3B1FA

Crystal structure of prephenate dehydrogenase from streptococcus mutans
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
290
structure length
286
Chain Sequence
AAAMEEKTIYIAGLGLIGASLALGIKRDHPHYKIVGYNRSDRSRDIALERGIVDEATADFKVFAALADVIILAVPIKKTIDFIKILADLDLKEDVIITDAGSTKYEIVRAAEYYLKDKPVQFVGSHPMASGAVAANVNLFENAYYIFSPSCLTKPNTIPALQDLLSGLHARYVEIDAAEHDCVTSQISHFPHIIASSLMKQAGDFSESHEMTKHFAAGGFRDMTRIAESEPGMWTSILLTNQEAVLDRIENFKQRLDEVSNLIKARDENAIWAFFNQSRQIRKNME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative prephenate dehydrogenase
publication title Crystal structure of prephenate dehydrogenase from Streptococcus mutans.
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Oxidoreductase
total genus 95
structure length 286
sequence length 290
ec nomenclature ec 1.3.1.12: Prephenate dehydrogenase.
pdb deposition date 2011-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02153 PDH Prephenate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3660.10 Mainly Alpha Orthogonal Bundle 6-phosphogluconate dehydrogenase C-terminal fold 6-phosphogluconate dehydrogenase C-terminal like domain 3b1fA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3b1fA01
2DTEA 3ASUA 2GF2A 5L95A 3RU9A 1KEUA 1M6HA 4IQGA 4QTZA 5C7LO 2VNAA 1I33A 5ENDA 1BW9B 3DXFA 1BWSA 2VWHA 4CV1A 1MLDA 2VRBA 3WJ7A 3PPIA 1HDZA 3UAGA 4XRRA 3UFXA 4A03A 3S2FA 4R16A 1N92A 3GG9A 2QRKA 3RBVA 1GZ6A 1P44A 3ANNA 4A5OA 4CLOA 3ZV3A 5KVVA 3P5SA 5IFLA 3GG2A 4FJ1A 2NQ8A 4BO5A 1U5CA 4YT5A 2X4GA 5KJCA 2X0JA 4L76A 5B1YA 3DB2A 1B8VA 2UAGA 5DBGA 4YT8A 1G1AA 1UXIA 1YOVB 3PYLA 1A7KA 3PJDA 4KTVE 1AHIA 4XCVA 1F0YA 3KSUA 4I5DA 4IMRA 3OQ6A 4NFSA 1QYVA 4UUPA 5JXWA 5G4KB 1F06A 1SCUA 3RUEA 2EW8A 4XB2A 1M67A 2JCVA 5AXCA 1HZJA 3O9ZA 1E92A 4DIBA 3VVBA 2I65A 3GVCA 4GX5A 3IC5A 1ZUD1 2VHVA 4RL6A 4IJVA 3JD4A 3IL2A 4CUZA 4Z3DA 1EZ4A 1GU7A 1Q0QA 1BSVA 1ORRA 3GUYA 4ALKA 5LC1A 4ALIA 4IGFA 3L4BC 2X1HA 3OJLA 3WFIA 5T64A 1CYDA 1WZIA 4DREA 1W73A 3W8EA 3L6OO 3B6ZA 2Q4EA 3TOXA 4BHTA 2D0IA 3VPHA 3ZW9A 4RVUA 3F6YA 3VH1A 2CFCA 3G0OA 2WE7A 1R4MA 3DBRA 4ALNA 1CIVA 1X14A 1LRKA 5A1TA 1ZMTA 4IGEA 3U3XA 4K28A 1EDOA 2FRDA 1DRUA 4ZD6A 1C3VA 1Z82A 1G0OA 5G2OA 4P8RA 5EINA 2AEFA 5GZ1A 5JMWA 2A9FA 1K89A 4YCAA 3VC7A 3ASVA 3DBLB 3E82A 4BNWA 1O8CA 1AHHA 5L7WA 1UDCA 3HFGA 5I8WA 2H63A 3DZIA 1T2DA 1WMAA 2QQ5A 2J5RA 1CEQA 1FK8A 3F4BA 3GT0A 3OJFA 2G17A 4CLRA 4L4XA 1NPYA 3V1UA 2CY0A 2NU8A 2G0TA 4DBVO 4JROA 1DC3A 4BMNA 4IZIA 2IXBA 5A9RA 2DC1A 1XQ1A 1IB6A 2O3QA 5CP8A 3WS7A 2O3JA 5HM8A 1ZBQA 1XG5A 3I6IA 4UVGA 3MOGA 3M1LA 4HFMA 4ZU3A 1MC4A 3WDSA 4HWKA 2P9EA 2WD8A 2AMFA 4INAA 1O5IA 3K73O 2GPTA 8LDHA 2C82A 4NFYA 2CF5A 2Q2QA 5EIOA 3VH3A 3CPSA 1N2SA 4IIVA 3L6DA 3L4SO 2VWQA 2HLPA 3F1KA 2GZ3A 1K6XA 4MP6A 2FP4A 2QIOA 5ICMA 4D42A 4UAGA 1H6DA 2X8LA 4OQYA 3ZU5A 1DXYA 3GHYA 1JAYA 3LC2O 3C85A 4LCEA 1C0LA 3B1KA 4BO2A 4L73A 3EK2A 2BI8A 2NUAA 3GK3A 1IY8A 4HFRA 3JV7A 2GERA 5JAZA 4BB5A 3SXPA 1EVZA 4EITA 4R1NA 2RBEA 2D8AA 2OMEA 4CLXA 3AUTA 5JDIA 4KUGA 3VOSA 3RAJA 2GN4A 2Y67A 3UCXA 4UVDA 3HNPA 4M54A 1GEGA 1HE4A 2OOSA 2W8ZA 5JDCC 4E31A 5K9ZA 5F5NA 1LSSA 4R5HA 4S1VA 3D1LA 4QO8A 2OO5A 2E37A 3CMCO 5BNTA 1GYQA 5FFFA 2O3RA 4JJGA 3FNHA 3ZHZA 3EW7A 2G82A 4QEDA 2GNAA 5KWEA 2VN8A 3ONDA 2YY7A 2WYUA 2WSBA 4JBHA 1ARZA 3ITDA 1E1MA 3U0BA 5LDHA 1BTOA 5T6BA 4CQLA 1XELA 3PIDA 3DFUA 3GVHA 1LX6A 4DQVA 4AJ2A 1FJHA 2FZWA 4BL5A 3Q2KA 4N5LA 3QRWA 4D0RA 3MJCA 2HAEA 2VZ8A 5A5EA 4D0SA 1E7SA 3A28A 4RVDA 2HJSA 3T7EA 2VHWA 1R6DA 2YHIB 2QYTA 3KXDA 3DL2A 2WD7B 3WTCA 4DVJA 3F3SA 4MJLA 4P38A 3K92A 4BNXA 5T8KC 5DT9A 3VH4A 3DOOA 2DBQA 4WCFC 1A5ZA 4IDFA 4K6CA 3DBHB 3TSCA 1D4FA 4BQPA 4PG5A 2D2IA 1VPDA 5TNXA 3INGA 1U8FO 4QXMA 4YAIA 2Q46A 4XYBA 4RVGA 3WGTA 1TB4A 4NBWA 3AK4A 4XQCA 5EMHA 4UEJA 1E1LA 1RWBA 3LVFO 4J1NA 1P1RA 4PRLA 2EXXA 3Q1LA 3DHNA 1L1FA 3MTJA 2I6TA 4YRBA 3GY0A 2VT2A 4GAEA 4CLDA 3LF2A 1ISFA 1YBVA 1IPFA 1ENOA 4RF5A 1HE2A 1I30A 4MVJF 1R0SA 1NQOA 3GVIA 1ZEJA 3ENNA 1XLTA 3E03A 1DFIA 4HKTA 2UUPA 2RIRA 1PQPA 1TLTA 2BFOA 1DC6A 4CMJA 3EHEA 5KVSA 4DIFA 1QR6A 1D1TA 1DAOA 1XU9A 2J3HA 3O8QA 1MV8A 4K26A 4OQZA 1SMKA 3VZPA 1GTMA 1W0CA 2V6MA 4Z9FA 3ZHXA 4D44A 3H9EO 5BR7A 2IZ1A 4FD3A 4BO6A 1ISJA 3DZFA 1DIGA 4FGWA 4W9NC 5A04A 2JHFA 1P31A 1NWHA 3BZUA 2QRJA 2YZ7A 5CDGA 4OH1A 2EKQA 5KTKA 2YW9A 4R69A 4CQMA 3FRJA 1N7HA 4GBJA 3DBVO 1V3TA 4TRNA 3OJEA 1F8GA 1GUFA 3GGGA 1ADFA 1LBEA 1P1FA 2C5EA 1ENYA 1HT0A 2WMDA 4MVJH 3CKYA 5I7VA 3JQCA 1Z73A 4O1MA 1HL3A 3TWOA 4ESOA 3IDSA 3UCFA 2EGGA 2YV3A 3KEOA 1RYDA 3GZNA 4YAEA 2JL1A 3ANLA 1FDSA 1FXSA 3Q9NA 4R9SA 1UXJA 4B7XA 3WOHA 2X0RA 4EW6A 1EUDA 4ND3A 2Y05A 2CVZA 3PTZA 3A9WA 1NQTA 2YV1A 5KJ6A 1LDEA 3BHIA 3HJAA 1NPTO 2W90A 3BTUA 1PU2A 3N74A 3SBOA 4EUEA 5JY6A 2ZTLA 2JKVA 4RVSA 2X6TA 1ULSA 1JKIA 2DBVO 4ALLA 3OM9A 5TS3A 1HE5A 2BKAA 3K8ZA 1ONOA 3VPFA 1WP4A 3JQ9A 4ND5A 4U6QA 4XIJA 2NVUB 4JJIA 5K6AC 3ITKA 1ONPA 1HLDA 4FDAA 3KYBA 3NV9A 4PLZA 3ZWBA 1MXHA 2XXBA 3TDKA 1A4UA 1B16A 1QV6A 3I9OA 4LRSB 3K6JA 3F4LA 1RM4A 2YFQA 1U5AA 2E4AA 3KSZO 4AL4A 1SO8A 1T2CA 1JDJA 3ON5A 1EVYA 4AJLA 2HMTA 4XDZA 1HF3A 1MG5A 3I52A 4U7WA 1LLCA 1R16A 1UAGA 3DBRB 5TJ9A 3RC7A 4E5YA 1HTBA 4B4OA 3OIDA 3UVEA 2Q1TA 1Y1PA 4MVJI 3F46A 3L07A 4F6LA 3PIIA 3E9NA 2VRCA 4YACA 3D0OA 4HV4A 1LTHR 3QLJA 5KJ1A 3NDJA 1EVJA 3HB5X 2J3IA 1VI2A 2EV9A 1LQUA 1CERA 1IHYA 3NTRA 2HO5A 2QZ9A 2V6BA 3QE3A 1PJBA 5L4SA 2J3KA 5AYVA 2AG5A 5L4LA 4DQXA 3H4VA 4GPD1 3I9KA 4NG5A 4WLOA 3GRKA 4E4YA 2B35A 2Y66A 4IDCA 3WXBA 5JFOA 3PEFA 4PGFA 1N5DA 2PZJA 2DKNA 1Y8RB 1PZEA 2CF6A 1DIRA 4IIUA 4NJOA 1GY8A 2BF7A 4CLRB 4YAJA 1A27A 1GAEO 2BELA 1V9LA 5F5LA 1Q7CA 3UCEA 3V2UA 1U7HA 2V65A 1U7TA 4RQTA 4NHEA 3C1TA 4EGFA 1KEVA 1GZ3A 3AOEA 4BV9A 4G81A 2VTDA 4XB1A 1Q7GA 4YJFB 3FCOA 1WVGA 5B4UA 4M87A 2Y1FA 3M1AA 2J5KA 1Y9EA 3GPDG 3PYXA 4KTTE 1NAHA 4IBOA 4TMFA 4YQZA 4E33A 3NDRA 4PG4A 3GEMA 1C0KA 1E3JA 1ZXBA 2AQ8A 3OBBA 3HDYA 1GD1O 5JDIC 3KOUA 4CL8A 1K5HA 2F00A 2Y93A 5HS6A 4DYDA 3B20A 4XEHA 3DAPA 1XU7A 3Q9UA 4OM8A 1G6KA 4AJ4A 1U3TA 1ZXLA 4FBGA 4CUKA 1HKUA 2P5YA 1E3EA 2DUUA 2P9GA 1EDZA 5IN5A 3WBBA 2AQHA 1P9LA 5I9LA 5IZCA 5CDSA 2EHDA 2TMGA 1GFSA 4OL9A 4CLEA 4E5PA 1U3VA 2E49A 1SNYA 4CM8B 4DPKA 4GVLA 3HG7A 4WGGA 2VOEA 4MIEA 5IDWA 1DC5A 4FIZA 1P33A 3ZU2A 3W6UA 5IXYA 3PHHA 1JKJA 4MP3A 1GCUA 2GRAA 1BGVA 1T25A 3KYCB 4E5NA 1ZK4A 1DHRA 1E7MA 3CIFA 2B0JA 1MP0A 4XR9A 1XGKA 4NPCA 3TZKA 3ZHBA 4CMIB 4NFHA 4DA9A 4PCVA 1W6UA 2ET6A 1P0FA 4CUJA 3LDHA 3G49A 4HNGA 2NADA 4UULA 5JS6A 3GEGA 4CQLB 1WPQA 4UVIA 4D41A 4P4NA 2PGLA 2NU7A 1B0AA 1KY5A 2EWMA 1N9GA 1DPGA 3IIEA 3ZNOA 2GDZA 3ORFA 5L51A 4M86A 3FNEA 2VHYA 3PHIA 4GMGA 3SLKA 1BXGB 1GCOA 2DPGA 4KUHA 4RF4A 3KUXA 4KOAA 2VNSA 1Y6JA 4A26A 2NVBA 1FF9A 1EVIA 3ZNQA 1NVGA 2J5QA 1H5QA 2EP5A 1SOVA 5TIIA 5U4QA 4I9NA 3RU7A 4D43A 4ILKA 5JYEA 1B8PA 1U4SA 1UXHA 1EMDA 1T1RA 4NI5A 4NJMA 5KNLA 1ZH8A 2B4TO 3JQFA 4TQGA 1OBFO 3BMQB 4IDEA 5FI3A 3SLGA 3OEWA 3ADOA 1VM6A 5DULA 3F47A 3F5QA 3W8FA 3WTBA 5TGDA 2AHRA 3ZV4A 3WYEA 2O48X 1VSVA 4GWGA 2ZCUA 5L53A 1QSGA 4CM4A 1ONNA 3U62A 1QORA 2DFVA 4CLHA 4Y8VA 4NU6A 4PLWA 2D4AA 2P2SA 3GGOA 3JQGA 4ID9A 5JAMA 1E3IA 2NM0A 4LK3A 3C7AA 1NVTA 4IJWA 3ZWNA 4M49A 4ALMA 3NUGA 2NLOA 5CEEA 4N5MA 3A4VA 3I3OA 1B3RA 3BMOA 4EBFA 4FFMA 2GSDA 3WLFA 2WM3A 3WQRA 3ZNPA 4S3MA 4DWVA 3ZZNA 2EGHA 4CR6A 1YVEI 3O8QB 3Q3CA 2RHCA 4RDIA 2I99A 1DIHA 1OZAA 4LRTB 4OHUA 1T2FA 3CZMA 1LLQA 1P1KA 4B3HA 3RI3A 3W1VA 5C5IA 3W4JA 3QWHA 1MFPA 4DPLA 4ONEA 2VYND 3WQSB 2ZYAA 5HRUA 2QYSA 5BQFA 1V3UA 4IPTA 8ADHA 2Y1DA 5BSHA 1H93A 3ENKA 4A10A 1RPNA 1ZJYA 5JE8A 3I6QA 2DU8A 1W4ZA 1SB9A 3GVPA 4GLLA 3JQAA 4NMHA 1X0XA 2O23A 2ZQZA 3DZGA 5HWSA 4R54A 1ADBA 4NK4A 1CJCA 3VZQA 4Y98A 5CHEA 1U2GA 1ZKMA 4O6VA 1P3DA 2VZ0A 4DIOA 1NQ5A 1HSOA 4BIIA 4EDFA 1DFGA 2O3TA 4JIGA 2IE0A 4HUJA 3VAZA 4BO0A 4CL3A 3OSUA 3VVCA 1E5LA 3UKOA 4XD2A 1AGNA 1EUZA 1C1XA 1GV0A 3PJFA 2V6FA 3ZWAA 3FI9A 4BGEA 2H6EA 4CV0A 1B15A 1PJ3A 4JP3A 5T57A 3LYLA 2QX7A 1OFGA 4BO9A 4FFPA 3NYWA 3WB9A 3PLRA 4W6ZA 4FGSA 5TX7A 1TA4A 1T4DA 3Q0EA 1NHWA 3M2PA 1IOLA 3DR3A 1ID1A 2PNFA 4CR8A 1H9BA 2I66A 3KTDA 1PJCA 4Y67A 4Z0HO 2Q2WA 2C2YA 1IL0A 3LQFA 5CDUA 3SVTA 2VWPA 3R3JA 1FDUA 3C7DB 2QRLA 2A92A 4L0QA 1XA0A 3ZU3A 4I1IA 3ABIA 1U4OA 2RAFA 3GUCA 4CMCA 3KHUA 3PGXA 3PQEA 1EQUA 5FF9A 3DONA 2R2GA 3NX4A 5AXAA 1MC5A 5G0WA 2UUOA 3GDOA 3GVXA 1CQIA 4GMFA 3ROPA 1Z7EA 1H9AA 2W2KB 2Q3EA 2CVOA 2EKPA 3OH8A 1DDOA 3E5MA 2NVWA 3JQBC 3ICCA 1P1IA 3DHYA 1VSUA 5KVCA 2BGKA 4U0JA 5AXDA 1JVSA 1PGJA 3KM0A 3NT5A 1E3WB 5ILOA 3AU8A 4AJJA 5A9SB 3KB6A 3LSYA 2O4UX 3FR8A 1D8AA 2VYVD 5A5FA 2EKLA 4E3ZA 3T4XA 4I5EA 3IJPA 4EUHA 1R4NB 1ZCJA 1H6BA 3T7CA 1AXGA 3FPCA 1DHTA 1N7GA 4PN3A 2OGUA 3NGLA 4R4JA 1PGPA 3ROKA 2O3UA 3ZWWA 1EE9A 3BMNB 2FR1A 4EYEA 1TEHA 3BMCB 4WLFA 3GDFA 3H9JA 1O89A 2CNBA 2VRCD 1X7DA 4E6PA 2BI7A 4CMEA 4CM7A 5HTOA 2PD6A 1DBVO 4ZQGA 4CR7A 1PZFA 2I67A 4MO2A 1A72A 4W7IA 3U4IA 4R01A 3RC9A 4JX8A 2PD3A 1I3NA 4L74A 3WGYA 4OKIA 1QYDA 5AXBA 3WG9A 4UUNA 4PZEA 5KJEA 4TWRA 1JLLA 5C3MA 1V0JA 1D7OA 4Y6PA 3PWSA 3ZU4A 1DJNA 3Q11A 4IINA 3PJGA 4AJKA 4I8XA 5CFZA 1YJQA 1Z74A 1JWBB 3UOGA 3GH3A 4GLOA 3SC6A 3S2EA 4WJZA 4BGUA 4QX6A 1Y5MA 3QHAA 1NFFA 2PY6A 4R1UA 1PR3A 3KVOA 4NBRA 1EBFA 2EJVA 2FPPA 4QSMA 4DLAA 2W98A 2X5KO 2YYYA 3U9LA 2ZB3A 3D3WB 3S55A 1OI7A 4QT0A 4WLVA 4OOEA 1GQ2A 3KYDA 1I3MA 1PJ4A 2JAPA 1HYEA 4EJ0A 2UYYA 4XRGA 2DVMA 3IOYA 2X7HA 1O95A 4DTIA 4QECA 3I5MA 4BKQA 1AUPA 1RJWA 5IJZA 3VTZA 3O4RA 1TT5B 1C1DB 1UP4A 5K0ZA 4W82A 3AI3A 4DUPA 2F1KA 5CPFA 4YJHA 3CINA 4AFNA 4YAGA 5H82A 1R66A 3ZI0A 2IEBA 3D4PA 4PG6A 2E6UX 3KZVA 2ZQYA 2YQ5A 4L4SA 3JYNA 4A2CA 1UUFA 1V8BA 3GF4A 3OHSX 3NJ4A 4R9RA 2P9CA 3PDJA 1V3VA 4FQ8A 2JAHA 3JD3A 1Y8QA 1HDYA 9LDBA 5C37A 1HYHA 4EUFA 2IYPA 4RPGA 2PKRA 3GN2A 3KETA 4WNIA 4JQCA 4YWJA 4ALJA 3QIVA 3C1AA 2OZPA 1U3UA 3HWRA 3JCZA 1PS9A 2HJRA 3GOHA 4PLHA 4J3FA 1ZMOA 2Q45A 3HSKA 4RZIA 4E13A 1OOEA 1ZO8A 3DZHA 2GLXA 4OJNA 3TZCA 1E7WA 5KJFA 1RYEA 3GR6A 4MIYA 1OC4A 3W4IA 4RZHA 5EERA 4LISA 4I5FA 3H6KA 4ZRNA 1T1SA 3PWZA 4GL4A 3WYBA 2BD0A 1NYTA 4KDFA 3WQQA 4WUVA 4Z9YA 2YHUA 2Y1OA 3TL2A 4RV9A 2OFPA 4O63O 5AOVA 1GQYA 3JQ7A 1JWAB 1WNTA 1YL7A 3UXYA 4KMSA 4RLSA 5IDYA 3CTMA 1UZLA 3RSHA 4IQ8A 4CODB 2FPIA 3JD2A 1J0XO 4DBZA 4FC7A 3F9IA 3S2IA 5U1PA 3CSDA 1NR1A 4B8WA 1BDBA 2HRBA 1LC3A 3O03A 2Z1NA 3OP4A 1DEHA 3FTNA 5DOZA 3SJ7A 4EJMA 4BO4A 3G1TA 1F8FA 1YS4A 2FZEA 2NNLD 2GR9A 4MDHA 4I9HA 1GADO 1UAYA 2HK7A 4IJKA 4WK6A 4ND4A 3ETEA 2ZTVA 3TZQA 2CDAA 2YQ4A 4H16A 2VYNA 3TPCA 2YDYA 2X9VA 3QWIA 2C2XA 4B7CA 4G5HA 1MA0A 1HDCA 1KEPA 3I1JA 2TMDA 3HE3A 4JN6B 2Q4BA 3H5NA 1GPDG 3WFJA 3MZ0A 5G0VA 1EK6A 4YVFA 3U4HA 4CMKA 3CUKA 4E30A 1MUUA 1NHGA 5ITVA 2LDBA 3G79A 1PJQA 3WSWA 3MEQA 4J7UA 5CG1A 3I83A 4GGPA 3PQFA 3I23A 1A4IA 3OF2A 3RKUA 5MDHA 3H3FA 3VDQA 1AN9A 3GEDA 1E6EA 3ROMA 4WCFB 4OXKA 3QVOA 4BGVA 3DMTA 4FB5A 3VTFA 1C1XB 1DO8A 4MINA 4FC6A 2JD0A 4BO3A 1PQUA 1XR3A 3SC4A 4GSKA 2JFHA 2O2SA 4DC1A 5IDXA 4YJGA 4IM7A 5THKA 3ZW8A 1EK5A 5CPBA 2W2LD 3P19A 5BNFA 2E82A 1H2BA 4DGSA 3RUCA 4QFCA 5U9CA 3FHLA 4NR0A 5HBRA 4J1QA 5HS4A 1LC0A 4GI2A 4KUEA 1GYPA 1NM5A 4TSKA 4Y6RA 3MCVA 3JQ8A 5JNLA 4QO7A 2C07A 2C7GA 2DPHA 1J6UA 3R0IA 4D3SA 3LT4A 1LDGA 3GRPA 4ZHSA 1UJMA 1NASA 3V8BA 4WKGA 2BLLA 3JQAD 4U6SA 5FEUA 3COSA 4BNFA 4CLOB 3X2EA 4J0EA 2EF1A 3UHAA 3DWFA 3WYCA 4C7JA 3UW3A 7ADHA 3OEYA 5L7YA 1JN0A 2WYVA 2X0IA 3TFOA 4IS3A 3B1FA 1GZ4A 4PG8A 3FWNA 1Y7TA 1TXGA 2ZTUA 3E9MA 4FJ0A 5I7FA 4AJHA 3PHLA 2JFFA 4XQGA 1E6WA 2AQIA 3WGGA 3D3EA 3R3SA 5ER9A 1X7GA 4AG3A 4B4UA 2VT3A 4J7CA 4J91A 5IF3A 2PZKA 4PIVA 3PYMA 3LT0A 1Z45A 4BNIA 2POQX 2AXQA 1SEVA 1LDMA 4DPMA 1KETA 5JO9A 4N5NA 1ZK1A 4BKOA 4HFJA 4IXWA 4L8VA 5DP1A 4XGIA 1KC1A 3V2GA 4LVUA 4CMEC 5A3JA 5L9AA 1VKOA 3PHGA 5TC4A 1R37A 2DTDA 1SZJG 1WDMA 2IYOA 4MVJE 4UEKA 3Q2IA 2ZATA 3FTPA 1VL8A 5JC8A 1D1SA 4PLCA 1EQ2A 4MVJP 5DOVA 2VYVA 4E2ZA 4BQRA 3ICPA 2XPCA 3H65A 1VE9A 2BFPA 5FI5A 3STHA 5A05A 3IS3A 3AY7A 1HDRA 5GY7A 5CG2A 3LT2A 2I3GA 2OP0A 1R4MB 3IMFA 1PZGA 4ND1A 1LDYA 3QY9A 3FNGA 2GZ2A 1OMOA 5DNAA 2Q1WA 1EEHA 2PKQP 4PLGA 1ZZEA 2B69A 4FFLA 3GZ4A 3G1UA 4RORA 4B79A 2PK3A 1YL5A 1C0IA 3FBGA 4W4TA 4TVBA 4J9UE 3H2ZA 1FDWA 4WLUA 3NTOA 1M2WA 3BXXA 1X1TA 5DN9A 5EN4A 1PWZA 4RVHA 2HCTA 4NBTA 2EG9A 3PK0A 5TF4A 4R3WA 4CM9D 3TJRA 4XYGA 2RH4A 3RUIA 2C20A 1YB5A 1M75A 1N8KA 1B2LA 3NRCA 1M66A 1NFQA 2CVQA 3FN4A 5KOIA 3MJSA 4K9DA 3JYLA 4IY1A 3DEYX 3AM5A 4OYRA 4UREA 4BKUA 1XKQA 4E0BA 3WIEA 2HDHA 1ZNQO 3U4CA 1BVRA 4NZ9A 4R1SA 1GL3A 1YOVA 2OUIA 5AQ1A 4YT4A 1NBOA 4P22A 2XOXA 4XYEA 1IULA 4YXFA 1UDAA 5G4KA 3GFGA 3WLEA 5JYDA 1P45A 2O50A 6LDHA 1Y5RA 3P2YA 4BNZA 1R0KA 4AICA 5JY1A 4J9VA 3ONFA 2Z5LA 2ZK7A 5DZSA 3HZZA 1VLLA 2Y0DA 2DFDA 4JJFA 2WTBA 3WMXA 2JD2A 1I2CA 4J43A 2NU9A 3RFXA 2UVDA 4RPLA 3CE6A 1JKFA 3FR7A 1IZ0A 3KEQA 3FD8A 5JMPA 3PZRA 3B1JA 4BV8A 4MKZA 2DQ4A 5DF1A 4CV3A 1VRWA 3B70A 3D4NA 3KO8A 3PDUA 4CPDA 4PVDA 1DRVA 1YBMA 1I5RA 5GZ3A 2Q99A 3D5TA 4AJIA 3VDRA 5THQA 1I24A 2HKIA 2IZ0A 4G2NA 4G65A 4TRMA 3AFMA 4BNKA 5A3VA 3DAFA 4RPHA 4B7UA 3W4KA 4E2YA 1S7CA 3MOIA 3I9NA 2Y0EA 2PH3A 4IJUA 4MP8A 1KBZA 3PVZA 4N54A 4DXHA 1XCBA 1SOWA 1DB3A 3L4BA 2AE1A 2YDXA 3EGOA 1H94A 3RKRA 1VKNA 3JQ7B 2I3AA 2JD1A 2X5OA 3JTMA 3BHMA 2YFHA 1YB4A 5GMOA 2Y1EA 2VUTA 3RWBA 1CQJA 1KYQA 4XIYA 5FWNA 2H9IA 1E7QA 3QSGA 2NSDA 3NJ8A 1WDLA 5A9TA 4GH5A 2HK9A 5HA5A 4MVJG 3P2OA 3DBLA 3ZWYA 4FFOA 3KV3O 2VOJA 3A14A 4TVOA 3EC7A 5TJHA 4FR5A 1YRLA 4MKRA 3PHJA 4DC0A 5J23A 3VHRA 3H5AA 2Q49A 2NTJA 4B3IA 2IRWA 4CMGA 1AE1A 3LK7A 5B37A 2Y0CA 3G3EA 3N58A 4OSOA 4Q9NA 1UR5A 2GYYA 3ULKA 4E5KA 2PV7A 2ZB7A 6ADHA 1U3WA 1UP7A 2ZIZA 4Y9DA 1PZHA 3DZBA 1Q2XA 3QVWA 1XDWA 3GQVA 3VKVA 2P68A 3OA0A 2V7PA 2O7QA 2X86A 3NT2A 3PXXA 4URFA 3ZNNA 3BA1A 1J49A 3ETGA 2FSVA 4RQUA 3RC1A 5I7SA 3WJAA 2UDPA 5BSGA 3EMKA 1C14A 1HDOA 4YR9A 4AJNA 4R41A 2OBYA 2QG4A 3QV1A 3A1NA 4GX2A 1E5QA 1X13A 3KBOA 4JGBA 4WASA 5BT9A 3OQ1A 2BFMA 1M76A 2DTXA 4F46A 5BSEA 1ZSNA 1PL7A 1PEDA 3ROQA 3AI1A 1QXSA 3MWEB 3TRIA 3KRTA 3WICA 3CZRA 4WLNA 2EIHA 2CUKA 3DTYA 5IG2A 1QYWA 2AEMA 4NQZA 2GASA 1Q0LA 1XWFA 4WE3A 4ZQHA 2EJWA 2PZLA 2FR0A 2R6JA 2QHXA 4BUCA 4ZA2A 2O4CA 3ZH2A 4KQXA 1P0CA 3LLVA 2W2LA 1GDHA 5B4VA 3JD1A 4W7HA 5TLSA 2IEDA 1EE2A 1I8TA 4K1LA 3JQ8B 1R15A 2HU2A 3PRJA 2GN6A 4TRJA 1HE3A 3FPLA 2CDCA 4XR4A 3AM3A 4RPKA 3H7AA 5I9MA 3RC2A 2WWRA 1ENZA 4BNGA 4CQMB 3CEAA 4XGKA 4TRRA 1G0NA 3PFWO 4XYMA 1NTOA 4FOSA 4YRDA 3ZWXA 3TN7A 1VJ1A 3IUPA 5BNIA 5L3ZA 3CMMA 1UXGA 3RUDA 3QWAA 4QQRA 3GAFA 1HYGA 3OJOA 2OP1A 3M6IA 5DCUA 4DQUA 1T4BA 5JDCA 1HDXA 1KIFA 3GZNB 3UH1A 3JQ9C 1OAAA 1L7EA 1YO6A 4XWYA 4F45A 1U8XX 4B4VA 4UVHA 1N1EA 3MTGA 2EW2A 3E8XA 3BIOA 2YHIA 2WD7A 2ZJ0A 2AW5A 4OXYA 4A73A 5IN4A 3HQ4O 3IP3A 3HDHA 4FW8A 1E0DA 1PWXA 5JC1A 1PJLA 4NDNE 1ISGA 1GQQA 3I9MA 3PFFA 4PLPA 5TSDA 5C7IO 3D64A 2C7VA 3DBHA 4NU5A 5GZ6A 3RIHA 3I9LA 3WNVA 1U9JA 1V35A 2HRZA 2DBRA 1O94A 1LI4A 3T4EA 3AUAA 4J0FA 4RVFA 5T5QA 3GC6A 2PA3A 4R5MA 4J4HA 1QMGA 1C0PA 1PGQA 1Z6ZA 2R00A 5CAEA 4FOOA 4Q3BA 5JCJD 4CV2A 5I9NA 1R12A 1IZ9A 4J49A 3VPSA 4II3A 1DIBA 1KERA 5ER6A 4D79A 4WOJA 4GX0A 4XDYA 3SJUA 1JU9A 4YPOA 4BMVA 4IMPA 2X9GA 3IAHA 1O6ZA 2GN9A 1TT7A 3FNFA 1WDKA 2NWQA 2OL4A 3QVSA 4MIOA 1T26A 4XKJA 5F21A 1DLIA 1GR0A 2Z1MA 4Q3EA 3U5TA 3RD5A 1PIWA 4EZBA 1P77A 3I4CA 1P1HA 2JCXA 4P4LA 3INRA 3K31A 1DAPA 1E1NA 1KC3A 3AOEC 4GWKA 4P4GA 4BNTA 3AM4A 1ZK2A 3GFBA 1QP8A 2BFAA 4NBUA 4BO1A 3GNQA 4OXNA 5T67A 1LNQA 1I2ZA 2O3SA 4KWHA 1KVRA 2X0NA 3G17A 3K5PA 1BVUA 4DLLA 1WZEA 1IHXA 1NNUA 1XHLA 1YDWA 3NGXA 4R3NA 1E7YA 4PG7A 4CM9A 2B4QA 5AVOA 3WR5A 4QUKA 1MXFA 4W9NA 2JHGA 3E1KA 4FJ2A 1XSEA 4HADA 5JCXA 2J6IA 4ZQEA 2DT5A 3ZV5A 4Z9XA 3GMSA 4Z6KA 4F3YA 1U1IA 2OORA 5IZCC 1RM5A 4H3VA 4RJTA 4J1SA 2VUUA 5L4NA 2X58A 4BNMA 2P5UA 3EUWA 4JP2A 1QV7A 1ZJZA 2X9NA 1ML3A 3DOJA 1ADGA 4OGWA 3H2SA 4BVAA 1KVTA 2VUSA 3RUHA 4BNLA 5G4LA 3ZWMA 1X1EA 4H7PA 1PJTA 5CEJA 5JBIA 2NVUA 1FDTA 1H6AA 2FMUA 2ILTA 2PKQO 2Z95A 1EFKA 1F17A 3EYWA 4D45A 4R68A 4OIMA 4EEXA 1YQXA 2PFGA 4Q3AA 3OMLA 1E77A 2ZJ1A 4HXYA 3MJVA 5KVQA 1YGYA 4JBIA 3RROA 4I9UA 5ITWA 1MB4A 1ULUA 3AU9A 1TI7A 3AY6A 4MKXA 3H9QA 4XYLA 4OO3A 4XJSA 2IZZA 2FOIA 5IXSA 2HMUA 5G0SA 1CDOA 1VL0A 2Y1GA 3HDJA 4TKLA 3DOCA 3DTTA 1LA2A 3WX0A 5K6AA 2WJPA 1Y81A 2UV8A 7MDHA 4GKBA 4HY3A 3C24A 3F1LA 3IKTA 3S8MA 3BHJA 1H0KA 2C29D 4GX1A 1GEEA 5EJ2A 4CMBA 2OBNA 3IJRA 3NKLA 2CMDA 4Z3KA 1WW8A 4D3DA 3L9XA 3MJTA 1LSOA 1DIAA 4KDEA 1ISIA 4L9RA 1E3SA 1YONA 2B83A 2FN7A 1MX3A 3GMDA 4FSHA 1I0ZA 1PJSA 4LVCA 1N1GA 4O59O 3QA9A 5EQDA 3X2FA 2HK8A 1N9GB 3DO5A 3JQFC 4O5OA 4W99A 1H2HA 4IUYA 1Y8RA 2ZTMA 2P4QA 1YQDA 4J2HA 4OMUA 3ST7A 3V2HA 4ZGWA 5DBFA 2OXIA 1K3TA 1CWUA 3O26A 3O38A 1GYRA 2PTGA 3ZCXA 3VZSA 1LSUA 1BRMA 1UZNA 3INTA 1JVBA 4AVYA 4YJFA 4NJMB 1NR7A 1X15A 2DLDA 4TZKA 2G1UA 1VJTA 3IKVA 4Q39A 4TZTA 2AA3A 3RUFA 1DJQA 4YEDA 1FMCA 4PLYA 4E2WA 3C3XA 4YA6A 4E32A 4BKRA 1YWGO 4MVJD 1O0SA 3AWDA 5JAQA 4CM1A 4CM3A 4CM4B 2HUNA 2J3JA 2VQ3A 2W4QA 5TT0A 3RCBA 3JQDA 4LSWA 1JQBA 1NP3A 1XEAA 1SAYA 3JQGB 3OICA 2SCUA 4RF3A 2AEJA 5JSFA 3WGIA 2X23A 2QW8A 1BDMA 3ZWCA 4RO0A 4CJXA 4DYVA 1B7GO 1P1JA 2Q1UA 3AFNA 3JSAA 4LMRA 4XA8A 2AQKA 1HWYA 1GV1A 3BMOB 4JXKA 1LXCA 5B4TA 1VC2A 4CM8A 4I5GA 1NQAO 5CDTA 3R1IA 2PH5A 4KQWA 5I8ZA 4BNNA 1Z75A 2Q1SA 4M89A 1O9BA 2FR8A 2FWMX 5ADHA 3GLQA 5KIAA 3NEPX 3ZN2A 1B14A 1JAXA 5IDQA 4EJ6A 5L40A 3KSDO 4LCJA 5F1KA 5DCWA 3KYCA 3K2EA 1PS0A 5A06A 4FFNA 1YJ8A 1FDVA 1BXKA 4CMIA 1LLDA 1RKXA 1JA9A 3C8MA 2B5VA 2BGMA 4E21A 4BMSA 4OAQA 1S6YA 1B26A 3FF4A 1A7AA 3L6EA 5EQFA 2DUWA 1U2DA 5DCYA 3JQAB 2E48A 2HSDA 3QQPA 1DLJA 3WMWA 1YQGA 4XZ3A 5BSFA 1HSZA 3MJEA 2X5JO 3EZYA 2PWZA 3PP8A 4XJTA 1E7RA 3TQHA 1QYCA 3ZDFA 1BXGA 1SBYA 3HFSA 1BG6A 2LDXA 2PD4A 4GQAA 4YJDA 1CRWG 2R00C 2A94A 4GGOA 4PLFA 4ND2A 3E5RA 4YT2A 4DRYA 4IDGA 1CF2O 3VPGA 3EY4A 4ROSA 3PWKA 1LU9A 3AUUA 5EL0A 4YBZA 4AJEA 4JBGA 1E1KA 3K2BA 1WAMA 4JCOA 1RM3A 3BMQA 2GO1A 3GNTA 1QG6A 3U4DA 1LSJA 4LGVA 1DRWA 3U09A 2NTVA 5H83A 3V1YA 4GKVA 1LDNA 4ZRMA 3R6DA 3ZGYA 3DQPA 1M6WA 2JFGA 1RM0A 1PX0A 3GNSA 3V1TC 4A0SA 3QP9A 4FCCA 1LDBA 3DZKA 1T2EA 1K2WA 3AUSA 3H5RA 1QLJA 4B8ZA 3ZWOA 1WLYA 3Q6IA 4XX0A 4J6FA 3QVXA 5JCJA 4RGBA 3M2TA 4FS3A 4WCDA 2HMWA 3MJ4A 1LRLA 1VJ0A 4EEZA 3C7CB 1HETA 3MWDB 4I08A 3HB4X 3ETDA 3ZV6A 4UVEA 3AOGA 2AG8A 3JYOA 2Q2VA 1PGOA 3L77A 2DBZA 2X22A 1LLUA 5MGBA 2H1SA 3A06A 2I9PA 1SEPA 3OQBA 5F1OA 1BMDA 4PLTA 5A03A 1LEHA 4YYZA 4NBVA 3P7MA 3IP1A 1I3KA 3TNLA 4FPXA 1H6CA 1EFLA 3OECA 3LZ6A 1J4AA 2D5AA 4YAKA 3H8VA 4R51A 4II2A 4LW8A 4KWIA 4Z0PA 1YXMA 2ZB4A 3QJ5A 3DZJA 4TROA 4ZN6A 2CD9A 1NXQA 2BH9A 1PJ2A 3RBZA 2I76A 4PVCA 2G5CA 2H5LA 1I32A 3JQEA 1X7HA 4LMPA 1I36A 4UUMA 4ZQFA 3EVNA 3ZWVA 2VHXA 4IDDA 5COBA 4IZHA 2HMSA 1K6JA 2QZZA 1PGNA 4Y6SA 4YQYA 1DFHA 4F6CA 3WNQA 5COQA 4ZQBA 3QVTA 1K6IA 3LLSA 5EESA 1IE3A 4UUOA 3ZHYA 2WYWA 5ENVA 3JQ6A 5DBIA 2CZCA 2RCYA 4U5QA 1DSSG 4ITUA 1I10A 2YJZA 2XF8A 3RJ9A 1UDBA 2O7SA 5CDYA 1Y9AA 3UUWA 1MFZA 3LC7O 2GGSA 4HX5A 2VTEA 1IUKA 1EBUA 5COAA 5EPOA 1SB8A 3WGHA 3RUAA 3EAGA 5F3RA 3E18A 4YTEA 2XAAA 1TVEA 4NIMA 4BOYA 3WIDA 1D3AA 3TZ6A 1HRDA 5ILGA 5ES3A 2VWGA 3HADA 3WGZA 3E9QA 4AJ1A 4C4OA 3NT4A 1BXZA 2BRUA 2PLAA 1BW9A 1NX6A 2CSUA 3W8DA 4BO7A 4BO8A 3DFZA 1Q1NA 4CMAA 5G0UA 3V5NA 1PL6A 3D4OA 1WWKA 3KYDB 3LC1O 3RFTA 3SEFA 1F12A 2GUGA 3H9GA 5F1PA 3RQSA 2AE2A 3GN1A 4D3FA 3TL3A 4D46A 3N7UA 4JK3A 3NDIA 4KZPA 4MPDA 4MOWA 1ADCA 3K96A 2I5PO 3PZBA 3KLPX 2ZYGA 4LSMA 4K6FA 4YJHB 2FPGA 2Y68A 4DMLA 2C59A 2W2KA 3RVDA 4CM6A 1KY4A 1HDGO 1PQWA 1WXDA 4BGIA 1KS9A 1PR9A 4WECA 3RASA 3TZHA 1EUCA 3FWZA 1UXKA 2JJYA 1I2BA 4WEOA 3E6AA 3HN7A 1YE3A 4XQEA 1KVSA 1DC4A 4J1TA 1E3WA 4Q3CA 5A9SA 1Y8QB 2Q50A 5A02A 3PGJA 3BTOA 1QRRA 4HNHA 3FBTA 3WWZA 2PGJA 2RHRA 3OA2A 5TQVA 5CEFA 2PR2A 2XXJA 4BNVA 3TFQA 1R4NA 1CETA 4B3JA 2DM6A 3RBXA 1ZK0A 3F5SA 5DP2A 3JQBA 1LUAA 4RCVA 3E48A 3LU1A 3ANMA 3QWFA 3RFVA 3VH2A 2FHSA 3I4FA 4OSPA 4A7PA 5IAAA 4PFJA 3BMNA 1R0LA 3BMCA 4WNCA 4WEQA 2VHZA 4J4TA 4YRAA 1QYXA 2WDZA 2A35A 1V6AA 3DAGA 4KP7A 2JCYA 3EZLA 5TT1A 4C7KA 4MVJA 2WE8A 1XYGA 4QFDA 3D5QA 4HFNA 3IQDB 2A4KA 2VZ9A 4U8GA 3SX2A 1HXHA 4UEOA 4PZCA 4H15A 4R1TA 3WWYA 4ZVVA 3H3JA 2P91A 3GGPA 4L75A 4J7XA 3UICA 1SC6A 4B4WA 4D7AA 5L7TA 2EERA 1Q0HA 2GCGA 1PSDA 3C1OA 1OC2A 4BNJA 4Z0TA 2D59A 3ONEA 5JPIA 3PLNA 4N7RA 1W8DA 4J4BA 2HMVA 1ISHA 4JLWA 4FN4A 1YKFA 4N18A 1NWCA 5JW6A 1ZSVA 2C54A 2CDBA 3BAZA 3NTQA 2RH8A 3BTSA 3D3WA 5IZ4A 3OFSA 4LN1A 2GD1O 1ENPA 4RF2A 3WGQA 1ZSYA 3JYQA 1X0VA 2EEZA 5C7OO 5KCZA 1K0UA 5KKAA 1TT5A 5A4DA 1C1DA 3DMTC 4GSLA 1IPEA 2IODA 2B4RO 2PZMA 4IQ0A 4OOFA 3UN1A 1HLPA 3UGKA 4NK5A 1L7DA 1BHSA 2B5WA 2EP7A 2NQTA 1QKIA 3ADPA 1F14A 1MGOA 1GPJA 3TF5A 4ZJUA 3WBFA 1DOHA 3AY3A 2GN8A 4IDAA 1NFRA 3QW2A 4XQ9A 1VL6A 3LF1A 3CH6A 1WMBA 1LJ8A 1NVMB 1KOLA 4PZDA 5DDIP 1KEWA 3L0DA 2WEKA 2ZB8A 3HUDA 3JYPA 2FY8A 3GHHA 5FYDA 2ZCVA 1GUZA 4MVJM 3FSRA 2D3TA 3EDMA 4YJGB 1HZZA 2G76A 1UP6A 5H81A 2BMAA 4OKNA 3U49A 2O2YA 3TOZA 5JO0A 1NPDA 3AW9A 3S2GA 1U28A 1ZEMA 4BB6A 3NAQA 3H9UA 4CM5A 9LDTA 3L9WA 1AXEA 3PQDA 5B12A 2HQ1A 1YH3A 1SPXA 4BNUA 1LQTA 3OETA 4J16A 4NH4A 4ZICA 4O0LA 3I9JA 4L4RA 2BGLA 1YB1A 2IXAA 3QWBA 4YDRA 2J8ZA 1KVUA 1PL8A 3IUSA 1Q7BA 2PGDA 4M1QA 3HDQA 1YBAA 3AI2A 1P74A 1HEUA 2B37A 4M55A 5I7EA 4X54A 4J2OA 2YUTA 1MG0A 4IXTA 3VPXA 1A9YA 3PJEA 1JW9B 1YDEA 1UZMA 4HP8A 3GDGA 5LDGA 4BKPA 4BS9A 1Z7BA 1B3BA 2Y1CA 1YL6A 2P4HX 3OIGA 1E6UA 1XQ6A 4M8SA 4EI2A 3DC2A 4XGNA 4E5MA 1E3LA 2V6GA 3ZWPA 1QLHA 1I3LA 1J5PA 3AJRA 3CXRA 4RLHA 2D1YA 4GVXA 4IDBA 2IDZA 4U0KA 1GUYA 3S1LA 1ZIDA 1T24A 1ZVMA 3PI7A 3KLMX 1ZK3A 4IS2A 1A71A 2B36A 3GAZA 3DMYA 3RJ5A 4PLVA 2NACA 4FFRA 2GZ1A 2DAPA 2OHXA 1PTJA 1ZW1A 1ZFNA 1A9ZA 5ICSA 2Y99A 3GA0A 4HBGA 2NTNA 1LRJA 3OIFA 4RDHA 3VZRA 4Q3NA 3EVTA 3WGOA 4DMMA 2C5AA 3OJ0A 3W6ZA 2VCYA 4CMHA 2FSSA 1KVQA 4TKMA 2D5CA 5JLAA 5T8KA 3HN2A 4YB8A 3D7LA 2NV6A 3JD0A 4NNJA 1UH5A 1IYZA 4WCFA 4AJOA 5TRTA 4JNKA 1I01A 4Q3DA 3DDNA 4WPGA 4A27A 3UF0A 4E12A 1B8UA 3VKUA 3K30A 4RPJA 3K9QO 4E2XA 4WOKA 1T2AA 4J90A 4BNYA 4DL9A 4DLBA 5JAIA 2ZKLA 3BYZA 3LT1A 3GPIA 2YV2A 1XIVA 1ISMA 2NU6A 4PRKA 1NAIA 3WSVA 2BHLA 4BNHA 5LCXA 4WLEA 3DHEA 5KKCA 1JTVA 1PS8A 2C0CA 5G0TA 3BTVA 3HHPA 2ZYDA 4AJPA 5L45A 4CQMD
chains in the Genus database with same CATH superfamily
1C7IA 1T0PA 2V7WA 2HSJA 2LRHA 2WFAA 3HUFA 4G8CA 3SICE 1RAAA 5FYQA 4WXYB 1KEUA 2R8ZA 2HRQA 3DYBA 3FZEA 4KQEA 4DYHA 4QTZA 2PSHA 2REQB 1YE8A 4FFDA 1I33A 3I45A 4UJ5A 1DRJA 1BW9B 3DXFA 1BWSA 1CRZA 3O3MB 2VRBA 1DWPA 3HKEB 3PPIA 3HYNA 1N2ZA 4XRRA 4YRSA 1CS0B 4PF1A 3OIVA 5KQRA 2FZGA 1GCAA 1ZM4A 3E9EA 1ORTA 3GG9A 1O6CA 2C4HA 1MNAA 3LWZA 2W6JA 4IVPA 3RBVA 5HSGA 3QUBA 5IFLA 3SQLA 1C3OB 2CLMB 3GG2A 5A5GA 4BO5A 4DMFA 4F1JA 1EVEA 4JP1A 1JU4A 3ECCA 3L7MA 4GU5A 4KE6A 1LF0A 4IUCS 5B1YA 3UT5A 1RI3A 1M83A 3NAMA 3ZCUA 1UXIA 2CB9A 3ZEIA 2ATEA 2WWWA 4E22A 5KYGA 3CEHA 4YUWA 4BBAA 1YULA 3MGAA 4IMRA 1MW9X 3OZXA 1QYVA 1J06A 2C8LA 3DYVA 3LYUA 1DT3A 4C43A 1SCUA 1SBTA 3MWGA 4K9QA 2WYOA 4Q1VA 3EZGA 3T6KA 5HK9A 1M67A 1PK9A 2GN2A 1R8QA 1HZJA 5AXCA 5A0FA 4DIBA 2I65A 3WK4A 1OE0A 2NYUA 1X80A 5CB8A 1UK8A 2IOFA 2FWAA 4IJVA 5EE0A 3JD4A 3TSZA 3OPYI 4EGAA 3IL2A 3GLIA 3C5CA 4Z3DA 2OECA 4BB0A 3FFWA 4URYR 3K32A 2ZIAA 1ZAKA 1BS1A 3EQ9A 3IE2A 3MTEA 5A2GA 2LCFA 2I1VB 4LY9A 2JGMA 3TDNA 1WZIA 2RGAA 2ZUUA 1W73A 2GAFA 3FCYA 4PY2A 4TL6A 4DREA 2V0GA 3P27A 2P9BA 1ZN8A 4F8YA 3VPHA 3ZW9A 4RVUA 3F6YA 3BG5A 2ZIFA 5FAKA 3EPKA 2B8EA 2FDXA 3IAAA 5TEVA 5JAUA 1SURA 1FP7A 1R0XA 1ICIA 3D0QA 1R4MA 2CB0A 3ISVA 4Y2PA 5FA6A 4D0NA 1S9DA 4HF7A 4N01A 1WVMA 4IKOA 5LYJA 1CIVA 5TQ2B 1YBFA 4FX2A 3F3KA 4W5HA 1ZMTA 1RRPA 2BM9A 5FOWA 3T95A 4CQNA 3U3XA 5AOAA 1EDOA 3MJRA 5CVVA 2I1WA 1HT3A 1Q1EA 3HA5A 4EF6A 5JARA 2RBKA 3GV0A 3MBIA 3PD0A 4DY4A 1K6EA 1I1QB 1ZOSA 3O1HB 3C5HA 5GZ1A 3DCNA 1NA5A 1HMPA 2ZYSA 2A9FA 3NKFA 3NKVA 3BB1A 1JQKA 3D6VA 4UMVA 4YCAA 3B3FA 3KPVA 3WLNA 3V1NA 4MRVA 3OUZA 3DBLB 4BNWA 4PX3A 1RJDA 2ZT7A 3ZQKA 5L7WA 1UDCA 4GMHA 5I8WA 3GRCA 1IJKA 1PQYA 1H1DA 2A0KA 2JCBA 2J5RA 1CEQA 4X6YA 5AM5A 4MGHA 1XA3A 4EG1A 1T6XA 1UBNA 2QQGA 1YQEA 2XVAA 3MBOA 4MQUA 5CLGA 5AKIA 2X19A 4EIWA 2WJHA 5I6DA 2I6FA 3O92A 4L4XA 1M1YA 5AESA 2AYXA 3D3NA 2GARA 2G25A 2I4MA 3NRJA 4NJEB 1E2FA 3NOOA 4PYOA 4D9BA 1J25A 2BFWA 2IXBA 4M9QA 3FWPA 4M38A 2WWIA 3KZNA 5CP8A 3WS7A 3F73A 5HM8A 4JC5A 3WYBA 4E5UA 3I6IA 3NBXX 4UVGA 2F1HA 4ZU3A 1U0BB 2XGJA 1MC4A 4M99A 4HWKA 4G0WA 2L0XA 1TNDA 4GZMA 4R2XA 3L93A 3K73O 3EZ9A 2C82A 2GYWA 3QUSA 5FNVB 4EGQA 5K0TA 1PL0A 2Q2QA 3IODA 1W87A 3PVCA 3TQSA 3GCXA 2DKOA 1JHXA 3L6DA 4PGHA 2PS9A 4US1R 3FGZA 1QQ6A 3MCAA 3LQKA 4IFTA 1D2HA 4O29A 3SZRA 4EHAA 2KMLA 2F67A 4XX1A 3G1WA 2X8LA 3A36A 3RU2A 1DXYA 2BCEA 3GHYA 3LC2O 4KE9A 2JGDB 4P5DA 4URVR 4C4AA 2Q8QA 2F3SA 4PS0A 4URWR 5DX1A 3WRXA 4BVJA 1EHYA 5IBQA 4BO2A 3NHYA 3TUZC 3ZDBA 2HADA 5JZMA 1P7CA 1N0HA 4GZ5A 4RGYA 5I7RA 2PMCA 4HFRA 1OCEA 4Q48A 4GMXA 2FMFA 1XD9A 1AGPA 1TCCA 1DJPA 4C89A 1EVZA 4EITA 4UTOA 2AUNA 4R1NA 1B1CA 3C39A 1TQ6A 1J56A 4PNZA 2I34A 1NZJA 1OB2A 1FYXA 3VR4D 1QAQA 3ZVMA 4KUGA 4AB1A 4P7KA 3JPYA 3EIOA 4UVDA 4MGKR 3KOOA 4R0VA 4DM4A 1L5GB 2Q9UA 1TK9A 2HDOA 1HE4A 2OOSA 5HZHA 5JDCC 5JOQA 3AEUA 2IQ5A 5K9ZA 3CRRA 2PKEA 2O8CA 4QO8A 2VP9A 4UNPA 3UB2A 2A9JA 2QDXA 3U4GA 4E5VA 3IIKA 3T5AA 1QB7A 4I46A 3O4GA 1FJGB 1A2QA 3DDHA 3PUWA 1JLRA 1JG7A 3SYMA 2CZQA 4OLAA 4IO1A 3UWPA 1IBCA 4JJGA 5CLFA 2CCJA 3T7IA 1EB8A 1SD1A 4C1NA 1XALA 1Q77A 3UJ9A 2MMCA 3NFRA 3ONDA 3QMPA 1POXA 2WSBA 2ZROA 3DE2X 3U0BA 1BX1A 1E1MA 5HQ3B 3MWLA 4MW7A 5T6BA 4CQLA 4UZEA 3DFUA 4DQVA 1C7JA 2FW8A 1GDDA 3RVMA 3VYWA 3Q2KA 1W94A 1SIBE 4D0RA 3MJCA 2HAEA 2VZ8A 3NAZA 1PTJC 1Z8HA 4G5QA 4D0SA 3S1SA 4RVDA 1G16A 4ZAVA 1ZI9A 1SU4A 3SE0A 3IBYA 4M1ZA 1CUDA 2YHIB 3KXDA 2H16A 3DL2A 4R40A 2GK4A 1OYWA 4ZVLA 3WTCA 4COOA 1TAQA 3R9KA 1APBA 4RTPA 2NXJA 4DVJA 3F3SA 2IBMA 3AIOA 1IVSA 1V8PA 4NZMA 2WA1A 4HH4A 3MINB 4WW0A 4IH4A 4URHA 5JQGA 2D2FA 3QV2A 3CUUA 3N8KA 4JYMA 2DBQA 3DWGA 4BC0A 2H8KA 5HW0A 1EWQA 1QIGA 1KAGA 3H1FA 3DEKA 5FNZA 4BQPA 1K86A 2JAUA 4GE3A 3LFUA 3KTAB 4IWXA 1M10A 3IHTA 4N47A 3ME5A 1XQYA 3N3AC 4LJKA 1SKMA 1NVFA 2L19A 4M2LA 3ZLTA 3SQDA 3PEVA 1JH9A 1FQOA 2PAAA 1IY0A 1TEXA 4J1NA 5C3UA 3D7NA 1P1RA 4DHEA 2MU1A 2XDQB 3Q1LA 1RI1A 4KIUA 3DHNA 2PUAA 2L42A 4MSUA 3ESZA 4RMJA 4YRBA 4FOPA 2YMLA 3R2JA 5J1SB 1WSBA 1E66A 1RRKA 3B1YA 1XRSB 3NUZA 3QU2A 3LF2A 3ZBQA 1WKCA 1ISFA 1I3OA 2OCBA 1MH9A 2VBCA 2FLWA 2YIVX 1T9BA 3FUUA 1S5PA 3L8HA 4NYMQ 4BFVA 3HXMA 1HE2A 5JMWA 5LMNB 1JT9A 5E3JA 5AI6A 3D2CA 1ZEJA 1V5FA 4BQFA 1SIOA 4HKTA 5IVKA 4R2IA 2OHGA 1U0GA 1EVLA 2VHEA 3KXLA 4ZT4A 1W8IA 3A4YA 5ED4A 3G8YA 4CMJA 5KVSA 4C76A 3FROA 2VDWA 3L79A 3TLJA 2JLCA 1XU9A 3SF8B 3O8QA 5DSXA 1MV8A 5IAKA 1KFEB 1SMKA 1GTMA 1W0CA 2IHVA 4Z9FA 1YACA 4B6JA 1OI2A 4BO6A 3ZX4A 1CULC 4FGWA 3HO8A 3FWHA 2GEJA 1NWHA 1G8JA 2EARA 1J97A 1DTWA 5IJAA 2QRJA 2YZ7A 4KAAA 4MI3A 4W8OA 1OGJA 5DTRA 3A1VA 5KTKA 1IBSA 5AUNB 3ZDDA 2B78A 2Q3DA 4DLKA 2FU5C 1TF2A 3CKLA 4DV2B 4MAAA 2IGBA 3BKWA 3QEMB 1U5BB 1TIKA 3H7IA 2GCEA 1V1RB 4R9NA 3TW6A 5LU8A 3GGGA 3U9SA 1XTBA 4HMPA 2C5EA 5FP0A 1LZKA 3CX6A 3CKYA 2Q07A 3JQCA 4ZVRA 1OFTA 2OGTA 4IIFA 3A9UA 3GPCA 3QY0A 1CE8A 2FZCA 4QFMA 4YAEA 2JL1A 1N78A 2UU9B 1RT9A 2C9YA 2PMBA 5IWCA 2XIQA 3Q9NA 4PRYA 1IZZA 4R9SA 2C2HA 3UGTA 4XVQA 4K9MA 1NW4A 2QN8A 2WF9A 2X0RA 2ZSUA 1H23A 4LMBA 4BNHA 4MDEA 1Q6YA 1FEZA 2Y05A 2WHQA 5BN5B 2YV1A 2AI2A 4PFKA 4DMUB 1LDEA 5KJ6A 3IJ5A 1G4HA 2PBZA 2W90A 3BHIA 2A5DA 3N74A 3SBOA 3VR4H 1EK2A 2I4OA 2GCNA 4EUEA 5JY6A 3HB0A 4RVSA 3EXHB 2X6TA 3DLTA 1IB0A 1T13A 2BFCA 1WTCA 1Q0UA 1DJLA 2BLNA 3EVZA 1JKIA 4R2WA 5TVKA 3Q98A 5CM8B 1WS6A 1ZWLA 3NW9A 1XVIA 3JQ9A 3CKMA 3ESQA 4ND5A 3H2GA 1JKXA 2NVUB 5I45A 1SZDA 3DD1A 1KI2A 5K6AC 2PZ8A 1W88B 1HLDA 1K7YA 1R4AA 3MJFA 3WNZA 1JRLA 2HRCA 4NU8X 5CLLA 3ZWBA 1MXHA 2LBPA 5AK6A 3DCJA 4QODA 4Z1MD 3LVRE 3K6JA 4HH0A 3NBMA 2B7LA 4FSXA 2YFQA 2VDNB 1DMRA 2C2GA 2H9AA 1T4CA 2YXNA 4MQFB 5BYBA 4WZBE 1ABBA 1T2CA 3CQ9A 1JDJA 4N48A 3QX8A 4G5YA 1GPUA 4PC3A 1B4DA 4WFIA 2IEZA 3BXOA 5THXA 2CJWA 3FNQA 1E3DA 2BJVA 3EF0A 5ABPA 5C1BA 3DBRB 1UAGA 1LWOA 4Q7QA 2ZVJA 3SAJA 3EPHA 2AWNA 1J24A 1RWWA 2IE8A 5PGMA 2FGKA 1PEAA 3ZX5A 4MVJI 1RE1A 5FOXA 3LXMA 5AVKA 1RLOA 3E9NA 3PIIA 4JC4A 4YACA 5J2UB 3MBKA 2J0UB 1A8QA 3D0OA 4O25A 3RK0A 5H8WA 1G18A 2VTBB 3HB5X 2RHHA 4WAUA 1L4MA 4X3CA 3VX4A 8GPBA 1IPHA 1YOBA 3QE3A 5K8JB 1ZS9A 2V7GA 1GARA 5FUXA 1NR5A 2WJYA 3SIPA 2AG5A 3H8JA 4OH7A 4QYIA 3LUGA 1I4LD 5LA6B 3I9KA 4CKWA 5BSTA 3FSJX 4FDTA 4IDCA 4JAVC 4ZKEA 5A6SA 4CEJA 5ADWA 5JFOA 3FHOA 2B8NA 2PQ0A 3PEFA 2AHOA 4D96A 2K7FA 3KTOA 4KFRA 4D4MA 1JFFB 3Q9SA 1Q21A 4MXDA 4DWWA 1A27A 2YJNA 4B87A 2HFJA 3PUIA 4EF5A 1Q7CA 4R8KA 4UTNA 1FFCA 1OH6A 1G6Q1 3F6CA 1KO1A 4L95C 2QSYA 4NHEA 4G3XA 2CLKB 1ND6A 4PBTA 1GZ3A 1FFAA 2AD1A 2GO7A 4G81A 4UHEA 2C61A 2IYUA 2G1JA 2V74B 2C57A 3GMIA 2JLVA 4MV9A 4U4AA 2LNDA 2ZTSA 1F6BA 3QXHA 2FFRA 3I0NA 3MB5A 1Y9EA 3WNCA 5A4AA 5G1OA 1HV8A 4YQZA 2C8KA 3CUEF 3N0WA 4M60A 1I80A 3AKEA 3DF7A 3GAAA 4PWYA 4LE2A 4PG4A 3KLBA 2O2CA 1ZXBA 5IWAB 4NECA 1Q22A 4NE9A 3W5JA 5JDIC 3KOUA 3DE1X 5JXIA 3MOSA 4PYQA 2TECE 2Y93A 3I8XA 4Y1GA 5T3UA 1S2GA 1NLUA 4M3NA 1OXVA 4EG3A 4CCYA 1SQFA 2HYDA 3IHKA 2VSFA 4RC9A 3ZHTA 5IU6A 3PEWA 3HFRA 3SP1A 2CE2X 1YZTA 4WKBA 5LOVF 1VIMA 1K98A 4B6EA 2PUEA 4C04A 1ZXLA 4OHRA 4CUKA 1F3OA 1NN0A 1E3EA 2BMWA 3CLVA 3GCDA 4LXGA 2WFLA 3DWEX 1H9CA 4IHAA 3WBBA 2AQHA 3F49S 4UCXA 3KPYA 2QX6A 5IZCA 3STYA 4DDMA 1E9EA 3E3OA 3UK2A 2XOKA 4GMKA 4BX8A 1SNYA 3GYGA 4DPKA 3A6HA 5ETJA 2VOEA 3COZA 2XZTA 3Q85A 4UD2A 3LCVB 3GCZA 1DC5A 1SHKA 5TQ0A 3ZU2A 3LI2A 4IGIA 4R6WA 5AUQA 2Q7DA 3FTQA 1GCUA 4LI3X 4MP3A 5H59A 2H2WA 1VOTA 1E7MA 4X1YB 4UHDA 4M22A 1VSQA 3ZHBA 2X14A 4IDPA 4NFHA 3EN0A 3OX3A 2HJHA 4AECA 2VBIA 1M73E 1ZJJA 2C7OA 2J9ZB 3GW8A 3ZJVA 5GJWC 4EJFA 5D6OA 4LJLA 3T0GA 4HNGA 2C78A 4UULA 4FNAA 4JYAB 4R1QA 3N2NA 2WT8A 4LTDA 1P6QA 1S2NA 4UVIA 4RGQA 3I5UA 4GMDA 4LMAA 3UV7A 3TUJC 1SOAA 1RE0A 1XNHA 2GBLC 1TVCA 3ELDA 5BXYA 3GFRA 4PZPA 1KY5A 3IIEA 5L51A 2JGRA 2ZRPA 3ZNOA 1K68A 1X42A 4PZYA 5BQ5A 2FEMA 4ZVKA 2XQKA 4GMGA 2DFLA 5I47A 3TBFA 1FA9A 1Z0KA 2QZSA 1GCOA 2Z1DA 3P1JA 4KUHA 4LE0A 4QEKA 2VNSA 1Y6JA 3E22A 1FSZA 4MLPA 4YO7A 5EFZA 3ZNQA 1FF9A 3GYBA 2J5QA 1J8DA 3PDIA 4FHEA 4KQ6A 1XCLA 4KQHA 2GWRA 4MRPA 1FSFA 1UIRA 3JASB 1R0BA 3KJHA 4RFSA 4KVZA 4FX5A 2CYCA 4D43A 1C2YA 1U2RA 1QCZA 1U4SA 1BHJA 2VA8A 4OHPA 2WP8J 5HZGA 4RTSA 1Q7EA 2MHCA 1ZH8A 3LNTA 1QAOA 2YL2A 2BEVB 2O2DA 1DQYA 1XLTC 5JNWA 5DULA 3HBAA 3W8FA 1N2CA 2VJMB 3U16A 1VSVA 1YB2A 2WV7A 4GWGA 1MOZA 2Q4TA 4LXXA 2ZCUA 2QWXA 1ONNA 2YHSA 4PR3A 1QORA 4ES6A 1KE1A 4CLHA 2YINC 1BWPA 2WIAA 3Q3JB 2KBFA 4MB2A 2EW1A 5SZKB 1E94E 1U8CB 4WH0A 2ZKIA 3N0RA 1Q1AA 3KR1A 2AUMA 1QG2A 3F4KA 2XWQA 4BZXA 5CBPB 4NMMA 5I3CA 4ZCRA 4LK3A 2BPOA 4IYRA 2OV2A 1NVTA 2QQFA 2YMMA 1K75A 2ZBRA 4REMA 1QIMA 4TKZA 5TMEA 1UJNA 4URZR 2NLOA 4F84A 3WGNA 2G1AA 1B3RA 1JLMA 2JLUA 2YWGA 2GSDA 4FFMA 4YJ3B 3WLFA 4DMHA 4DWVA 3MELA 1D2EA 3QUTA 5E9AA 3F90A 4CR6A 3I28A 3EX7C 1TO2E 1ZNWA 3UUFA 2WP0A 5BQXA 1DIHA 1JI0A 1OZAA 1L5QA 3D59A 5AKXA 5TARA 1P1KA 2EWVA 4KVGA 5ECYA 4B3HA 3O3OB 3DEAA 4DPLA 2X4IA 1U94A 3DTVB 3DBIA 3I42A 3L4EA 1CUCA 5HRUA 2QYSA 2G83A 5JCZA 1V3UA 4HSEA 1M2OB 8ADHA 5BR4A 2W9XA 3ELBA 3MRTA 4OYHA 2RC5A 5CLIA 5BSHA 3PLAE 1JDPA 2B98A 2VDUE 3CUVA 3ENKA 1DS6A 4A6XA 4O4JB 4AP5A 1ZJYA 3N87A 4ZARA 3VOTA 3LL4A 3I6QA 3ZIAD 1T3LA 2B61A 3GVPA 3T7TA 4NMHA 2D5IA 1XEXA 1SXJD 3FJ1A 2O23A 3IAM6 4HNSA 4CT4B 5HWSA 4QBIA 2VQDA 1ADBA 1PN3A 3LX5A 3K9LA 1XFDA 2GESA 4NK4A 4L3OA 1CJCA 3UMCA 4RTKA 1VGRA 2MINB 1PFGA 1ES9A 2FSPA 5CHEA 4IQ4A 1Y98A 4B7AA 3EJ6A 1BCSB 3QLTA 3SI7A 4RTRA 1ZINA 3KDSE 1IRIA 3IO3A 1VG9B 3M4JA 3IA7A 1HSOA 2PUTA 4REQB 2EL7A 4BIIA 4EDFA 4X66B 5D3ZA 2MYPA 3TSYA 3T5CA 5DN6D 3IEPA 1V5EA 1COWA 4HYYA 1GR1A 3UKOA 2ZWMA 1CKEA 4XD2A 1AGNA 1EUZA 1OX4B 2GAAA 1M54A 4EUSA 4IIEA 1PUIA 3ZBUA 5CB6A 1G5HA 3AB3A 2V6FA 1RBYA 3D7RA 3ZWAA 2C5BA 2GVZC 4Y7DA 4CV0A 2CNLA 4Z1OA 5T57A 1YNOA 3LYLA 2QX7A 3UA3A 3AR7A 4FFPA 2FEWB 5F9MA 3VC3A 3WB9A 4W6ZA 2Z3VA 2VAVA 5FA8A 5K99A 5HIMA 3DQZA 1Y7IA 3LY5A 4L9WA 5TX7A 1T4DA 3UMFA 2C8JA 3G9ZA 4FLMA 3EY9A 4Z7JA 1G8GA 2WY2D 2XBUA 3M4XA 1G5TA 4HQKA 5K0BA 4KHPB 3KJZA 4FDVA 4CR8A 1NNEA 4Y2VA 4Y67A 4Z0HO 3ZYZA 1BN6A 3FWYA 4FYHA 5JV5A 2Q2WA 4ETWA 5CDUA 3HDTA 3LY9A 3SVTA 2CBXA 2VWPA 1U0LA 3R3JA 3URKA 2W4MA 3C7DB 2DX7A 1CFZA 1UBUS 3OMXA 2VHQA 4K03A 1Z22A 1SC4A 2ZE7A 1KFKB 1LPNA 1XA0A 4L0QA 1GPH1 1C3LA 4DLUA 4CMCA 3Q72A 1FP4B 5F9HA 3F67A 3PGXA 1EQUA 4JYZA 3BWEA 1SD2A 1OZHA 4BQIA 5B1EA 2H0AA 5K05A 3DONA 4C07A 3JXEA 5G0WA 3BWMA 1U31A 3DB1A 1T6YA 1X94A 4WXMA 3GVXA 2OCDA 4BDSA 4KDCA 1CQIA 2C4WA 3ROPA 2PLNA 1LB1B 4DY6A 4Q4HB 2C77A 4KO1S 2GZRA 4L0DA 2EKPA 3GCWA 3OH8A 2CW5A 3AVPA 2A1UA 3BSWA 5K0CA 1EUCB 3AG5A 3TIVA 1VSUA 5B1IA 4LF6B 2Q5JA 4XPIB 4II7A 4DADA 2VKQA 3ADBA 2M32A 4RAOA 5G3ZA 1WB9A 1JDSA 3OOSA 1KZ6A 4AJJA 5A9SB 2C0PA 2PPLA 4I1YA 4AF7A 2W00A 1AS0A 3IB6A 4H7KA 4EFNA 3KB6A 3TI7A 2O4UX 4C3OB 3ZHVA 4URUR 4F8JA 4RFVA 2FEOA 4B3DA 3IR5A 5LXTB 1PR0A 1QJ4A 4EUHA 5BWBA 1H8HD 3BZWA 2V03A 2QUAA 1C1HA 2I6UA 3FPCA 3FPGA 2B8TA 4NV0A 2EBHX 5HE9A 1RQPA 1UFRA 2XUPA 5GWXA 1CB7A 3VR3A 4ZREA 2FZVA 3ZWWA 3P9XA 1L5HB 5JD3A 3VSAA 1L8QA 1FTYA 1WXFA 1RYMA 3SZUA 2CNBA 2VRCD 3LPCA 1RXUA 5EIHA 4E6PA 2BI7A 3AVQA 3I5YA 4CM7A 1XEWX 1DVRA 2X5NA 2QLTA 2D2EA 4X94A 1DBVO 1K7EB 3D3JA 1PZFA 1XCPA 5KREA 4GW3A 4MO2A 4RVCA 4QFBA 5KNBA 2ONZA 2ONKA 3U4IA 1WMSA 5CHYA 2LE0A 3U9TA 4B3BA 5BMOA 4L74A 4LOKA 2YNMA 3BD7A 5AXBA 1QYDA 1OI4A 4BMPB 1NG9A 2R8BA 3L7YA 1SHJA 4TWRA 3S28A 3A25A 3UJDA 1V0JA 3BRCA 4Y6PA 4DCNA 3HXPA 3ZH9B 3BFXA 4G9BA 3VI3B 3Q11A 3PJGA 5CFZA 1Z74A 3IKJA 1JV2B 3A26A 3LZCA 1IBRA 2HHLA 1WUJS 3AR3A 4GLOA 3S2EA 3SC3A 3TOCA 2M6KA 3ZZ1A 2WC1A 4BGUA 1R0CA 1SBZA 4C3ZA 1Y5MA 3GGJA 3RTGA 4RMNA 3L40A 4R1UA 5EXTA 4G23A 3B6EA 3DDOA 2EJVA 4QASA 3CX8A 3CUYA 5IYZB 1SOMA 3U9LA 4F1WA 1RJ9A 2ZB3A 3D3WB 4RMGA 2ENWA 5D01A 3RRXA 4WLVA 1I3MA 3OMWA 3OZEA 4A0FA 2ADOA 2JAPA 4EJ0A 1D03A 3JVUA 3VUFA 1A1VA 2BT4A 3OE5A 4BKQA 3WRYC 4L50A 1RJWA 1ACLA 4Y0NA 3S40A 3VZCA 2OZLB 7YASA 1HX7A 1WABA 5CVCA 2QP3A 4KGXA 1RSZA 2CHQA 3K5WA 2G9VA 2MYTA 1PFQA 2J59A 2FPUA 2QGNA 1F2TA 2RHLA 1UJ2A 3KKQA 3NNDA 2V7XA 3AVOA 5AJTA 5E8JA 3WK5A 4LDPA 4QUGA 2PS1A 2RE8A 1P73A 1MIHA 1YR8A 1RIFA 4A2CA 1L5WA 2ZZKA 3WMEA 1GLGA 3TSOA 2QD3A 3ECSA 2AZDA 3PDJA 4ANFA 4MHTA 1V3VA 4H1TA 1FZTA 2JZNA 2J0SA 3D31A 4LPSA 4PSVA 1R2QA 5B1SA 9LDBA 1FFXB 2G8NA 5L3QA 6PFKA 4TYWA 1GA4A 1OX5A 1XMPA 1CUIA 2A4MA 3L1UA 2QJTA 4A6DA 5AW7A 1DKNA 2PUDA 1EFVB 2PKRA 3GN2A 2E1RA 3V8RA 4J16C 4WNIA 3TQOA 4R0NA 3Q40A 4JQCA 3FNBA 2DSTA 3ORQA 2XX3A 4KXXA 4DJJA 3E7DA 3EWIA 4QRHA 4TKUA 3QIVA 1QGUB 1U3UA 2OZPA 2R84A 1Z18A 4G1FA 3ENZA 3I72A 1P2DA 3GOHA 1Y6QA 4C03A 2IIBA 4XVHA 2A8YA 1L5FA 3IT0A 4E13A 3OEED 1I5OA 4YQEA 1M0EA 4I4TA 2JFXA 4LJ6A 2B6HA 2P9HA 1FRQA 4N7JA 5FI0B 1CJUC 1WCXA 2XCUA 4MIYA 4A8JA 3F0TA 2GFQA 1CF9A 4WBNA 2HTEA 3UZUA 2F1IA 5C51B 3PWZA 1HA3A 5F1YA 1Y80A 2BD0A 3QFFA 5DX8A 2DWOA 1RC0A 2OKGA 1CVLA 4KDFA 1A9XB 4S1TA 3AERA 1K6MA 4TYQA 3IQHX 3L0IB 1E4VA 5AOVA 2EG5A 1WNTA 3WZLA 1KWKA 1UZLA 3HNOA 3C3MA 2WJ4A 3Q0TA 4IQ8A 1OIVA 3RFUA 4UHFA 4DBZA 1XPRA 4K2HA 1ULAA 4FMPA 4QYMA 1XMSA 3M81A 2G36A 1VMDA 3KOWA 3QFSA 3C1UA 3CSDA 1NVUQ 1LC3A 2OENG 1PUXA 1M33A 2IV3A 4WXEA 3U7EB 4KITB 5EJ8A 3RDPA 2BR4A 5FWXB 1T6NA 4LUCA 3R4VA 3EGEA 4BJHB 5IMSA 2R8YA 5FI1B 4BFTA 2H1HA 3C14C 4F4JA 1E8DA 3RPEA 3PCRB 1YS4A 5TXGA 2FZEA 1YDFA 4D99A 5K0FA 2GR9A 1XZFA 5AJZA 1A9OA 4L1KA 4GNRA 3ZHRA 3UPTA 4IG4A 4ND4A 1QP4A 4XLTA 3FMFA 1A88A 3KOMA 3UGJA 2IY8A 4EO9A 4ZEMA 2CDAA 2O05A 4H16A 3R7BA 3KG2A 1JLHA 1RU3A 3E9CA 4MVYA 4YRPA 3SFVA 3TPCA 3GQBA 1JAIA 4MA5A 4EHIA 2X9VA 1WPRA 4YFVA 3QWIA 4D8YA 4D98A 1SBNE 4G8DA 2Q29A 4LZZA 4BQQA 1YIAA 3AR4A 1HDCA 1QIKA 2HJGA 3AZPA 5AJYA 1W0KD 5AOCA 1J90A 3IUJA 4RA9A 4HQ0A 2P6MA 5AOBA 4D3ZA 1GPDG 1EK6A 1MU0A 4E30A 2JCGA 2LDBA 3QVMA 4DUYB 2A1IA 2YMQA 2EKZA 2AOTA 3OF2A 3RKUA 2Y1WA 2FX5A 3FSEA 1E6EA 4ZT5A 3ROMA 4INJA 4HAOA 3VTFA 4FB5A 4XVCA 1C3EA 4KQFA 4MINA 4CFZA 5HKKA 5K0LA 1XR3A 4UNIA 1RJGA 2IS4A 3F98A 2GCIA 2V5AA 3JR7A 1PCXA 4YJGA 2QTLA 1YASA 3MFQA 3O8OB 5JSZA 4JB0A 4DCPA 5KS2A 5DNEA 1IFXA 4J94A 2IEGA 4NEHB 5K0JA 1OLUA 1M2KA 3HO6A 2WUWE 3P19A 4C6SA 4XVUA 5JNSA 5BNFA 3K94A 2O8DB 3QF4A 3RUCA 5IMBA 3AFIA 1VJCA 5DIFA 1PQ4A 3SYLA 5U9CA 2NXEA 1VPWA 4FXOA 5BW4A 4DMRA 3IR6A 1X8LA 5HS4A 4GPZA 4ESVA 1X9IA 3QBEA 4LOIA 2J3MA 5DNWA 5K03A 1N8TA 3FW1A 3I34X 2BFEB 3U7FB 4KUEA 4NCKA 1NM5A 5HIIA 4M7PA 1IHUA 4WTOA 2C7GA 3QLVA 4RMHA 4EM6A 4D3SA 1SQ0A 1XB2A 1LDGA 2AR0A 2G08A 3FZYA 2M2IA 1OBHA 4ZHSA 2IS1A 2MSNA 1XK7A 4A91A 3CX3A 4QRDA 3QQ5A 1V1MB 2BLLA 3JQAD 3RH0A 5FCDA 3VVMA 4L07A 4A92A 1IBKB 4J3NA 2PYDA 2XQFA 4YYEA 3N2IA 3HNRA 2XB8A 3LH5A 4LOJA 2IPMA 3UK0A 1TD9A 3UHAA 3UJNA 3B6MA 1OYYA 2DE0X 2L69A 1UKCA 2Q0SA 2DERA 3DWFA 3WYCA 4C7JA 5HVNA 7ADHA 1WMFA 1ZIYA 1JN0A 2I7DA 3O1JC 3SS9X 3UT5B 2XA2A 2Z3ZA 3GFVA 3ORHA 2OV8A 5PNTA 4C4XA 4M88A 1Y7TA 3C5VA 2ZTUA 5DTIA 2BUBA 5IM5A 3U61B 5I7FA 1ZQ9A 4AJHA 3PHLA 2KWIA 1SKUA 1E6WA 3WGGA 4U02A 3I04M 1U1FA 3D3EA 2A9QA 1YK1A 4HDOB 3OD5A 4TS1A 5ER9A 1HYBA 2I2WA 3UAOA 4UOZA 4PIVA 2RD2A 5AW9A 4EO4A 1JBKA 5AICA 2N47A 1GNVA 2POQX 3UAZA 1EE1A 1LV8A 2AXQA 3ZY3A 3AR2A 4DPMA 3U19A 1KETA 2YFYA 1O94D 2NAFA 1NW5A 2DG2A 1X80B 1ZK1A 3LCMA 3LK6A 3B5EA 3NC0C 4I4IA 4MLCA 3AVWA 3V2GA 4LVUA 3GLIB 2OV4A 4U5XA 5JJBA 4HGNA 2IYOA 1WDMA 2V9ZA 4UEKA 3PGVA 1T6BY 2ZATA 3DKRA 3FTPA 5IT0A 2W6NA 1O7JA 1ZGHA 2BZ1A 1D1SA 3AFHA 3CB4A 4MGYR 3TGPA 3G8BA 4CGYA 1OV6A 1ZNZA 1EQ2A 1IONA 4MVJP 1KORA 3IH5A 2OZKA 3FYDA 2VYVA 4QD3A 1IM2A 5KNCD 5JWHA 2BZSA 821PA 1VE9A 1U0RA 2BFPA 5DHPA 2IV2X 2XMGA 2YV5A 3IS3A 5LWHA 1ORWA 1ZIOA 4D2IA 3BVPA 1T34A 1VBFA 4LZPA 4O1HA 2Q5HA 3OI7A 4OJYA 2NQ2C 2OP0A 4CU5A 2QTGA 1R4MB 1X87A 3O2NA 3R5FA 1RXSA 1E1RD 3R76A 3JW8A 3TL6A 1LDYA 2OHHA 1ZH0A 5LZ7A 4UCQA 2I91A 5LKAA 2CYBA 3VSEA 4ZOBA 2XMRA 1DBWA 4AROA 1CF4A 1OTHA 1EEHA 2C5FA 2QNRA 4M9UA 4BE4A 2OB2A 3TW8A 1L3IA 2YXDA 3GEBA 4M9XA 4Q1AA 2NZUG 3GZ4A 3KAKA 1I4TD 3R5HA 3P8ZA 4NHOA 1RYBA 4PYRA 1XF1A 4U2EA 4R2HA 4ZEXA 5D86A 1L4FA 1GSIA 1YL5A 4LFBB 3GZJA 2R97A 1US8A 1O58A 3FBGA 3Q2OA 4W4TA 2Q6KA 4J9UE 2JEYA 1BXRA 1FDWA 2B1GA 3I9V6 2OEPA 3R6LA 5LDDC 2GFHA 5DN9A 2ZIUB 4BV2A 1TUBA 4Q9IA 1PWZA 4QOJA 3OU7A 4RVHA 1YAJA 1VQ1A 2Q9BA 4QKQA 1CJKC 4CIWA 1R64A 3M6AA 4EY6A 2KM1A 1RKVA 3BDIA 5A5VA 4S2EA 3AR8A 4EHLA 3C6YA 4GOMD 4XYGA 1MC8A 3ZHCA 2C20A 1LCIA 4EA8A 1YB5A 4K9NA 4TTSA 4DSAA 1JXAA 3HZHA 2W0SA 3WHLA 3EOZA 1E2BA 2AFHE 2CVQA 2CVHA 4BFYA 3EVCA 3JYLA 4BKUA 3DEYX 4H17A 1T4MA 4YXWD 1GTL1 3L8YA 5AKLA 4P2GA 3WIEA 4JU9A 2Q5OA 2OK8A 2B4KA 3U4CA 3EFHA 5K45A 4K9PA 4LC9A 1C9EA 4M0FA 3LDAA 1RP7A 4O08A 3UW1A 4IW3B 1QFZA 4YT4A 3PU6A 4P22A 4EY5A 1IULA 2BFBA 4L6AA 1YKSA 2P1ZA 3ADDA 2YZ2A 4GR4A 3LUFA 2ZXFA 4KQIA 1ZICA 5EUMA 1CJSA 2GTPA 2HXSA 3WLEA 1NVVR 4OEHA 1CZRA 1Y5RA 3BPSA 5GOTA 4EO7A 2IPXA 2ERXA 3HY3A 4QWWA 1KDYA 3TLGB 4AICA 1S9HA 4BLRA 4BNZA 5JY1A 2WU8A 1IJBA 5BRJA 5JNUA 4F06A 1NW6A 2WTBA 1USUA 1FXWA 1H66A 4E1VA 1I2CA 3T54A 1D4OA 1QH8A 1CUGA 1WBBA 1B41A 2E6KA 2QMUA 1WPXA 1OUMA 3H6HA 1KJZA 2FQQA 3HN6A 1L4HA 5D5HA 1IXRC 2XIJA 1RQ2A 3C8HA 3RIEA 1IZ0A 1G63A 2CBGA 4HS4A 5JMPA 3HJNA 4B76A 4OG2A 5LQRA 1LS1A 3B1JA 3ISJA 4J03A 4BV8A 2GJ8A 4R31A 4R8SA 4WOPA 1EFUA 2VDJA 3R3WA 2X2EA 3KO8A 4LYDA 3ZKWA 4C2BA 2WIDA 3PDUA 1KMCA 4PVDA 1YBMA 1I5RA 1XKXA 3HLTA 1QK5A 1WEKA 1BQEA 4UU8A 3D4LA 3M0EA 3UWDA 4GFDA 1VXRA 2HKIA 2RG1A 3BK2A 4IJ5A 4OYLA 1RAHA 3MIIA 3REFA 4BNKA 2AC2A 1Y63A 2I78A 1H0RA 4RPHA 3ZCSA 4N4AA 4S12A 3AEUB 2BHSA 1HOTA 3U26A 1ZONA 3MOIA 3VPBA 4TV9A 4RPIA 2JAXA 3A4IA 4MP8A 2O8CB 1KBZA 3NH9A 4N54A 1PP4A 4B7ZA 4ETNA 2ZT8A 1L4EA 4J0JA 3JQ7B 2BEUA 1JQ5A 1L4YA 4DLVA 3G9QA 2X8JB 4DRZA 2JS7A 1NUTA 1X1QA 3ANSA 5B2ZA 1S0UA 2R7KA 4ML3A 4P3PA 4Z99A 5HQTA 3RJTA 2AV6A 2H9IA 2C7PA 4JMLA 4UM5A 3NJ8A 4XFJA 3L05A 1WDLA 4PO9A 4CI0B 4WVLA 4QM6A 2HK9A 2QR5A 4US0R 4QATA 1UBLS 3TLZA 4RBNA 1QUEA 2HSZA 4FFOA 3A14A 5FFMA 3JQPA 4MR8A 2V6IA 1QTQA 3L0BA 2GMWA 4HWRA 2EJCA 2Z2YA 1AHPA 1F0KA 1NBEA 2D74A 3PF8A 4KXYA 3EH1A 1NMXA 1YRLA 4FP9A 4FR5A 4AMVA 5J23A 3PQ2A 3VHRA 1ZGAA 3PE4A 4NCNA 1CJBA 2YVAA 2QTNA 5KNDA 5KNCH 4B3IA 2IRWA 2IUFA 1SXJC 2ATIA 4HEHA 3VZDA 1SA0B 5ARBA 5BVGA 3V4ZA 4B8YA 5JQGB 1FYDA 2ES4A 3IVMA 4HXGA 2GYYA 4Q9NA 5CIQA 3ULKA 3CLTC 4E5KA 4M1WA 2IYVA 3WIOA 1GZ7A 1U3WA 1Z39A 2I62A 3FPFA 3ASYA 4P7GA 3CZQA 4F3KA 1XDWA 3CF6R 3VKVA 2P68A 4XWTA 2XMQA 1TJPB 3HYCA 3NT2A 3PXXA 4BVBA 1JA1A 1JJIA 3BA1A 4JMPA 3ETGA 4RQUA 4M0EA 3RC1A 2VJDA 3ROGA 2JFBA 2UDPA 3WJAA 4GRAA 4AWAA 3EMKA 4P7BA 1ZP6A 3SR3A 3WO1A 4YR9A 3J7AC 4FHCA 4MMXB 1RBMA 2WVGA 1D4ZA 2O0KA 4R41A 2QG4A 3QV1A 1MOQA 4B71A 3KBOA 4WASA 5BT9A 4QU0A 2I55A 2L82A 3UHJA 5BSEA 4NRDA 4DV3B 2PUBA 3I9FA 3MWEB 1SHUX 5BWOA 1JHPA 4PSKA 3HC7A 5CK4A 1XNQB 2PKCA 1QYWA 1E9SA 1TZJA 1P4GA 1SVWA 5GTDA 2GASA 3NMUF 2YXLA 1E2IA 3QA3E 1Z35A 4UC0A 4WE3A 4IX1A 1G3IA 1GGEA 2YC2C 1SC3A 3E27A 3HBLA 4K05A 1XZJA 3T94A 4G97A 4O4LF 2VFAA 4BUCA 3VBCA 3LDFA 1NNI1 3FVQA 4P3YA 3W79A 4EG5A 2M9MA 4ZA2A 2YJTD 4KR0A 4KQXA 3LLVA 1JR4A 1XMXA 3FZGA 3WYDA 1GDHA 1GXSB 1S8FA 1TD1A 2JFOA 2XR1A 1O96A 1P5RA 1ZJ4A 2RHTA 2VDMB 3A6ZA 5DH9A 5TLSA 2GXUA 1EE2A 1WNFA 2FMXA 2K2QB 1S4QA 3H8SA 1R15A 1UPAA 3PRJA 1DTWB 4TRJA 4B5KA 3D6FA 3GLHA 3I2GA 3E0QA 4PEVA 4XR4A 5SYMA 2JLWA 3H7AA 3QZUA 4KK3A 4XE5A 3VXKA 2H2GA 5DGDA 3VR2D 2IBSA 5HIKA 5IXJA 2A1TS 3VKGA 4B09A 4YRDA 1CQWA 2ZI3A 1VJ1A 2OKCA 3IUPA 5BNIA 5DEIA 1GKYA 2DT8A 4C0BA 3NOXA 1UK6A 3KWJA 1IBMB 2QOEA 1PLJA 5CDHA 4QGGA 1IG3A 2TSYB 3UC5A 1HYGA 4BLVA 2OP1A 4DQUA 4ZIRA 4BP1A 1P2SA 5AHXA