB 4I55A 3FVVA 4Q02A 3U0BA 1W85B 2PWYA 2BBTA 3RYFA 3R4VA 3BK7A 3CS3A 1A77A 2EG9A 3AWIA 3DW3X 3LS2A 1TAHA 4R5MA 1O6GA 5BNWA 4N41A 3KKPA 5H0IA 1EP9A 2JJ8A 2UZAA 3STWA 5EMKA 3O0TA 4LJ8A 2IZ1A 3JTEA 1VA5A 3WISA 5FTKA 3B82A 4LSZA 2GAOA 3E3LA 4EA9A 4J1TC 4Y2HA 4D3ZA 4KPUB 1SXJC 1MIOB 3A6FA 3I8XA 3W34A 4BFXA 2JLRA 2R8XA 1BYUA 2EDAA 1A9OA 1MLDA 1SKBA 3E9NA 3DS8A 1U8FO 2QRZA 3I4LA 1ZVKA 2VPZA 3VGJA 4EHIA 2BE9A 4ESHA 4Z9XA 1FDIA 1RXSA 3CLHA 3TZQA 4DYDA 4KQXA 1UT6A 3DWFA 3GAMA 2J4DA 3NDIA 4NAHA 4DYVA 2GBIA 4GGMX 4NCXA 2LTAA 3KJIA 3L1KA 4PAMA 1Q7CA 1E3JA 1EDDA 1QORA 3PJEA 4YJHB 2IK8A 4PGFA 5ALHA 3U7FB 1OZFA 4CKYA 3T3NA 3CX8A 3PEWA 1P9WA 1VHTA 3A11A 3O84A 4HDAA 2ZI5A 3BIFA 3OEWA 1WPXA 2PD6A 1OXSC 3T5BA 3UV7A 2C82A 4P4NA 1Q7BA 3VQTA 4KIUA 1ZVVA 2O5CA 2W8BB 3B1VA 3LXRA 1F0YA 3CUVA 5GGYA 1P73A 1RM4A 2DPHA 3OAAA 1YJ8A 4IZOA 4HGRA 4LOKA 3CLTC 4M3NA 3V4SA 4DSOA 1FK8A 3DLCA 2WTUA 1PHPA 3GJ3A 4MPDA 4YA6A 3I9OA 3QHPA 1A1SA 2GETA 4LTMA 1DI0A 4MQEA 1P8JA 2WM8A 1KE2A 3H0CA 4O4IA 4XARA 5DBHX 3SXUA 4ZCRA 5IVHA 4X3OA 4ZQBA 2X0EA 3KEFA 3ONVA 1KYQA 3OFSA 4MB2A 2O23A 3ZV3A 4OHYA 3ASYA 4TM7A 2P2LA 3E2PA 4IHJB 2ZQYA 4CR7A 2AD5A 2R96A 1COWA 1XU4A 3EXIB 2IYXA 2EFEB 3MCAA 4NJMA 1KEUA 2IXFA 2IE8A 5B3AA 5AI9A 4RVFA 1ZM3A 1L7AA 3JPYA 4AF8A 4LF5B 1Z6GA 1JHDA 5KEIA 2XA2A 3PVZA 4FCWA 2EP8A 4G0OA 1ODCA 2NT4A 4POAA 4CLRA 2WTMA 1B4DA 3GDFA 4EZIA 1C3OB 2X6QA 2DC1A 3HWWA 4B74A 4OQFA 3AHEA 3KWJA 3QUTA 4PCLA 5DGHA 3CISA 1PV2A 2Z9CA 3QVMA 4IILA 4RKYA 5DTEA 3R7WB 3JX9A 3IEXA 3PK0A 3UMBA 3PQCA 4WZAE 3MBIA 2VC2B 3OE7D 4B1FA 1XTPA 5BW4A 2XTJA 1Q84A 4P31A 3UHFA 4RPLA 1K5DA 2F00A 2J0VA 3OJXA 1WRBA 4PAOA 2QL6A 5AUNB 1NXSA 5JCXA 4Y67A 4GP7A 3I2HA 3R7LA 1VL1A 4JV5B 3OPXA 4IIJF 3SR0A 3COJA 3GYBA 2R5FA 4JEIA 1G41A 1K8QA 5F52A 4ZOAA 4DA9A 4XGKA 2W6JA 4M9XA 2IOQA 2Y1FA 1EWRA 2QYOA 1GOTA 3B7PA 3NMUF 1HDEA 3PE6A 4A0HA 3RH0A 3NHUA 1P7PA 2RH8A 2Z04A 3IQDB 3TGWA 2ZE7A 4RTMA 1N5DA 1Z7EA 2VBGA 2YFQA 4C1NA 1U98A 1LZLA 2XOXA 2W6PA 2H00A 4L8GA 1Z63A 1KK2A 2ZYHA 3C6BA 2IF2A 3FZGA 3M4NA 3HO1A 3ZI4A 2G40A 5JECA 4J2OA 4L4ZA 2ZDHA 5F3WB 3T52A 3BXOA 3ZUPA 1NMSA 3RM3A 3RVDA 3SC2B 4W1QA 1RD4A 4JBGA 3ZDEA 2HSJA 4A92A 2NVOA 3BWMA 1M2GA 4WY2A 4QDOA 2QRVA 2Q99A 4B75A 1DQZA 4NCKA 5BWLA 4KFCA 4O0LA 5CNKA 4QQ8A 4WNYA 4XFDA 5DBEX 5C4MA 3KKKA 1ZMRA 2QJRA 1CUAA 4UEOA 5HDBB 4GE0A 3TZEA 1L8XA 3ND8A 1KEEB 4NYJQ 1WSAA 3P0HA 4RANA 3WGQA 3LCUA 3I6YA 1SUEA 3V8BA 1TXGA 1UIRA 4I1YA 4K86A 4OQ4A 4AYXA 4IJ6A 2BOVA 3EY9A 3VDMA 1QJ4A 5ERXA 1AF4A 3R6WA 1PFVA 2AXPA 1JQEA 3JD4A 3KKOA 1JDBC 5C4GB 1ISGA 3WRVA 5CCEA 5BR8B 3IAEA 5KC8A 1A71A 1CQIB 2VRBA 2XBUA 1RJWA 4L2IA 3OKFA 1Z2OX 5KNDA 4KSYA 5M7EA 3R8FA 1SVKA 4R9NA 5AHWA 2Y1CA 5ALOA 5LIPA 2IFTA 2RH9B 1VIAA 1VRCA 3LTEA 1U9JA 3MFYA 3OBIA 1WUKS 1WL8A 2VZ8A 1NJFA 2QZZA 1EBFA 3ZBUA 3GT4A 1QUFA 1I2AA 3HCPA 3KPUA 3E9DA 2HSEA 5K8IA 1FNDA 2INGX 2WT4A 4TXHA 3T3OA 2LP4Y 1M6HA 4GDFA 3VR2D 3C48A 4R6XA 3NUGA 3TTYA 4EKYA 1QIEA 3O4RA 5KJ6A 3T0IA 4CCWA 5IKMA 4HXFB 1PJ4A 1RQNA 4HAIA 4YMVA 2FDXA 4EW6A 1T0UA 5EHNA 2XXAA 1PK9A 2ZU0C 3GHYA 3V00A 1U99A 4QPPA 4GI7A 2PV7A 3SBXA 3K1YA 2FEKA 1CS4C 4MEJA 4D0LB 2WJWA 5B7PA 3OAAD 3IUMA 2XNDA 2VS1A 1MU0A 5CVUA 2XKBA 2BCEA 4HEHA 2OLEA 4PLWA 4Q21A 2FG5A 2JDIA 2P6PA 1AF7A 1K3FA 1JZSA 1KVTA 1L4YA 1OF1A 1NUQA 2NSYA 2QQ5A 1AUVA 2K2QB 3H2JA 3OTHA 4KE7A 3ZEIA 3M89A 4QRDA 3I05A 2FHSA 2UXBB 1U04A 1JT2A 2V6MA 1E20A 4XGRA 4ND2A 3TJRA 1IXYA 5G0TA 1XNGA 3PNMA 4IGIA 2Q6LA 3E2IA 2QL5A 1BE0A 2Q4RA 4P5EA 3UAZA 1GGMA 3W2TA 2FRXA 1JRLA 1GIAA 1XYVA 1IOVA 1JYFA 5J4VA 4PO9A 5AHRA 2UZ1A 4E0BA 3ZBQA 1H94A 2REXB 3IX7A 4QLBA 1H1DA 3QKSA 4GF5A 2PEYA 1W34A 3D6FA 3DXXA 4D3FA 1U2RA 4CGZA 3QFTA 2OE2A 3E0XA 1YL7A 1I33A 5CH3A 1JQJC 4F4JA 3RVBA 4JJAA 3O9ZA 2FHPA 1R0YA 3SZRA 5FBHA 1QF6A 5F9MA 4ZT5A 4DPLA 1ANKA 3HCNA 1DUVG 2P6RA 4A6DA 4PAGA 5HG0A 5ITZA 2QW8A 1GDTA 1CUEA 3FUUA 3EZ7A 3V2GA 2WTBA 4Q9LA 2OAGA 4X00A 2HO4A 1QXSA 3B38A 3QHQA 5JFOA 1M2JA 3PPVA 2EZ8A 3INTA 5AM4A 2WDPA 2MDTA 1ZG3A 2MYPA 1E2MA 3D4LA 1NNSA 4CKEB 2O1XA 5E4TA 3ZCUA 4FINA 2O1WA 3BREA 4AQ7A 1V43A 3H4TA 3G13A 3J81A 3FPEA 2ODWA 1DCMA 3CCCA 2Y4OA 3CUEF 4Z51A 5ITWA 2UYHA 3VNSA 2VZLA 2ZWVA 3AVPA 3Q0TA 4S1OA 4B5LA 8ABPA 2X2PA 1RYNA 3FN4A 3LSTA 3PDJA 4FHEA 1VFPA 4KXLA 3KE8A 2WFMA 4DIUA 1NBEA 1YHYA 1INLA 4NU5A 1NUPA 2HN9A 3CLKA 3TJMA 1EB9A 1RLUA 3GAZA 3PU6A 5DK4A 2PL9A 1U8ZA 1KR5A 2I4OA 3CO5A 1B73A 4NNJA 2TECE 4M6WA 5F5XA 2QLLA 3A9TA 1U1GA 1Y7HA 3TLGA 3DHWC 1U2DA 2E5FA 2J59A 1P2BA 3P9SA 4EI7A 4A1OA 1EM6A 1OWMA 4ZZ1A 1KJJA 4YRMA 3C41J 3GFRA 3AEQA 2OGWA 4Z9BA 4EPXA 2H1WA 1QDLB 1O57A 4GNKA 4TTPA 3ESAA 3G5AA 3E3MA 5JDCA 1L4BA 2YVKA 4BNZA 3AB8A 3GGGA 2ZRJA 1EZ1A 3B48A 3LNTA 4IDBA 4PZLA 1FPQA 3LLSA 2PX6A 5DLQC 1V1JA 2A3RA 5A9TA 1M9NA 1HDOA 4OKIA 1JBEA 1RI1A 2OCXA 1C1DB 5KOHB 3TOCA 1SRRA 1S9HA 2OY0A 2IOFK 1SOAA 2Z9BA 3IUBA 1PT7A 2WD8A 4MS3A 4ZVSA 4AL4A 4Q3LA 3AVUA 1E2IA 1J00A 4NV1A 1NN3A 2NTJA 5DXFA 1FFXA 3L7MA 4EMSA 2LWIA 1NW5A 2REBA 1YRHA 1H23A 1KI2A 4YAJA 2HMAA 4JAVC 2AOTB 3DZBA 1UEXC 1V5IA 2IV7A 2F90A 3VH3A 4K1LA 2GEJA 1VIMA 2ODNA 2D0DA 4GLJA 2DQ4A 3NLLA 2IYEA 5JC1A 3TR6A 3PYLA 2CBGA 1KXZA 2BZSA 2CGEA 4FYXA 4IKOA 4RF5A 3UUWA 3DO6A 1FJ2A 1SHUX 3MNFA 3K9FC 4R2HA 4G36A 3I73A 2W9XA 5A6SA 1ONNA 5E3IA 4YGXB 2VJPA 2JGNA 1JMKC 3EA5A 5FLKA 3IIEA 3Q7TA 1XSEA 4BNUA 1VLZA 2A4KA 3GR6A 3K4QA 1ZW1A 3OQIA 4G0MA 4AUMA 4EELA 1OC2A 4WOPA 3C8ZA 5AUOB 3AL3A 3WQHA 4QT4A 5FOSA 2V74B 2IYAA 2TS1A 2FZEA 1Q1AA 1PKEA 2JGKA 4RD2A 1CQJB 1N57A 1Q15A 1XR3A 1OTYA 3OPVA 4D9MA 4JJ7A 3OCXA 3V80A 5IYZF 3HKDB 3T3HA 1JALA 2P6NA 2HJGA 4MQFA 5COAA 2GA8A 1NUSA 4FB5A 4YV1A 1VLQA 3L4JA 4DDTA 3LLUA 2M6LA 1T8WA 1WV1A 2AN1A 5E0OA 3RC1A 2CBZA 3CHYA 3FNEA 4FZ5A 2A0YA 2II6A 2FJPA 2RONA 4EY3A 1JQAA 1EIWA 2HSZA 2W6ZA 1UPBA 3K9QO 4GU5A 3EASA 1YDMA 4V1CI 2CDCA 4B81A 3OUZA 1IXRC 3ERCA 1QCCA 3H3JA 3SYNA 4MV1A 3E7DA 4NZYA 2ZI6A 4Q4JA 3C3CA 2W4QA 1X86B 2Z8ZA 5TC4A 1I5OA 2GD0A 2ZI9A 4FJ1A 1XLTC 1LA2A 4ZO4A 2F2TA 5CYGA 2O3SA 2PLFA 3TPFA 1PJTA 5F78A 5LYJA 5C1DA 1Z0DA 3DO5A 4QUAA 1OCEA 2C3OA 3OC0A 4MWSA 3DE1X 3OFND 4B3FX 4EF5A 2B4YA 4TQAA 2CK3A 2YC2C 3JZMA 2H9YA 4DNQA 2PLWA 1NBME 4PZPA 3DL2A 2ORWA 1AO3A 1W6RA 1YZ3A 1YTUA 1LPBB 4G2TA 3ROXA 2BUCA 4OHZA 2Q7DA 4PHGA 2VCYA 1ZD9A 2D5BA 1H4QA 1NXQA 4FE4A 2RHOA 2EJUA 4BNNA 1V7PC 1EUCB 4J4BA 2PH3A 1ZGHA 2WA2A 1CWUA 3G2OA 4EI8A 1ISRA 1G16A 3LT2A 3VTZA 4LCEA 1AN9A 4DXAA 1JKMA 4EI9A 4TKVA 5AJVB 2CV2A 1SPBS 3L02A 1R9GA 4K8OA 4TS3A 1YR1A 4TSKA 3SN6A 5LZ8A 1L7EA 1SCKA 2KJQA 1P9RA 4X1KB 4EY7A 4CKCB 4XJVA 1UZAA 4YJ3B 3WQRA 5A4IS 2WUFA 4JFAA 2ES4A 3DYVA 3SJ7A 4BX3A 2WAOA 4DBVO 2YJ3A 4O08A 5I9LA 1E1QA 1M2NA 2Q3MA 3G9TA 3L4EA 1JW9B 1DIOB 3Q85A 4P80A 4YMGA 1U5BA 4B44A 4MICA 3ZWXA 3SG0A 4QU5A 2C2MA 2DUNA 1RXWA 2Q3CA 4LJ4A 3O2JA 3FR7A 3N87A 4QODA 3X1KA 4JOQA 2CVZA 2QUAA 3WJ1A 4QM7A 3DBIA 1JLLB 3HRHA 2X6TA 2ONKA 2VF4X 3QM1A 4V0ME 4Z0HO 1FFGA 2JFXA 2G7ZA 2H2IA 4ZRMA 4CMHA 1DT3A 2HRDA 3WWCA 4D74A 1YR9A 3I04A 1X7XB 1U8XX 4FILA 4DREA 3LVBA 3NEJA 1VJGA 3R09A 1LS6A 3PQ2A 3JARB 4DEXA 3IXMA 3RVNA 4CKBA 5AI8A 1YR8A 1KC3A 2IP1A 3KZKA 4GX5A 4KXWA 4MV0A 5G1OA 1E9BA 1JAIA 1TM5E 1HH4A 5ALFA 1EK0A 2GPWA 1Y9AA 4KE8A 3CH6A 3V34A 2H8KA 1PT5A 3DTYA 3PWTA 3PC2A 1GTJ1 1E8DA 5AVZA 3CRQA 1HE2A 1JS1X 1EKXA 4B3RB 3WLSA 4M0CA 3M6WA 5FL7A 2NVWA 1ESDA 1TZJA 4ZVMA 3G2PA 4PYRA 3RB8A 1P1FA 1RYFA 3DVRX 1UM9A 1Z6QA 3NRBA 4LRTB 4WA7A 4XVRA 4O63O 1NIJA 1Y5NA 3QFSA 4BGVA 2DY0A 4OK6A 4UE6A 1RHKA 5D85A 2IXTA 3EQ7A 3HPQA 2P4SA 1ZUD1 2CCKA 2JHGA 3P4UA 1UK9A 3OFKA 5K3EA 4CTOA 2VZEA 3VYUB 1C3EA 3AIKA 3Q7SA 4BX2A 1DTEA 1SXPA 3T7KA 3CLUD 5LD2B 4B6FA 2A5FA 1G5TA 3N5CA 1H6AA 5AJTA 1U2GC 4KZKA 4AZTA 2J9XB 1EXVA 1DLIA 3DV0A 3L0ZA 3A4LA 9ABPA 5GY7A 1XCLA 2R2AA 2D5IA 1E2NA 4ZYZA 4FDUA 1IXKA 1T5OA 2DLNA 3COVA 2X41A 3EFEA 2YRWA 5TGDA 5J2UF 4LYYA 4NE7A 2W22A 3G2HA 4IH4A 4NR0A 5AKEA 2PHZA 1SXJA 4KV7A 3O3OB 1QGYA 4E22A 4AUEA 3OOJA 3HUFA 5D1NA 4YCNA 3PUKA 3VAYA 3VZDA 2P79A 1E4OA 2DECA 1ZMXA 1SCIA 3QUQA 3WMWA 2GZ1A 2JVJA 1VZ2A 2K4MA 3I9JA 4MHSA 3E81A 1E2BA 1RRKA 2WSMA 3FXAA 1RW4A 4H1TA 1RHMA 3VPGA 4DBLE 4R8RA 1R6UA 1SA0A 3CO0S 4YK7A 3OLQA 1X1DA 4JI2B 1ORWA 2BGRA 1FRQA 1Y42X 2TYSB 4BDTA 3HB0A 1C29B 1PFQA 4MGHA 5EUMA 4LGCA 4M0PA 3AGPA 3LC2O 4GBED 4GEKA 4AU1A 1TW2A 4RXUA 5AK4A 3LJKA 2ZIXB 3L8DA 5CVVA 4B6QA 3U2QA 2QN3A 2B1GA 3R76A 2GDZA 1FX0B 5ECDA 1R6BX 1OWLA 4FGJA 4X7MA 3IMFA 5BSTA 1JH9A 1TL7C 1ZO8A 3IIIA 1GPAA 1SELA 3HA3A 4FU0A 4QBTA 1OAOC 1YFLA 1NURA 4G9BA 3MGGA 1DC8A 4MIOA 3SJAA 3ANMA 3ZD8A 2QX9A 4B33A 1QB7A 4BYGA 4BPBA 1PS9A 4FEYA 3VPFA 3ASZA 5AT1A 3PS9A 2QTAA 4Z4FA 4G0PA 4P7JA 1Z7WA 1CVIA 3P0FA 4GG1A 1KY3A 4G0VA 1MB3A 1ZJ6A 4DSAA 1YIOA 4GKAA 4EJFA 3ECSA 2E4AA 1X80B 3HDHA 1CF4A 1DEAA 3AR9A 3R0IA 5AW7A 1S6YA 1RCTE 3G85A 2ZRGA 3GD7A 3GRZA 3JZFA 4J6FA 4KQGA 4U3JB 4Q9JA 3ZU3A 3V8RA 1ORDA 2R751 3VHQA 2O2DA 3UFBA 3GLFB 4N9WA 2A35A 2A94A 1QG2A 1JEYA 2VXCA 3QXCA 2XUGA 2E4ZA 3R7BA 5C1BA 2ZUEA 1Y98A 2C96A 3WYDA 1O08A 1RJEA 1RXUA 3EGCA 2FZ4A 3AQ4A 1KGDA 3UMGA 1HYGA 3PGLA 5IN4A 1UANA 4KREA 1XJ5A 4OIMA 1WB5A 1IJKA 1I7DA 2GCEA 4YLGA 3VNBA 5HRUA 4LRYA 2UAGA 3OU6A 5BUQA 4QHSA 1NN1A 2PX2A 3EWNA 5B4VA 1FS4A 1U81A 5EJ5A 1W0KD 2NNWB 3AGQA 1EXDA 1R15A 4UJ5A 1O6ZA 4OSOA 2C97A 4W1RA 3CF6R 1KU6A 3BCHA 2FUEA 1E8MA 4OXNA 4P0PB 1ZISA 3C45A 4UHBA 1KHHA 1WOMA 5KOYA 2XCOA 2DPYA 2CD7A 4D80A 4YCMA 3RWBA 3O1LA 2BGTA 4HRYA 3TSZA 2XZLA 1E9EA 4EEZA 1GTL1 4KL8S 4ZICA 4JELA 4WKPA 4JP3A 2HT6A 3FPHA 2PRZA 2YZKA 1S4MA 3OPQA 1M76A 2AMJA 3OG9A 4IDAA 2PFGA 1KETA 4OXQA 4MEBA 1ZN2A 1YA8A 2BEVA 2DPGA 3QMVA 3RS7A 2NLOA 3PPXA 3RS0A 3RFCA 2HYIC 1WQ3A 1G9XA 3C70A 4XYBA 4MA4A 4DJDC 3S0JA 3F2IA 3H65A 2PKCA 1J0CA 2WNIA 3AUJB 1MDBA 1CZHA 1H4VB 1USVA 3TIVA 2O7NA 5BWOA 5C9ZA 1V9LA 2ZYTX 1YS1X 2R6FA 1XQYA 2XEDA 2OZPA 4II7A 1SM4A 3DMTC 3AJ8A 3SYMA 4ZVRA 5DHPA 1L7NA 1SD1A 3F1KA 5A03A 2I2BA 3BGDA 1RAGA 4DHEA 1DMSA 5JWHA 2JS7A 4LK3A 2QI9F 2A8YA 3OJOA 2OFWA 5CUQA 3FPSA 1RHRA 4KCGA 5DTQA 4G6ZA 3QE3A 5IC4A 1Y6ZA 2XMGA 2OC4A 4WZZA 2C54A 5KNBH 3AR4A 1XC7A 2PSFA 4HOYA 4P4UA 3T7JA 1XRRA 2H48A 2GEKA 4UM7A 1YWGO 3MLBA 5BW5A 2KBFA 1HDZA 4QGAA 1W1WA 1RVV1 1OLSA 1TCAA 3HSSA 3IILA 3PDCA 3V32A 4B3GA 2XHEA 4ZAXA 4K5QA 2C9ZA 2E87A 3JAMA 4M21A 1ORRA 2ZFUA 3SE7A 1NXWA 2IXBA 2QAGB 4AY2A 2I5PO 4GPBA 4P35A 1Z6AA 5I9MA 2ZXFA 1EVJA 3JCZA 1GVNB 4BLQA 2DTEA 5IAEA 1ZGCA 3IL2A 4EGSA 1VRWA 3OI7A 1XPUA 4QAQA 3L2OB 4AJOA 1DKPA 1GCOA 2EL7A 4PRYA 4TTIA 3C3JA 4S1NA 1SBYA 3ECAA 1DJOA 1YJAA 1KP3A 4HDCA 2GSWA 3GLHB 3HP7A 4YUYA 5LOVF 5T7BA 1E0KA 1P75A 2V0GA 4D4JA 2EFGA 1EBBA 2BISA 4IHAA 1EVQA 2B7CA 3DD1A 4LSWA 4M53A 1NYRA 1NVFA 3QH4A 2IYOA 3IKLA 3KUDA 1RAAA 3CA8A 3L8HA 1QRUA 1QE5A 4OH1A 2HA2A 2JCVA 4GMHA 5GGXA 2C77A 1N9GB 4PM4A 4WEOA 5CFNA 1JG4A 2LGJA 4XCVA 1XLTA 2AK3A 3GEGA 3R0JA 3RKUA 4AW9A 1UT5A 3A1CA 1W29A 2ZAOA 3HYCA 1MB2A 1Q7EA 1ZIPA 3WQQA 1CUHA 1IZ7A 2FR1A 4TXNA 1R9NA 3V4ZA 1X13A 3W1EA 1EK5A 2HJ9A 1QVRA 3ITNA 3OCYA 2ZRIA 4DA6A 1GWNA 1ZUIA 1MQAA 4X63A 3UGJA 3N9IA 1FYVA 1QIMA 3IIMA 2Q29A 1DTSA 1SAYA 3GFOA 4JJGA 1YT5A 2VXBA 3PP8A 4PZ0A 2YZGA 4ZDKA 4IWXA 3QFFA 1QOZA 2WMYA 1C3LA 3OPYB 2C99A 2PCLA 1QIDA 2XDAA 1M74A 1S2LA 3OCZA 5DCLA 3TDMA 4C4TA 3EVGA 4URYR 2JBWA 3OFVA 1KAEA 2HJHA 3TBKA 4YASA 1A3CA 5A9SA 1ZRSA 1D2GA 3HR4A 3LQ4A 2F48A 2J0UB 1L5ZA 4IHKA 4XZ3A 2QN6A 5L6MB 4GBGA 2V96A 4BFTA 1XQVA 4ZJUA 4IJ5A 4BNHA 2DFTA