3B1FA

Crystal structure of prephenate dehydrogenase from streptococcus mutans
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
290
structure length
286
Chain Sequence
AAAMEEKTIYIAGLGLIGASLALGIKRDHPHYKIVGYNRSDRSRDIALERGIVDEATADFKVFAALADVIILAVPIKKTIDFIKILADLDLKEDVIITDAGSTKYEIVRAAEYYLKDKPVQFVGSHPMASGAVAANVNLFENAYYIFSPSCLTKPNTIPALQDLLSGLHARYVEIDAAEHDCVTSQISHFPHIIASSLMKQAGDFSESHEMTKHFAAGGFRDMTRIAESEPGMWTSILLTNQEAVLDRIENFKQRLDEVSNLIKARDENAIWAFFNQSRQIRKNME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of prephenate dehydrogenase from Streptococcus mutans.
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Oxidoreductase
molecule keywords Putative prephenate dehydrogenase
total genus 95
structure length 286
sequence length 290
ec nomenclature ec 1.3.1.12: Prephenate dehydrogenase.
pdb deposition date 2011-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02153 PDH Prephenate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3660.10 Mainly Alpha Orthogonal Bundle 6-phosphogluconate dehydrogenase C-terminal fold 6-phosphogluconate dehydrogenase C-terminal like domain 3b1fA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3b1fA01
2B5WA 4QEDA 2J8ZA 5G0UA 5IXSA 1X7DA 4H15A 4CMGA 1N92A 1PQPA 1V0JA 2Y1FA 1IPFA 4NPCA 1I36A 2D8AA 4H7PA 4XQGA 3GEGA 1GD1O 1RKXA 2IXBA 2E4AA 1UZNA 1HE3A 3EMKA 3ROMA 5JCJA 1DLJA 1E7QA 5AOVA 5A1TA 5TLSA 2P9GA 4CMKA 4IDGA 4QO7A 2V6MA 1EE9A 3HN7A 2Y68A 3D4NA 1H6CA 1TB4A 4II2A 4XRGA 2VRCA 1PS0A 2GNAA 1OC2A 1ZMTA 3NTOA 1RWBA 4FFOA 2EP5A 4ND4A 2Q99A 4UUPA 1XEAA 5TT1A 4B3HA 2O3SA 4F46A 3C7AA 3MWDB 4HBGA 3FSRA 3L4SO 1U2DA 3ASUA 1ZK4A 1PJ2A 3ZU5A 2D2IA 4W82A 4DPKA 1E92A 3PZBA 4BNTA 5T67A 3WIEA 1U3TA 3HN2A 4N7RA 2DTEA 3IKVA 4EBFA 3L6EA 2GUGA 1MFPA 3F5SA 1LRLA 4BVAA 3RAJA 1PS8A 2O2YA 4UUMA 1BXKA 1K6IA 3GF4A 2C82A 5JXWA 4J9VA 4EI2A 4E5MA 2A9FA 5A5FA 2IEBA 3K6JA 3L6OO 4NJMB 1YOVB 1ZJYA 5JE8A 1CDOA 1BG6A 5I7SA 1J49A 2FMUA 3OQBA 3HDQA 1UAYA 4GX1A 1UZLA 4ALJA 3G0OA 2HK9A 1VC2A 2Z1NA 1ZK3A 2YFHA 3WBFA 4IM7A 5JMWA 2GZ3A 4NI5A 3K31A 4BNYA 1UUFA 1Z73A 4IJUA 5A9TA 1ISHA 1Y5MA 3HDYA 1VJ1A 4YYZA 1LQUA 2W2KB 3JQAB 3E03A 3L4BC 4J1QA 1C0LA 5ER6A 1SO8A 4XIJA 1HZJA 1MXFA 3GNTA 3ITDA 4J7UA 5EERA 4R41A 4D44A 1HZZA 1ULUA 4ALMA 4PVDA 1HDYA 1M76A 3D64A 3NGLA 4PRKA 4I8XA 4Y6PA 1LEHA 1YE3A 1X0VA 4NFYA 3ZGYA 1ZO8A 3OJOA 2GRAA 1NXQA 1PJTA 4R1UA 4MVJP 3BTUA 1GCUA 3ONDA 3PRJA 4DYDA 4XIYA 4Z0TA 3GLQA 5JDIA 4LW8A 4YJHA 4L8VA 1P1KA 5K6AC 1DC6A 2Y67A 4WKGA 4CM8B 1I2CA 4U8GA 5AXCA 3RC2A 1DAOA 5CG1A 3FCOA 3TZHA 3OIDA 3G17A 3BZUA 3N74A 4YR9A 1BGVA 2J5KA 3BTVA 3OA2A 2QZZA 2W2LA 4QXMA 1B2LA 3PZRA 1OAAA 2OHXA 3NT5A 3ONFA 1WLYA 4DLAA 5ICSA 2WD7A 5H81A 1UZMA 3GZ4A 1EQ2A 4RVSA 5COAA 3M2TA 3S8MA 4AJHA 1U8XX 3O38A 2ZIZA 1QORA 3GZNA 3NRCA 3WGZA 3D4PA 1KS9A 2CMDA 5JAMA 3AUAA 1ZXBA 1EVJA 1ONPA 4Q9NA 5GY7A 2ZYDA 4EJ6A 4AJ2A 4J2HA 3FNGA 4UUNA 4LRSB 1E5LA 1ENOA 3C3XA 3TDKA 2XOXA 3PIIA 3OM9A 4ND3A 1UXHA 1SB8A 2H1SA 5G4KB 1T24A 1YL5A 3T7CA 3BMNB 3WOHA 4BV8A 5B4TA 4OSOA 3P7MA 4UEJA 4NBTA 4MIYA 3CH6A 4HNHA 5CEJA 4D46A 4Y6RA 2UV8A 2P68A 1K3TA 4J0EA 3B70A 2X0JA 3PJFA 2X23A 1NAHA 2O3TA 4FW8A 3JQGA 2JL1A 4GSLA 1OMOA 4NBUA 2EW2A 1G0NA 4GX0A 3UCFA 2JFHA 3DZBA 4MIEA 1XLTA 3IKTA 1PR3A 1D7OA 3E9NA 3PQDA 4D45A 2ZB4A 4S3MA 4YACA 3ZW9A 3X2FA 2C5EA 3AFNA 4J1SA 5IN4A 3DQPA 2CY0A 2H9IA 2EV9A 2NU9A 1ISJA 3STHA 4IDBA 3GGPA 1MUUA 5A06A 2BGLA 1QRRA 4DIBA 5A5EA 1GZ4A 1B3RA 1FDWA 1NWHA 2WYUA 4L75A 4LVUA 3SXPA 5MDHA 3I6IA 4XYGA 2WYVA 2FR0A 3KUXA 2RHRA 1MG0A 1KEVA 2CVOA 4RDIA 4KWIA 3CINA 2VUUA 3QVXA 4DYVA 3Q9UA 4HUJA 5BR7A 3JD2A 2CZCA 3FR8A 3M6IA 2YUTA 3LVFO 3GEMA 3K2EA 1SNYA 1CJCA 1EE2A 1WWKA 1GEGA 3NEPX 2X22A 4MP3A 5JCXA 4JXKA 3MEQA 3TZKA 1M67A 2RIRA 2BFPA 4XWYA 1PZHA 2GPTA 5ILGA 4PLZA 1JN0A 1NAIA 4BMNA 1VL6A 2X5JO 3H6KA 1LLDA 1JTVA 3DXFA 3EHEA 3F1LA 3FPLA 2ZQYA 1IYZA 2POQX 4O1MA 5A3JA 1B3BA 1T1SA 3BXXA 3V2GA 2Q1TA 4D43A 3C7CB 3LF1A 1MLDA 3R3JA 1FDTA 2I66A 3WFIA 2B4TO 5G0WA 3I9NA 1JQBA 3GUYA 4LK3A 4I5GA 1A4UA 4OJNA 4RF5A 1UDAA 2D1YA 1HE4A 5G0VA 5C7OO 1IL0A 2G1UA 2QG4A 3PQFA 1E6UA 1GFSA 3RUCA 2FPGA 5K6AA 4EUEA 4UVIA 2YJZA 3WGOA 4GGPA 3V2UA 1DJQA 3BMNA 1B14A 4ONEA 5JO9A 4ALIA 1LLCA 3L0DA 4QX6A 2EJWA 5CG2A 1HEUA 3I9KA 4XB2A 1SPXA 4RZHA 5JYEA 1WDLA 3DZGA 1T2DA 1ID1A 4Q3AA 4LVCA 2Z5LA 3ZWNA 2HK7A 3UOGA 4J9UE 3SBOA 3DAPA 3MZ0A 2P9EA 4FC6A 1GZ6A 1HE5A 4IGEA 3KBOA 4NJMA 5IAAA 1U7HA 1JDJA 4Q3EA 4JN6B 1G1AA 4ZQHA 4MVJF 4FFNA 1KEWA 2IE0A 3IC5A 4L9RA 3JD4A 4WLUA 1Q2XA 5I9NA 4CL3A 1LA2A 4MVJE 1OFGA 3PXXA 1LDYA 3AJRA 1YQDA 2AEFA 1LBEA 2IDZA 1JWBB 2Y0CA 2V6BA 3S55A 4C7KA 5LDHA 4KQWA 3HG7A 2O23A 4OIMA 3T4EA 4PLTA 1I01A 4IY1A 1T2CA 3QLJA 4FOSA 3NTQA 3ZZNA 3OQ1A 5IF3A 1YOVA 2P2SA 3PLRA 3MOGA 1IZ0A 3SX2A 4IQ8A 2Y1EA 4TRMA 4YJGB 5T8KC 1YB4A 2P4QA 3PJEA 1I3NA 1CRWG 4WPGA 4L4SA 5IJZA 3WICA 3QA9A 3KYCA 3IIEA 3Q2KA 4EYEA 2HMVA 1Y8RB 5B4UA 2PA3A 1AN9A 1LTHR 1GL3A 1DC4A 3DEYX 1D1TA 1NR1A 3GK3A 2EKPA 1E7SA 3I5MA 1K0UA 3GNQA 1T2AA 4JP3A 3GVHA 4GQAA 5TJ9A 2IZ1A 4FGSA 3I9JA 3HQ4O 1NWCA 2H5LA 5DZSA 1LDEA 3VKUA 4CMJA 3TJRA 2NM0A 5DCWA 3RROA 4CL8A 3AI1A 2VHWA 3PWZA 1NFQA 3EGOA 1MP0A 2QX7A 2VTEA 1A7AA 1WNTA 3F47A 2ZTMA 1K6JA 3D0OA 3AY7A 4U7WA 1F12A 3AUSA 4CLDA 2VWPA 3C24A 1IOLA 1OZAA 3JD0A 3H9QA 3EZLA 3PGJA 3RKRA 4OOEA 3RBXA 2EKLA 4B4UA 1XR3A 2FRDA 4A03A 4ZQBA 2W8ZA 1UR5A 6LDHA 3LU1A 5DF1A 3PJDA 1E1KA 5GMOA 1Q7CA 2DUWA 4YT5A 4C7JA 2HUNA 3NYWA 3MWEB 5DULA 1CETA 1H6DA 1YL7A 5EINA 2QW8A 2HQ1A 3VZPA 3I9MA 4TRJA 3CE6A 1R6DA 5KNLA 4RF4A 2VRBA 3LQFA 4DQXA 1RM0A 2ZYAA 3SLGA 1YH3A 2FOIA 4MDHA 2IEDA 3DAGA 4W6ZA 3GGGA 5KJFA 4P38A 2NQ8A 1E3JA 5TRTA 3X2EA 4ZICA 5KJ1A 4NU6A 5DOZA 2PGJA 3KYCB 3G1UA 3NUGA 4BNVA 3JYQA 1K6XA 2D5AA 4Z3KA 4KDEA 2CVQA 4CM4A 4E21A 4XYBA 1DOHA 5EIOA 4CLXA 3Q3CA 5KTKA 3JQGB 4J1NA 3KB6A 4I08A 4UVDA 4ZN6A 3NKLA 1TLTA 4LMRA 3A1NA 3A14A 1PZFA 1VPDA 1XKQA 2AEMA 4IS2A 4NDNE 1L1FA 3OEWA 1QV6A 1LUAA 3VHRA 4XCVA 4J4HA 4J6FA 2YDYA 4RPLA 1GUFA 5JDCC 1PQUA 1QYDA 1MXHA 4CM9D 4DL9A 1H0KA 3F4BA 4QO8A 3M2PA 3VZQA 2AE2A 4OKNA 3Q9NA 1TT5B 4MOWA 1V35A 2GN4A 2VYVD 4ZHSA 4DQUA 1MX3A 4BV9A 4RPGA 4Q39A 4M8SA 2JCVA 3F46A 4PN3A 3TZCA 4FDAA 4WCFC 5ITVA 1IUKA 1B8VA 3ZV5A 3QE3A 3TFOA 3TOZA 1X7GA 2EKQA 4UUOA 1PJBA 1QYWA 2X6TA 4Y67A 5FI3A 3WJ7A 4OQYA 2VNAA 4XA8A 4BNKA 3WGGA 4ALNA 4EDFA 3ZU4A 1E1NA 3DZKA 3JTMA 4CLRB 1VL8A 2NUAA 4NBWA 4RGBA 4CLRA 1W4ZA 5G4KA 4PLPA 3RBVA 4FOOA 4CM9A 4GX5A 2YQ5A 2Y1OA 2VWGA 2WWRA 2VYVA 4BKOA 1UXIA 1ZKMA 3U4DA 4D0SA 4B3JA 4ID9A 3WSWA 1HT0A 4ND5A 4BIIA 1EFKA 2X86A 4J4BA 4MP8A 2E49A 5DCYA 1HL3A 2PH5A 4U0KA 4XZ3A 5BT9A 2CVZA 1SOVA 4YAJA 4YBZA 4DLBA 4RCVA 3H7AA 2E6UX 4W7IA 5AYVA 4M49A 4ZRNA 3ZWVA 3A9WA 4CMIA 3HADA 3SEFA 4TKMA 2J3HA 5CPBA 4J91A 1DB3A 2YDXA 3CEAA 3FI9A 1FF9A 1PGOA 2GN9A 4HFMA 3GA0A 3T4XA 4E0BA 3GAZA 3I3OA 1PSDA 3FHLA 2FR8A 2D0IA 5T5QA 3UAGA 4PLFA 4BNJA 1LSJA 3OECA 3E8XA 4P4NA 1MC5A 3DWFA 4XX0A 1FJHA 3PDJA 2NTNA 3LSYA 2A92A 2JCXA 3D5QA 4IS3A 3PLNA 2O3RA 1NPTO 3QHAA 2XF8A 5AXDA 1SMKA 1N9GB 2OP1A 4K6FA 4XKJA 3QV1A 1LDGA 2WMDA 5ICMA 4NG5A 3H4VA 4TQGA 3HFGA 2V65A 2QYTA 1FK8A 4E12A 4NNJA 3VC7A 4R1TA 1R4MB 5A04A 3MTGA 1Z75A 4LCJA 1RM4A 3L77A 4XYMA 3DC2A 1SCUA 4BO2A 3KSZO 4K26A 3PJGA 3SJUA 3QWBA 4UULA 3LC2O 2YHIA 2QHXA 2EG9A 2HDHA 3SC6A 4BNXA 1Y9EA 3O26A 3KV3O 2B0JA 2QRJA 2OZPA 2VT2A 2X0IA 3ENNA 3BMOA 3EVTA 2I9PA 2QRLA 3OHSX 2Y93A 1Q1NA 2Y1CA 3CUKA 1CYDA 1W0CA 5IDYA 3WTCA 4Q3CA 5HWSA 3KEOA 1AXGA 3HDJA 3JQ7A 4FFRA 3H3JA 3IMFA 3UCEA 1ZZEA 4RPJA 2C0CA 2CDCA 2UUPA 2PFGA 4BQPA 4YAIA 2P4HX 3WJAA 4DQVA 4UVHA 3DOCA 3GN1A 1XHLA 3PPIA 2DBVO 5GZ3A 5U4QA 1PWZA 1Y8QA 3PFWO 1JAYA 2BF7A 2RAFA 5BNFA 4J49A 1M2WA 2J5QA 1GADO 1R66A 3ZH2A 3LT4A 4U6QA 1NFRA 3RJ5A 3EDMA 4BKRA 4BGIA 2BI8A 3COSA 3EY4A 1DDOA 4KDFA 5FF9A 4BGUA 5CDSA 2HRZA 3H5NA 5EMHA 4J7CA 4G81A 3F1KA 1ZW1A 4Z9FA 3AUUA 1HDRA 5TX7A 4WLEA 4N5MA 1JKJA 1NNUA 4M54A 3VDRA 3KYDB 4YQYA 3U09A 3V1YA 4ZGWA 3AM3A 1I30A 3H3FA 3LDHA 4BNZA 3LLSA 3GN2A 4BO0A 4YJHB 1FDSA 4B7XA 4F3YA 1B8UA 2JHFA 5C37A 1KC1A 2TMDA 1H6BA 1OOEA 2PV7A 3E5RA 4O63O 5L4SA 4FFMA 1XYGA 3WX0A 4CLEA 1U5CA 3GHHA 2DTDA 1GTMA 4G5HA 4IBOA 3MJCA 3I52A 5A03A 1WPQA 3I1JA 4DWVA 1DHRA 4ALLA 5A9SB 2EP7A 3PYLA 2NTVA 1LC3A 2NVWA 4IJKA 5JS6A 2Q49A 3VDQA 3MCVA 1SB9A 3TZ6A 1BW9B 1SEVA 2EXXA 4Z0PA 5EPOA 1J0XO 1GEEA 2OO5A 4B4VA 4YAEA 4BQRA 4MJLA 2P5YA 2GYYA 3U3XA 4P4GA 3W4KA 4RF2A 1VKNA 4XR9A 1Y5RA 1BXGA 2HMUA 5I9LA 1E3EA 2PKQO 3CPSA 4QUKA 3QWIA 4L4XA 2NU8A 5IZCA 2FPIA 5HTOA 1E7MA 2GF2A 2PGDA 4TZTA 3AOEC 4J90A 2YV1A 1A5ZA 2G0TA 3T7EA 4OGWA 2BFMA 4LGVA 1XU9A 3DMTC 2GSDA 4L76A 4BUCA 3U62A 2VYND 5DBIA 1QYVA 4YQZA 2HAEA 3C1AA 1Y8RA 3U4IA 8LDHA 1BW9A 1ZEMA 2O3QA 3NDIA 1ZIDA 1KC3A 5KWEA 1E5QA 9LDBA 2DBQA 3D4OA 2ZATA 4ZQEA 3GQVA 5JAIA 3UVEA 4YJFB 4CMIB 4OAQA 4DA9A 3JYNA 4XJSA 3WMXA 4RDHA 3ADOA 2GZ2A 3AW9A 1KY5A 3H9GA 3AY3A 3NGXA 5TF4A 4WGGA 3ICPA 4CR7A 4I9NA 4Z0HO 3FF4A 2JCYA 3FBTA 1F06A 3ZWOA 3JD3A 3Q0EA 2VCYA 3D1LA 2J3IA 4HFRA 1TVEA 3KSDO 1GUZA 1KERA 1XU7A 1ZUD1 4RLSA 4XDYA 5JSFA 1NBOA 3OICA 5JC8A 1BXZA 1DFHA 2FSSA 3IJRA 5AXBA 5EESA 3U49A 1I0ZA 2W90A 1F8GA 4BNFA 3IL2A 1I5RA 1PGQA 1KEUA 1WXDA 3L6DA 1R4MA 2PZJA 1C3VA 4ILKA 4GVLA 1X15A 4EJ0A 1P0CA 2DU8A 3M1AA 1F8FA 4E32A 3VAZA 3AI2A 2XPCA 1HDGO 3QP9A 3O8QB 2RCYA 3PDUA 4XYEA 4A5OA 2VOEA 1GUYA 1EMDA 2Y05A 1NQ5A 4LSMA 1I10A 2WE8A 3P2YA 3G3EA 1PR9A 2TMGA 3V1TC 4WLNA 2X7HA 3DMYA 4J1TA 3GT0A 4JX8A 3V1UA 3E48A 4BNWA 1QKIA 4M1QA 2XXBA 4FB5A 3DZHA 4R5MA 1GR0A 1X0XA 1ZK1A 4IDDA 4ND2A 4CMEA 1BHSA 1ZXLA 4BGVA 1TI7A 5CDUA 3P5SA 1UXGA 4NMHA 1HF3A 1DAPA 5KJ6A 3UICA 1YVEI 2DFVA 4IZHA 1DIRA 1DC3A 3M1LA 3FPCA 3KLPX 4IZIA 4YDRA 4CLHA 4DBVO 3HUDA 2SCUA 2VT3A 1G6KA 5I7VA 4BB6A 2RHCA 2XAAA 3DBVO 3AU9A 2PD3A 3GPIA 2FN7A 3EYWA 2C07A 4K28A 5DBGA 4DMLA 4WNIA 4NIMA 4TROA 2F00A 3TF5A 4B3IA 2R00C 2I3AA 4XGNA 4OXNA 3UH1A 1XIVA 2JD2A 1WDMA 1G0OA 1U3VA 3GFGA 4D0RA 3OIFA 2Q46A 1MC4A 2BFAA 4E5YA 1NQOA 4E5PA 4G65A 3W8EA 4YB8A 1JKIA 2RH4A 3K92A 1R37A 1KVQA 1V6AA 3KVOA 4J4TA 3DAFA 3NTRA 1EZ4A 1MFZA 3TPCA 2I99A 2A35A 2GD1O 4DVJA 1UP6A 4OMUA 5JCJD 3LT1A 5IFLA 3HNPA 3JQBA 3BMQA 4H16A 4MVJH 4DC1A 3EC7A 1JLLA 3TFQA 2UDPA 4AJLA 2FZWA 4DPMA 1J6UA 5KJEA 1YB5A 3QWAA 3ZN2A 2EIHA 2B37A 2OBNA 3RWBA 2ZTVA 4R54A 1YO6A 1ZVMA 4TKLA 4FN4A 3WMWA 1A4IA 1O89A 3ITKA 1XCBA 3W6UA 2VTDA 3V8BA 4MO2A 1P77A 2DT5A 2PTGA 3CXRA 4MPDA 3W8DA 1H5QA 3RC1A 3GZNB 2FPPA 3ZV3A 4AJNA 4X54A 4GMFA 3QQPA 5GZ6A 1N5DA 1TT5A 3F9IA 4ZQGA 5TJHA 1PJLA 2VWQA 1QXSA 2X4GA 1IHYA 1I2ZA 4E2XA 1S7CA 3RJ9A 5KJCA 1IULA 2FSVA 5KVVA 3INTA 1DRUA 3ONEA 1DXYA 4GBJA 2Q1SA 1V3VA 4D3FA 3K96A 1J5PA 2O7SA 1AUPA 4QFDA 4PG5A 2IZ0A 1QP8A 5TSDA 5T57A 4NHEA 3S1LA 2HMSA 5A02A 4JGBA 3SC4A 4JJGA 1MGOA 3D3WB 1ZNQO 3C7DB 1DRWA 3ASVA 1HLPA 1JVBA 2X58A 3A06A 2E82A 5AVOA 4BO5A 1R12A 4RORA 2NVUA 5TNXA 3WS7A 1PQWA 2DFDA 4OOFA 4RO0A 2WM3A 4B7CA 5TC4A 4EGFA 3RUEA 3LK7A 4PVCA 1L7EA 2EF1A 3JQFC 3DBLB 4ITUA 1DJNA 3PHJA 3IP1A 1LSSA 1Z7EA 5IZ4A 2R6JA 4IQGA 3AM4A 3TWOA 3HWRA 1O0SA 4DC0A 4EZBA 1P0FA 1DSSG 3OA0A 2PGLA 4URFA 2X0RA 3DFZA 2D59A 5IG2A 5L53A 2VZ8A 3ROKA 2ZB7A 4RLHA 1NTOA 4LSWA 4FCCA 1C14A 3PWKA 4J2OA 4JLWA 3OETA 1O6ZA 1LSOA 1E0DA 1DIBA 2NSDA 3FNEA 1XDWA 1E3SA 5DCUA 1GPJA 1KOLA 2Z1MA 4RVHA 2IRWA 5JFOA 4TVBA 2Z95A 3F5QA 3R0IA 4R1SA 2BD0A 4N18A 1R4NB 4DREA 3TOXA 2W2LD 4O0LA 4FGWA 1PJ3A 1IHXA 4Z9YA 5U1PA 5CDGA 1Z6ZA 1GY8A 4AJOA 4E13A 1JAXA 3ZWAA 4YAGA 2WD7B 4GLLA 2B5VA 1BSVA 1YONA 4W99A 5A05A 3HSKA 4I1IA 3DL2A 4PLVA 1T2EA 1UJMA 3OBBA 3LLVA 3AI3A 2JKVA 1Y8QB 2HJSA 3GAFA 4WLVA 1PWXA 1VRWA 1QYXA 3VPHA 2O48X 1YL6A 2AQIA 3FWNA 4R3NA 4L4RA 3OJLA 4R9RA 2AA3A 1PGJA 1LSUA 3JQAD 1UXJA 1R0LA 2C5AA 3K73O 5KKAA 3HB5X 3I6QA 3ICCA 5EL0A 3ZNPA 2ZCVA 2WTBA 4WLOA 4F6LA 4KQXA 5HA5A 4GI2A 5CFZA 2X1HA 4R69A 1HXHA 1LXCA 2B35A 1KYQA 3JQBC 3ZWPA 4YA6A 1EUZA 1U4SA 4C4OA 1U4OA 1N8KA 2VZ9A 4I9HA 3UGKA 1W73A 1SOWA 4EJMA 4F45A 2V7PA 4I5EA 5IXYA 1BRMA 3E6AA 3NT4A 2HLPA 2EERA 4O6VA 1YBVA 3PYXA 4RQUA 3HDHA 1V3TA 2NVUB 4AJ4A 3JQDA 4CUJA 3JQAA 1HTBA 1T4DA 4JP2A 1NQAO 1YKFA 4HFJA 4HY3A 1RM3A 1ULSA 3U4HA 4FIZA 2B4QA 3N7UA 1LX6A 5DN9A 3LF2A 4YRAA 3WGQA 1IY8A 3PHHA 4E5KA 2JAHA 3EVNA 3ZHBA 4NQZA 4TWRA 1VI2A 1C1DA 1A27A 3IOYA 3WWYA 4YWJA 1KIFA 3UUWA 1VKOA 3WFJA 4DBZA 4R3WA 3ZHXA 3ZU3A 4CM4B 3JYOA 3PFFA 4N54A 1WZEA 3JV7A 4IXTA 4PLWA 4JJFA 4BNIA 5C7LO 5B12A 7ADHA 3FTNA 2Q3EA 1N2SA 2ZB3A 4FFPA 4OM8A 3UF0A 4JNKA 3F4LA 3I9LA 4ALKA 2CUKA 4II3A 1E3LA 5G0SA 4MVJM 2ZCUA 3LZ6A 1ENYA 4EUFA 4CM7A 4H3VA 4P22A 2IYPA 4BNUA 2EW8A 1JW9B 1T26A 1YDWA 2BGKA 4MVJA 1UAGA 4IPTA 5THQA 1U7TA 1PZGA 2HRBA 3VKVA 3WBBA 2XXJA 1WP4A 4E31A 3U4CA 5JAZA 4FJ0A 5ILOA 1D4FA 1DHTA 1IZ9A 5H82A 4S1VA 3B6ZA 3OMLA 2OUIA 3SVTA 2GZ1A 1QLJA 4J3FA 5L9AA 1QR6A 3FTPA 5KIAA 1O5IA 4A0SA 2PR2A 4G2NA 3EW7A 4DIOA 4RV9A 2DUUA 2P91A 3ROQA 4MVJD 2P9CA 3MJTA 2WDZA 3ANNA 4WEQA 3B1FA 3ETGA 4RVDA 3WGTA 5IDXA 1XGKA 3JSAA 2Y99A 3JYPA 5L7TA 4YPOA 2O4UX 5BSGA 1N9GA 4UVGA 2Q4BA 3OSUA 2DBRA 1ADFA 3GOHA 2YY7A 1E7WA 5DP2A 1Y81A 2HMTA 3GUCA 3QSGA 1EFLA 4OYRA 4YT4A 4M55A 2Q50A 4FQ8A 4CR8A 1ORRA 3RU9A 2B4RO 3VVBA 3ZWXA 4BNGA 1Z74A 3ZWWA 1JVSA 3HFSA 1LLUA 1P1FA 1YS4A 2Y0EA 1EQUA 4MKZA 4XRRA 3NX4A 5F5NA 4OXYA 2AE1A 4BL5A 4PRLA 4CLOA 2YFQA 3GFBA 3TQHA 1D3AA 1GYQA 3JCZA 3H2ZA 3QVSA 3AK4A 2ZB8A 1K5HA 1Q0LA 3DZJA 3L4BA 1HSOA 1PJCA 1AHIA 1Z45A 4R16A 3VOSA 2CFCA 1P1IA 3KTDA 2JAPA 3ZV6A 2HO5A 3GRKA 3JQEA 2CSUA 5KVQA 3K2BA 1LRJA 1ONNA 1EVIA 2E37A 2NLOA 4R51A 2ZTUA 2PKQP 5JW6A 4EEZA 4IQ0A 4BO7A 1E3WB 5KKCA 3KETA 2Q2WA 1DEHA 4FPXA 1WMAA 2VHYA 2AQHA 3GH3A 3ZCXA 3GVXA 3ETDA 3AM5A 1XQ1A 7MDHA 2F1KA 4BO3A 2DTXA 2UUOA 4PLCA 2Y66A 2DC1A 3WQSB 1CQJA 3INRA 1VM6A 2NADA 2X9GA 1XA0A 4K9DA 5TGDA 3VH4A 4CMHA 3KOUA 1BDBA 5FYDA 5ENVA 1YB1A 4WNCA 1C1XB 1HE2A 1PU2A 1PL8A 1N1GA 1ZJZA 3OFSA 5C3MA 4K6CA 4R5HA 2DPHA 3OP4A 1GYPA 3GDFA 3R6DA 4HADA 4E2WA 2DM6A 3DBRA 3NJ8A 3S2FA 1VJ0A 2C54A 5L3ZA 3KO8A 4MP6A 2VHVA 3DOJA 1N7GA 1OI7A 4IINA 1FDVA 2GO1A 3QVTA 2JHGA 5G2OA 4ZJUA 5JY1A 3L07A 5DNAA 5L40A 2BI7A 2BLLA 4GSKA 1B7GO 1BMDA 1PIWA 3DHEA 3PYMA 1O94A 3WLEA 1Y9AA 4QT0A 2B36A 2PD6A 4O5OA 3ADPA 1C1XA 1WDKA 3K30A 4R68A 4P8RA 4CLOB 4BKPA 3WSVA 1GU7A 3BHJA 4GLOA 3FBGA 5I7EA 3PTZA 5DP1A 4CMAA 1EDOA 2W98A 3FNHA 4R1NA 3GG9A 3NAQA 5CDTA 4KMSA 2OBYA 2Y1DA 3JD1A 4E5NA 3C1OA 4I5DA 3ZDFA 1U2GA 1NVGA 2PH3A 5DBFA 4PG4A 3I23A 2ZQZA 4JBGA 3MOIA 3WIDA 2G5CA 1YRLA 1ZCJA 1Z82A 3EZYA 4A10A 1GAEO 3IUSA 1Q7GA 4WCDA 1PTJA 4CPDA 1EDZA 2I67A 1LDNA 1NPDA 3QWHA 5G4LA 3JQCA 4BGEA 3ZWMA 5K9ZA 3S2EA 2WEKA 1WMBA 2B69A 1X1TA 4YT2A 1UXKA 2OP0A 4YVFA 4CQLA 3WDSA 3GGOA 1E1MA 1I3MA 3AY6A 4PZEA 1XG5A 1M6HA 3S2IA 1I32A 4MVJG 4UEOA 4IUYA 4XJTA 3V5NA 1T4BA 1BVUA 3ANLA 5B1YA 3KSUA 1DIAA 1ZFNA 4TRNA 4XD2A 4RL6A 3GMSA 2YW9A 3KLMX 3DHYA 4MIOA 1B8PA 4B79A 4ND1A 1RYDA 4E3ZA 3VZRA 3GNSA 1P1HA 3PWSA 5G0TA 5BSHA 2PZMA 3TL3A 3DBHB 4XDZA 4YAKA 5FEUA 1HDZA 5B37A 5IDQA 3WNVA 1O9BA 2X9VA 5T6BA 4W9NA 1NPYA 5DOVA 5L4LA 3PHIA 1P3DA 4N5NA 3QY9A 1GPDG 1PGNA 1CQIA 4AJEA 4GL4A 3PHLA 4INAA 5TQVA 3RFVA 1P45A 3DTTA 1KBZA 4XEHA 1P74A 3VTFA 3FR7A 1H6AA 1VL0A 2X5OA 4BNNA 4RVUA 3PEFA 1ISFA 4KTTE 4WE3A 1ADBA 4ZRMA 3LT2A 3ZI0A 4W7HA 3RD5A 4GWKA 3E9MA 3RKUA 3ZNOA 4KUEA 3B1JA 1FDUA 1KY4A 3IQDB 2QYSA 1HYGA 2VWHA 4D42A 4U6SA 2C29D 1YXMA 3OJFA 4DMMA 1GV0A 4FD3A 4NH4A 4GGOA 4KWHA 1GQYA 4HX5A 5DDIP 1E3WA 1EEHA 1KVRA 2EJVA 2IXAA 2PK3A 3B1KA 4WOJA 1CWUA 3W4IA 1YBMA 5U9CA 1YBAA 1NP3A 5I8ZA 4WCFA 4A2CA 5KOIA 2NU7A 4K1LA 1W8DA 3PIDA 1DBVO 4NFHA 2V6GA 2D5CA 4AVYA 3GPDG 4E2YA 3C1TA 2DBZA 3D3EA 1BWSA 3NT2A 2NU6A 4D79A 1P31A 1E3IA 1U3UA 4E4YA 1W6UA 2ZYGA 2W2KA 1FMCA 5T8KA 4CV0A 3IAHA 3GVCA 3ZHZA 5C7IO 1HDCA 4F6CA 4E2ZA 1PZEA 2AHRA 1NVMB 3D5TA 4KUGA 1VE9A 1HYHA 2A4KA 4A27A 4DUPA 4MVJI 2AXQA 1E6EA 5THKA 4FC7A 3DZFA 2CF6A 4Y98A 2EGHA 1PJQA 3KYBA 2O3JA 4WECA 1UH5A 2YV3A 2G17A 5T64A 3UHAA 2VZ0A 4R9SA 3DBRB 4IMRA 3OH8A 1VLLA 1V9LA 5ADHA 1CIVA 4PG7A 4QFCA 3W1VA 1MB4A 1PJ4A 1TA4A 3UKOA 4IIVA 3WXBA 1SAYA 2VHZA 2Q1UA 3U5TA 1XELA 3UCXA 2AQ8A 4OKIA 5I9MA 3IJPA 3ZV4A 4EITA 3R1IA 1GDHA 4CMCA 1ADGA 3C85A 5HBRA 1Y6JA 3E1KA 4WEOA 4UVEA 2WSBA 5L51A 1HDOA 2GR9A 3GEDA 3UXYA 3K5PA 3O8QA 2Y1GA 1I2BA 2PY6A 4E33A 1H2BA 5A4DA 3QVWA 3SJ7A 2ZTLA 4FJ1A 4M89A 4GKVA 5IN5A 4D3DA 4NBVA 1YGYA 1HLDA 2GLXA 3HHPA 4MKXA 1K89A 4EUHA 1UP7A 2RH8A 3C8MA 4D41A 1H9BA 1YDEA 4HNGA 1ZSYA 5DT9A 5CEFA 3DDNA 3L9XA 2O4CA 1GZ3A 1OBFO 5JAQA 1HDXA 1U8FO 4M86A 3L9WA 3ETEA 1ZSVA 1I8TA 2G76A 1U5AA 1WAMA 1AGNA 1P1RA 2BHLA 1O8CA 4R4JA 1PL6A 1HETA 1YJ8A 3TSCA 1X1EA 2HU2A 1T25A 4B4WA 3KYDA 1CF2O 3GR6A 3WR5A 5JNLA 4A7PA 2DLDA 4JIGA 3Q6IA 2VYNA 1A71A 3MJ4A 3TL2A 3PVZA 4LN1A 2J3JA 4IDFA 4W9NC 2VUSA 3D3WA 2JJYA 4OH1A 4U5QA 1DLIA 4D3SA 5JDCA 4JCOA 4DIFA 3F3SA 5JYDA 2ZK7A 2PD4A 5COQA 3RFXA 2DAPA 4N5LA 4JBHA 3P2OA 5TS3A 4BO9A 4YEDA 4Y6SA 5H83A 1WVGA 3DO5A 4WK6A 3ZWCA 3JQ9C 3BMQB 4JJIA 3RUDA 3WWZA 2BH9A 2GN8A 3ZNQA 5A9SA 2A94A 3WYEA 4ZA2A 1ML3A 3FNFA 4O59O 3WNQA 4CV1A 2H6EA 2FP4A 4IDCA 3BAZA 2O3UA 4Q3BA 3WYBA 2PWZA 1LDMA 4JK3A 3E18A 1I3KA 1JU9A 3E9QA 5KVSA 2EGGA 2LDXA 1BVRA 4GX2A 4DRYA 2VHXA 1HRDA 2J6IA 3DOOA 4XYLA 5J23A 3O4RA 3HZZA 1DIHA 1FXSA 1HWYA 2EEZA 3GVIA 4GMGA 4QSMA 1H93A 3I4FA 2EHDA 4GWGA 4ZQFA 1I3LA 2DQ4A 3CSDA 1E7RA 2Q4EA 3BTOA 1Q7BA 2I65A 1B16A 3E82A 2E48A 4YXFA 1MV8A 1MG5A 1UP4A 2C7GA 4YJGA 5CHEA 3RVDA 4BMVA 3BIOA 2OGUA 3CMCO 3NV9A 1U9JA 4L73A 3GVPA 1JWAB 3IUPA 1HSZA 5L95A 3FWZA 3LYLA 2OMEA 4J16A 2VUTA 1EBFA 3CZMA 3FN4A 3O03A 5L7WA 2ET6A 1NVTA 4QECA 3JQ8B 3F6YA 3D7LA 4GKBA 3BA1A 1ISGA 3KZVA 5F21A 1TXGA 2C2YA 2JFFA 5JLAA 2V6FA 4D7AA 1MA0A 3BMCA 4E30A 2DKNA 3TRIA 5HS4A 2HSDA 3BMCB 4Q3DA 3KEQA 2GCGA 3DR3A 3NDRA 4B7UA 4CM8A 2VNSA 4NJOA 1BXGB 3ZWYA 3WTBA 4PG8A 5L45A 3RC9A 1EK6A 1VSUA 4IMPA 4TZKA 5B4VA 2P5UA 4NR0A 2PLAA 4RZIA 1VSVA 1ENZA 4OL9A 2ZJ1A 2EWMA 4FBGA 1B15A 5CDYA 4L0QA 1PS9A 4PFJA 2Q2VA 4HFNA 1LNQA 3CKYA 5HS6A 2FWMX 3P19A 2PZKA 1NR7A 4LISA 1U1IA 1XQ6A 1CERA 1NFFA 3EUWA 3GDGA 2D3TA 3ULKA 4XR4A 3UN1A 4DLLA 2WE7A 1ZSNA 5BQFA 1UDBA 1GCOA 4IGFA 4EW6A 2I3GA 3RC7A 4CMBA 3O9ZA 2R2GA 4XQCA 4UEKA 1X7HA 3DMTA 3CIFA 3K8ZA 3R3SA 3E5MA 4PG6A 2BMAA 3MTJA 2DVMA 1A9ZA 3EAGA 3HB4X 2UVDA 3IP3A 3ORFA 2YQ4A 3AFMA 3QRWA 2CNBA 3KHUA 1VJTA 3QJ5A 4XGIA 2LDBA 4JQCA 4YRBA 2OXIA 2GGSA 2YZ7A 2CDAA 3CZRA 3ENKA 3KM0A 4AJIA 5HM8A 1Z7BA 2YV2A 3MJSA 3OJ0A 1J4AA 1K2WA 2YHIB 4J43A 1RYEA 2NWQA 4IDAA 2W4QA 4ZVVA 5GZ1A 2C7VA 2HCTA 5L7YA 5L4NA 1ADCA 2WJPA 2QQ5A 3BTSA 2I76A 3ST7A 1A9YA 1EVZA 1AXEA 1CEQA 1F17A 2C20A 1DFGA 4BO6A 5KVCA 3V2HA 3WGHA 4MINA 3FD8A 3W4JA 3H9UA 3OJEA 1V3UA 3A28A 2VQ3A 4B4OA 4TVOA 4BMSA 4RJTA 2IYOA 4RPHA 4TMFA 2JD0A 4AL4A 5F1PA 1T2FA 3UFXA 4GPD1 5I7FA 4R01A 1IPEA 5TIIA 1SZJG 1ZK0A 5BNIA 3JQ9A 3IS3A 3KXDA 2NACA 1KVUA 2X9NA 4GH5A 4KUHA 3JQ8A 1U3WA 3QVOA 4CV3A 3DFUA 3BHIA 5BNTA 3RCBA 2UYYA 1QV7A 2AEJA 3H65A 1QG6A 3W6ZA 1L7DA 1NM5A 2O50A 4WOKA 4CODB 5JO0A 5JY6A 1Y1PA 1D1SA 3ABIA 4AJKA 1SBYA 3U0BA 4A73A 1KVSA 3PI7A 1KEPA 4XQ9A 1LQTA 6ADHA 4UREA 4RVFA 2NNLD 1E1LA 4BO1A 2X0NA 1EVYA 2PZLA 1GV1A 3LC7O 4DTIA 4DXHA 1B0AA 5EQDA 3SLKA 2O7QA 5JMPA 4CV2A 5HRUA 2QIOA 1QYCA 3VH3A 1DC5A 1M66A 4BS9A 5JBIA 3RASA 2NTJA 2YHUA 3RUAA 4I9UA 3Q1LA 4BKUA 1ENPA 1RPNA 1XWFA 4NZ9A 4CQMB 1E7YA 4WASA 4B8WA 1ONOA 2ZKLA 1ARZA 2BFOA 2DPGA 2FZEA 4KZPA 2Q2QA 3H9JA 1LRKA 5CP8A 1P9LA 5LC1A 2X8LA 1Q0HA 2YYYA 1PEDA 1TT7A 2QZ9A 4YRDA 5IZCC 3CTMA 4IIUA 1EBUA 1IB6A 1GYRA 3GDOA 3PK0A 1H2HA 3AOEA 2VN8A 2HKIA 5IDWA 3W8FA 4YTEA 1ZBQA 5BSEA 3AUTA 4Z3DA 2WD8A 1QMGA 2IODA 1QLHA 3I9OA 1YQGA 3EK2A 1H9AA 3OF2A 3VPGA 4AICA 1BDMA 1U28A 4FR5A 3HE3A 3QWFA 1BTOA 1R4NA 1EUDA 2JD1A 2RBEA 3VZSA 1DIGA 2GERA 1AE1A 1EK5A 4CR6A 2J3KA 3DHNA 1DRVA 1R0KA 5ES3A 1PL7A 2UAGA 2WYWA 3H2SA 4M87A 4AJPA 5AQ1A 3DZIA 4LCEA 3RUIA 3PGXA 9LDTA 3G49A 4PGFA 4KP7A 2O2SA 4XQEA 1ISIA 4YCAA 1HYEA 4BNHA 3G1TA 4CM3A 1KVTA 1Q0QA 3WQRA 5EN4A 5F1KA 4WUVA 1GQQA 3JYLA 4CJXA 3JQ6A 2H63A 1C0IA 1E77A 1JA9A 1B26A 1IE3A 4YJFA 3QIVA 5KCZA 3RIHA 3RBZA 2ZJ0A 3B20A 5LCXA 3H5RA 3PQEA 4LMPA 4QQRA 5LDGA 4AFNA 3GMDA 4CM5A 3H5AA 1ZK2A 3INGA 1C0PA 1S6YA 4PCVA 3VTZA 3NJ4A 1LLQA 3WG9A 2CD9A 1GQ2A 1NX6A 4KOAA 4WCFB 4CUKA 3DTYA 4KTVE 4ESOA 4Y9DA 4Y8VA 4ZD6A 5ER9A 3GG2A 1NQTA 2BELA 2BRUA 4I5FA 1DFIA 5ITWA 2FR1A 1D8AA 1PX0A 3H8VA 4RPKA 3GRPA 4DPLA 4J7XA 3N58A 4IXWA 3PP8A 1OC4A 3VH2A 3KRTA 5MGBA 3MJVA 3WGYA 4J0FA 4BHTA 5CEEA 1R0SA 4Z6KA 4RQTA 1F14A 2B83A 4OQZA 2C59A 1ZH8A 3DBLA 3VPFA 3I83A 3OEYA 2BGMA 2J5RA 3BMOB 3RI3A 4W4TA 3ZWBA 1NHWA 2AMFA 4CMEC 2OFPA 5EJ2A 1T1RA 3Q2IA 4BO8A 1NASA 2AW5A 3A4VA 5CAEA 2OL4A 4NU5A 4HWKA 4A26A 4HP8A 3GY0A 2QRKA 4PLGA 4FJ2A 2BKAA 4HKTA 2FHSA 3OQ6A 4WLFA 2I6TA 3TZQA 1LDBA 3ZW8A 2NQTA 4OHUA 3VPSA 1R15A 4U0JA 5F1OA 5BSFA 2CF5A 4PLHA 4PLYA 3AU8A 1H94A 5FI5A 2R00A 4IJVA 4ZU3A 2OOSA 3JQ7B 3VVCA 4FSHA 5TT0A 4RVGA 3ANMA 4JBIA 1WW8A 4CUZA 4YJDA 2Q45A 1JKFA 4BNMA 5EQFA 1HKUA 2AQKA 2OORA 3LT0A 1M75A 5I8WA 1LI4A 4WJZA 2Q1WA 1A72A 4UAGA 2HJRA 5CPFA 1N1EA 2X5KO 3TN7A 1YQXA 4NBRA 3WYCA 5F3RA 1SC6A 3FRJA 5COBA 3UW3A 3RUFA 3RSHA 3BYZA 3OIGA 3RU7A 4HV4A 4EEXA 2CDBA 1LJ8A 1PGPA 1F0YA 4Z9XA 1I24A 1TEHA 3ON5A 4GAEA 1LC0A 4MKRA 3G79A 4AG3A 1V8BA 4LRTB 3VH1A 3ZNNA 3WGIA 4E6PA 4BOYA 1WZIA 1P44A 4CM6A 4CQLB 4NK5A 1C1DB 3ZHYA 3WQQA 1N7HA 3TNLA 4AJJA 5FFFA 1DPGA 4NK4A 5ENDA 3WLFA 3ZU2A 1AHHA 4FFLA 3H9EO 1YJQA 1A7KA 4CQMA 1Y7TA 5A3VA 8ADHA 1RM5A 3K9QO 5JC1A 4BO4A 1R16A 1SEPA 1NYTA 4NFSA 4BB5A 4CM1A 5K0ZA 3RFTA 5AXAA 1XSEA 2GDZA 1ZEJA 3AWDA 3U9LA 4PIVA 1P33A 1ZMOA 4DGSA 4OSPA 5A9RA 1ISMA 2Y0DA 3WB9A 3RQSA 1M6WA 1PJSA 1LU9A 1DO8A 4OO3A 4XGKA 2JFGA 4AJ1A 1C0KA 4XB1A 1YWGO 4HXYA 4ROSA 3AOGA 3DONA 4P4LA 3DBHA 4FS3A 4TSKA 3PHGA 4BNLA 3S2GA 3VPXA 4PZDA 5JDIC 2PKRA 2I5PO 1UDCA 3I4CA 4RF3A 3ROPA 4B8ZA 3HJAA 4CQMD 5FWNA 3NDJA 4IJWA 2D4AA 4BKQA 3MJEA 1NHGA 4Q3NA 2GN6A 2HMWA 1X14A 5JPIA 3GC6A 3LC1O 4L74A 5F5LA 2AG8A 4OXKA 3GHYA 2AG5A 4GVXA 3DB2A 3JQFA 1P1JA 2HK8A 2C2XA 2NVBA 3QW2A 1I33A 4JROA 4IDEA 1RJWA 4QTZA 3Q11A 2PNFA 1EUCA 4YT8A 1X13A 2ILTA 2GASA 1KETA 2NV6A 2G82A 1O95A 4TRRA 3CMMA 3IDSA 4PZCA 3BHMA 1E6WA 2VOJA 2VRCD 2IZZA 2FY8A 5C5IA 1QSGA 3RUHA
chains in the Genus database with same CATH superfamily
1WU8A 2EJCA 4QEDA 2GRUA 5H3LA 2DJIA 3T7AA 1PD1A 1MZVA 1U9CA 1GFIA 2C97A 4BQFA 5FPQA 2E6KA 2MSNA 4EZIA 3J81A 1CR6A 2HEGA 5E1MA 1VBKA 3O83A 2C98A 1R8YA 2WZDA 1Y5LA 1QIJA 4XQGA 1PO7A 4EKNB 2Y92A 3GEGA 1NUQA 5BUSA 3OEHA 2VZLA 1PVDA 1S9HA 1SXJD 3UMBA 2H57A 1UZNA 1HE3A 3EMKA 5AJZA 2BE9A 5JCJA 4KC0A 1FRVA 2JLCA 1TIPA 2P9GA 4M1MA 4KAFA 4IKPA 2PL5A 1EE9A 3HN7A 3S2ZA 3T41A 4Y2TA 2GK3A 3D4NA 1TB4A 2PT6A 4PBSA 4XRGA 2YZGA 3U31A 4BLWA 3KNZA 3NTOA 4MHSA 1W75A 3O7WA 4F4HA 4E11A 4UUPA 5NLLA 1H9CA 3FWPA 2ZUVA 1KSHA 4B6GA 3IOMA 1KZYC 2ZU6A 1W4CA 3EUFA 4MV9A 4CF4A 4DNFA 4DZTA 1R00A 4P92A 1PJ2A 2YCLA 3ZU5A 4W82A 4C4ZA 1E92A 1U1CA 4BNTA 2CZGA 1KKLA 3HBAA 3JALB 3NH9A 1U3TA 2C2ZA 2DTEA 3IKVA 4EBFA 1NXVA 3REFA 4LE1A 2PRKA 3OX1A 1TLLA 4OQPA 5EIWA 4U7GA 1UBRS 4ENQA 1U0BB 1NW5A 1JFFB 3VR3D 3NHMA 5AI0A 3GLGA 2XZTA 4L4UA 1QIDA 1UJNA 1XRRA 3SS7X 4BVAA 2O2YA 4KBYA 3GF4A 4MX8A 3M4XA 3GLIE 2OYSA 1G20E 1FQWA 4JEUA 3NONA 4UHKA 1YCFA 4E5MA 4L50A 4CQJA 3CH4B 5IX8A 2PMFA 1P4GA 2IEBA 3L6OO 5D8DA 1YOVB 1J1ZA 1ZJYA 3WO0A 1GSAA 4FFBA 4ZGBA 2JARA 2WNSA 1CIPA 3BWBA 3HVKA 3H87A 1BG6A 3I6ZA 5I7SA 1BVYF 2EBWA 2WD9A 2ZBRA 4P86A 4E1AA 3V4VB 2IYSA 1VI5A 1E4EA 1QFZA 3KJEA 4ZEVA 1UZLA 5HJ5A 1VC2A 1Z2DA 1OXKB 3C4VA 4TTTS 2YFHA 5FUVA 3WBFA 5JMWA 4Y1FA 4UASA 4BNYA 2QQFA 4WQMA 1U63A 3ZCSA 1Z73A 3I6BA 4JLBA 5A6SB 1JGTA 1VJ1A 1Q7TA 1IY0A 1UBHS 4KQKA 2HREA 3E03A 4J1QA 7AT1A 1SG0A 3H5LA 3FUWA 3GNTA 1L3IA 2VF8A 4BBJA 4EG0A 2XEXA 4R41A 5B7NA 2WB2A 4WK4B 4MB6A 1QNFA 4AM8A 1M76A 3UQZA 4B71A 2V55B 1GU0A 5AIBA 3P0EA 1JKMA 3NGLA 1RVDA 1PZMA 1Q50A 1YE3A 3DL7A 4IV5A 4BC0A 4FFVA 3Q7PA 3OJOA 5H9WA 3FUUA 1NXQA 4DMRA 2V6IA 4HWSA 1RQLA 2OFOA 4YRPA 1Z6AA 1VMIA 3ONDA 5EP4A 4B6PA 3ZY5A 3QFTA 3AR2A 4Z0TA 3GLQA 3OURA 4GPTA 3JRWA 4LW8A 3QEJA 1F3OA 1P1KA 4LXGA 1I4OA 1J8MF 2OFXA 3V48A 3RIEA 2WWYA 3R7AA 5DM60 3H18A 5E1DA 4MDYA 2ZRAA 2VA8A 2H1FA 4U8GA 1SUAA 3FUVA 3OCUA 4MV8A 4QDUA 5AXCA 5J1TB 3RC2A 5KOHA 3W5CA 2HYDA 2YUIA 3BKWA 4PX5A 1GTVA 5G1PA 3IQGX 3G17A 3L8HA 2W58A 1KNXA 3AHGA 4DF3A 1UOEA 3QM1A 4I4IA 4ZEMA 1J1UA 1CRPA 1BGVA 3N59A 2Z6QA 2BAGA 2QZZA 3SR3A 4CKYA 4JNCA 3TEJA 3CRW1 1KI6B 3T5PA 3CNEA 4QUGA 3OHMA 3QEMA 2WD7A 2JAOA 2I6SA 1R5JA 3NORA 5LXTA 1G8SA 4WJKB 4IHJB 3FZNA 5J4VA 3UMCA 1QMPA 3M2TA 1U8XX 2KYRA 4MGYR 5JZMA 3WK4A 2NYAA 1G98A 1OSNA 1EAMA 2B99A 1QORA 2QTMA 5DXFA 2CNKA 3NRCA 1U5BB 5HZGA 4N76A 3CR3C 2C7RA 4QLOA 1KS9A 5I7AA 2F9FA 4I2VA 2ANBA 1ZXBA 3DQZA 4G8DA 4Q9NA 2HCRA 1FQKA 3BSWA 2ACWA 3IP5A 3ESYA 4NKRA 4EJ6A 4ZYZA 4HLDA 4JVOA 4J2HA 4UUNA 5CM8B 1GZ7A 4R98A 3ZOZA 1R5BA 3R2JA 2A7QA 1XL1A 2CXNA 5B3JC 3PIIA 2IY7A 3OM9A 4MRPA 3OEEA 1SC9A 2H1SA 3IVRA 4A2QA 1XXHB 4NCHA 4Q9LA 2ZSDA 3WOHA 1UK9A 2QTLA 4NBTA 5IJ0B 3KOXA 5JJLA 4CN8A 4HNHA 5CEJA 4D46A 4WZBA 4Y6RA 3KWMA 4X65B 2P68A 1K3TA 4P31A 4LECA 2OWEA 1CUXA 2AC7A 3IR5A 2ADOA 3JS5A 1OXSC 2AYZA 3DJYA 4FW8A 5LQJA 3JZMA 1XZ8A 1CZLA 1UC4B 1OMOA 3P0FA 4MRMA 4NBUA 3TM5A 4YV1A 4DNPA 2EW2A 3A9UA 4MIEA 3IKTA 2ZJZA 2A5YB 4HQRA 2XMBA 3WRWA 4K46A 3E9NA 3PQDA 4CKBA 1IXKA 5A2GA 3EMDA 3K0AB 1U2DC 2C57A 2W0MA 2VL7A 1PT7A 3BDAA 3H0EA 4IICA 4YACA 2IWHA 3W8NA 3X2FA 2ZJ7A 1D9XA 5H4GA 5K3EA 5DNUA 3BN3A 1AH2A 3H1GA 2LCQA 2H9IA 1NG9A 1ZD3A 2AFVA 2IP4A 1J70A 2KM1A 2EV9A 5BWOA 3T15A 5CYPA 5F5XA 1QGUB 4M7OA 4RADA 1CUUA 3WK6A 2PIDA 4KITB 1DC8A 5CFQA 2SECE 4HHEA 4O2AB 2QVYX 4D4JA 4ZHQF 3EQ6A 4X24A 3PEVA 1GZ4A 1B3RA 1FDWA 1VDMA 5DNDA 4DMHA 4DN6A 2CVPA 2C5GA 5A4KA 2IKSA 2WKSA 1QHNA 2WYVA 2IPMA 4FNGA 4U2EA 4XYGA 5JVDB 5E3HA 2OLJA 4UXJA 2HF9A 1WXQA 3CF4G 5FOTA 1MG0A 5H7XA 2H07A 4CHTA 3WRYA 3C3AA 5REQB 4BLQA 3A6PC 1C1HA 2ZRPA 3MLBA 3QVXA 4M6WA 1COWA 3OF3A 4U3JA 3PEUA 2D5LA 3QLEA 3K0AA 3K2EA 4W1PA 1SNYA 1TK9A 3BWVA 3KQWA 2HZ7A 1VTKA 1MO3A 1LPOA 2X22A 2XE4A 3GGJA 3N1UA 5JCXA 3GRCA 3NBMA 4TT3A 4BJ6A 3K4HA 1V1RA 2D5BA 4XWYA 1ZH0A 1NMQA 5CVCA 1K98A 1KYTA 1ZNXA 2IQ5A 1UBEA 3DSRA 2GPTA 3O9VA 3TJZA 4IF6A 3U2QA 4BMNA 1WPGA 2RBKA 4A8HA 1YZKA 5DIZA 2IYVA 2C88A 5D5PA 1JTVA 4P36A 4CT0A 4E4TA 4Q9IA 4G5RA 1B0ZA 3FYUB 1F2TA 2OCLA 3FBWA 3LNTA 3CO5A 1T1SA 3B9BA 5EKDA 3D59A 5BR8B 3A6GA 3V2GA 5J3JA 2J0EA 1UOOA 4LXHA 3C7CB 3C5VA 4O25A 1QRUA 3NRBA 2VAMA 3F73A 1OQAA 2I66A 3MSXA 2CLDX 1UT5A 2B4TO 5J58A 2MHCA 2XKKA 4LBYA 1E4EB 4LK3A 3CLSD 4RF5A 1JFVA 1Z5OA 4FZJA 1NBME 4PGGA 1XOIA 2PVCA 1JS1X 2ZJ4A 2QG4A 3MMZA 5DRTA 2YWGA 1EGHA 4NBNA 3RUCA 1XN4A 2N75A 1XEWX 1ZL0A 4MYDA 2CL6X 3WGOA 4LXTA 6Q21A 4LS3A 4MUHA 4PYQA 1L8XA 1IK6A 1U80A 3KTAA 3BMNA 3JWHA 1UBCA 4ALIA 4MUGA 1HLFA 1XMJA 5CG2A 4LYFA 1LWNA 1Y3BE 4M9RA 1KMHB 2V6JA 5JYEA 721PA 2VJBA 1T5TA 2OHGA 2VQ6A 3EWNA 3P4XA 1M3SA 4LVCA 2UXBB 1LH0A 3C6QA 4NE9A 3Q9LA 1I2AA 4H6VA 3ZWNA 1GWNA 3E9YA 3DAPA 2ZXEA 3NS7A 1HL7A 2XNDA 2OAP1 4IGEA 1ZCAA 2I4LA 4Q3EA 4JN6B 1W5TA 1CY6A 3GLHA 2RHBA 3LDFA 3DYBA 3EC2A 4FFNA 4LC1A 3K9BA 4MVJF 4RXUA 2IE0A 2DUMA 2FW9A 3B8HA 3JD4A 4WLUA 5I9NA 1G291 1VG1A 2PX8A 1LDYA 2EAUA 3H6GA 2IFTA 5FPYA 2EWWA 1QOZA 4KXYA 4NICA 4Y2RA 5IMSA 1B8OA 2I1VB 3RR2A 3S55A 4MRRA 3A58B 3ZR4B 2Z43A 4C78A 2KW5A 2QZJA 4KQWA 3CNLA 2OCPA 1E4OA 4PR0A 5EIBD 5ALYA 4FD2A 1SWVA 2IVZA 2HA6A 3HBNA 3NTQA 4MWCA 3U7IA 4ZTZB 4Z7OB 1OBHA 5EKXA 1OX4A 1ZM9A 4MR8B 1R5OA 3PLRA 1QWSA 3DO8A 3RVKA 1XMXA 1RMYA 2D7CA 2H48A 2IW3A 1P2FA 1ZISA 2R6R1 2Y1EA 2ZJAA 3ELYA 3O94A 4MW2A 1Y3CE 1QAMA 3TG2A 2PH1A 2X77A 5DTRA 1UADA 3TRKA 4ADSG 1Y6FA 1U2GC 2CLSA 4F96A 2JIRA 4F71A 3IIEA 4MQ6A 1ZI8A 4V0SA 5LQUA 2IKQA 2HMVA 2JDID 2OOKA 3FNBA 3QIAA 1AN9A 3V3TA 3AF1A 3PC8C 1W48A 1J0EA 1E7SA 1PUIA 2EKPA 1I7NA 4JODA 3RSGA 3TIXB 1G8PA 4A6PA 2I78A 2JC3A 3WRVA 5IC4A 5F2KA 1UBJS 2DXIA 2PUCA 1UWCA 2IZ1A 1H22A 4NLLA 5C34B 5JLJA 2V45A 3EEFA 4LDQA 5AKEA 4F2WA 3A05A 4URXR 2WF6A 3BSYA 3FCEA 1C8VB 2AOWA 1FXWF 2NM0A 1UPTA 4NL4H 4B9EA 4D9KA 2A9KA 7REQA 1WXWA 1Z35A 3ODGA 1KO1A 1XNQB 3D0OA 2ZUSA 2UYOA 4RSGA 1D4ZA 1DQNA 1I7PA 2P3SA 2VWPA 5I3ZA 3G0BA 4G01B 2HWKA 1C9YA 4ZRDA 5EZ6B 3JD0A 3H9QA 1M0SA 3EZLA 1B8NA 2FEXA 3DCIA 3HN6A 4FCVA 2C78A 2WICA 3RBXA 3EVGA 4ER6A 2FRDA 4AWXA 2KLHA 3DTVD 4GNKA 3MWJA 6LDHA 3GRYA 3VC3A 1ZNYA 2VF7A 1N2GA 3IQHX 1MB3A 1ZVVA 5EKSA 1RXVA 1YDHA 3MGKA 3TAHA 2DUWA 4I1SA 1A8HA 4AN1A 5K05A 1U0HC 4O3MA 4BEWA 2HUNA 3MIZA 3X2SA 1KXZA 3SVLA 1H6DA 2I54A 5EINA 4QGFA 4M0DA 5JHHB 2V59A 3EA4A 3IPAA 5EI5A 4OU5A 1R6DA 3VC2A 3VV2A 2C7OA 3OPXA 3IQZA 1VMDA 4G0ZA 4IDOA 1X7ZB 5FOUA 3WLAA 3LQFA 2CXRA 2VJQA 1RM0A 3FPJA 1DCKA 1L9KA 1VLZA 3RRFA 1ADYA 1VYTA 4YRLA 1EKXA 4YHHB 3LX8A 2B6HA 2OESA 4EHFA 2P6UA 1O4VA 1E3JA 3RFFA 1N7JA 1TMKA 4RZUA 3RSQA 3TLXA 4LQCA 3KYCB 2V54A 2GJAA 1BMQA 1UBNA 2E21A 1JAZA 2XLCA 3JYQA 4BNVA 4Z3KA 4FSXA 1T15A 4HQLA 2RHJA 3AEQA 4HUTA 4XYBA 1NVKA 5DHSA 3Q3CA 3MILA 1A4RA 2D2XA 2RJ3A 3O90A 2WWXA 3NKLA 3O8DA 5DU2A 1TLTA 5CT8A 2V98A 1Y37A 3QE0A 3A14A 2KI5A 1KIAA 2AEMA 5EUBA 1L1FA 1GLNA 1Z6PA 1E3QA 1LUAA 2E89A 3IPLA 1C80A 1N0HA 3VHRA 4JV5B 1VIDA 4H1TA 4RPLA 4EK9A 5IK2D 1A2BA 3HKCB 1QANA 1ZXXA 3D6JA 4BEBA 4DL9A 1H0KA 1QIHA 2PLRA 3M2PA 1G7TA 1EXWA 4Z4HA 1BKYA 1ODIA 3JY6A 1Y6RA 3PT5A 2WAOA 3LCRA 4IH9A 5D3KA 3TLYA 3VVLA 4XVUA 5BN4A 4X3OA 1KAEA 2CXPA 3NWJA 5FUYA 4BV9A 1SELA 1VL5A 4IZ6A 4QODA 5JECA 1ZR4A 2W8BA 4NCXA 4ZYYA 4QRHA 5IJ9B 2IS4A 3RK4A 4F9TA 1RSZA 5TQ2A 2IBTA 1JYFA 1IUKA 3T6KA 1ECLA 4Q37A 2F8MA 5KWJA 1HEYA 2R3SA 4H3HB 2F1HA 2WIFA 3RVOA 3TOZA 2X6TA 5JRZA 3WDLA 2VNAA 5CTAA 4XA8A 1Z0KA 5A6SA 4C4RA 2H5EA 3WGGA 4YRCA 2QMZA 3ZDEA 3TKLA 5LWHA 5AW1A 2BGGA 2KB0A 2R8EA 4CLRB 3QX8A 1VL8A 2NUAA 3V4OA 4NBWA 4RGBA 2QGNA 4MCHA 4BX2A 1XMIA 3SEQA 1L1EA 4PLPA 5G4KA 2RH5A 4DTCA 5BNZA 2PXAA 2ZAYA 2ZR8A 3TBFA 3PUVA 1RYHA 2HTEA 2QTVA 4WN3A 4YAWA 1HNZB 1ZA1A 4QJ5A 1DGQA 5AW8A 4O8ZA 1EFKA 1PJ8A 1XDSA 2UZ1B 4J4BA 4MP8A 4UAUA 4JVMA 4PX2A 3ZE8A 2QVBA 1HL3A 2OFFA 4QLAA 1SOVA 2GBFA 3JPYA 3SGLA 4HDKA 3A6EA 2G0NA 1ZCBA 2I8LA 4DLBA 1MEOA 3CIOA 4OP3A 1V4NA 1FRFS 1ODFA 2YWDA 4C1BA 1UEXC 2O8EB 1IM5A 1COZA 3HADA 1Z0SA 2SKEA 4ZPXA 1KP9A 2G4VA 2J3HA 5CPBA 5T4EA 4TTAA 3QVMA 4GD3Q 4B3FX 4JYBA 3SYMA 4DRXA 3T4XA 1PGOA 2GN9A 3HZHA 4YI3A 4IH1A 1PJZA 4DLWA 2HU5A 1TO1E 3UMRA 1DKQA 5B7PA 1K8RA 1PSDA 1ETUA 1HO3A 2CLFB 2D0IA 3D3KA 3DV2A 4HBZA 5J4HA 3AM1A 4ZVOA 1IUNA 1L5FA 2XYQA 5BN3A 2HXSA 5AUOB 3K09A 4WDQA 2DETA 3EDOA 3S5UA 2G88A 2PJZA 3LFTA 2O2HA 1G7CA 4MICA 2IHVA 3U1TA 2JCXA 3U4AA 3D5QA 1UJ4A 4R8RA 3THYB 4XVHA 1NPTO 1U0TA 4RXMA 2XF8A 4OI4A 4P4SA 1Y1LA 3FB4A 1SMKA 2C3YA 3IO5A 2IIVA 4JYMA 4K6FA 4OP2A 5K4AA 4EY8A 2FPSA 1Z25A 1LDGA 2B20A 5CIQA 1M8GA 2AD5A 3F6BX 4EYOA 5CD9A 1E2BA 1M5RA 1W6RA 2QYTA 4QQKA 3HKDB 1XCJA 5TMPA 5CCBA 2DRIA 2RHMA 3VC7A 4P34A 2QVZX 5JJBA 3EGVA 3VUFA 1T9GS 2VPQA 3EBLA 4IP0A 4ZXPA 4MLZA 2F1OA 3WKAA 3OOEA 2CNOA 3WLTA 4DV4B 3GLIA 3ACDA 4K26A 4OJQA 3X1MA 1TFRA 5B3AA 4I6JA 3AKZA 1TF7A 2OZPA 2VT2A 4F8YA 3BMOA 3V4LA 2I9PA 3RIMA 4MKHA 2BYTA 1EHCA 1T8TA 3R9IA 1YFLA 1BRTA 2B4YA 1W4AA 2ZI9A 1JF8A 4P2GA 1JBQA 5MHTA 2PGOA 4Q3CA 4J07A 3RFUA 3R7LA 3TZEA 1GLGA 3WBKA 3E9DA 4HXGA 1QF6A 1ZNZA 4ZP1A 2O5CA 3LWBA 4L08A 2GM9A 2NYUA 5EJ6A 3VPAA 2PFGA 3CPHA 3I92A 2E0IA 2XUPA 5JZOA 2E4XA 4JMLA 4BFLA 5FTLA 3A3PA 1LK5A 4D8XA 5IWCA 5J1SB 1KZGB 4MW5A 1XVLA 1L7NA 2FETA 4AYWA 5GZ3A 5DJ5A 1J1IA 3I34X 4BECA 1DEAA 4OYLA 1JAYA 2RAFA 5ALQA 4J49A 4X94A 3CHYA 1M2WA 3HUUA 4RMNA 3X1KA 4R9VA 5MFPA 3G2MA 1J8VA 3D8HA 2XSZA 3CW2A 2OCIA 3FKQA 3RJ5A 3ORSA 3EJWA 3AUFA 4BGUA 1X7ZA 1DV1A 1I4LD 1Y4UA 1GGMA 3H5NA 4J7CA 4ZZ3A 4JASB 3ITEA 3VVMA 3OQJA 4DR3B 4Z9FA 1KFJB 1QGYA 4RE5A 1HDRA 1U2EA 4HH4A 4Y2PA 4EFKA 5B1EA 3PX7A 1JXAA 1RLJA 1PUXA 4AQDA 3VDRA 5HIJA 5JH7A 1O6CA 3DMHA 1VSBA 1W30A 1EK0A 1Z13A 1C4XA 4YQYA 4M6WB 4DDUA 1J0DA 5HDBB 5BPHA 3AEQB 3TQCA 3H3FA 3HBLA 4WBSA 4BNZA 4FFWA 4MGIR 1UK7A 4KXWA 2IBMA 3U0VA 1FDOA 1GPBA 3V00A 1Z4IA 3K5IA 5ABPA 3E5RA 1GNRA 1X1BA 3SN6A 2XA9A 4C2BA 5L4SA 1OAOC 2FUKA 3HFJA 2FFAA 1NQWA 3GHHA 3OU2A 4JVSB 3LUAA 2QORA 4WERA 5ARCA 3UV3A 4MUMA 2B2NA 4PPYA 2KBEA 4WSOA 3UTCA 5KB3A 5T7BA 3MW8A 1AKWA 4MI9A 4QUJA 1NJGA 4FVTA 1GNTA 1BMFA 3GL9A 2FLKA 2AN5A 2CHFA 4ZZIA 5KHLB 1RC1A 3C5EA 2X4IA 2W8BB 1RNLA 4S2UA 2N47A 2Q49A 3S28A 4NABA 4ETNA 5ESWA 2B8TA 1PLJA 4J0IA 2EXXA 3M8KA 3T3NA 4LEIA 1YCGA 2JGEA 1KPIA 1TRKA 3USCS 2NUPB 1JEYB 3I2FA 4EB6A 2NZ2A 2WJHA 3COWA 4MJLA 3VJKA 2GYYA 2XDQB 4P4GA 1N2BA 4RF2A 4IX1A 1W0KD 2O2ZA 4O5AA 4B45A 5HHTA 4P81A 3PXUA 5I5EA 4QTXA 1CUFA 1GTG1 1QHEA 2DZDA 1GGNA 2PYDA 3CPSA 4M83A 4QUKA 2FWPA 4QBKA 3T7IA 4UKDA 2WTUA 2BFDB 2C7BA 5EYPA 1E7MA 3AOEC 1NJ2A 1Z0DA 4OV6B 4AAYA 4DLZA 2NAPA 4IR7A 5AK6A 2F90A 2JLBA 5K8CA 5IVKA 5J43A 3D02A 4J90A 5AW2A 4Q19A 2Y1LA 2J3DA 4OGWA 4BYMA 2GSDA 2JFNA 3NHAA 3BB3A 3U62A 4ZCRA 1JU4A 1AXRA 1F9AA 1VI6A 5DBIA 1UBOS 3RK0A 1K4YA 4RV4A 3U4IA 3AEZA 8LDHA 1T13A 2O1SA 2L69A 2GPYA 3WVNA 3KKMA 1WULS 1O5OA 1JUDA 3HZOA 1XVUA 4X9XA 2GBIA 2ZIXA 3LQYA 4F4DA 3EULA 5C51B 2QJRA 4DBLE 1SG9A 2XDQA 2JBAB 4KMMA 3UVEA 2PCLA 5IUJC 3NCHA 2IOYA 4HRAA 3RHSA 4A16A 3T1TA 3X1YA 3S5JA 3WMXA 3ZCVA 1RHJA 1OLUA 3ADOA 2G07A 2GZ2A 3AW9A 4P53A 5HGJA 3NGXA 3NMUF 3OE7D 2F67A 5JUWA 4BBPA 1D2GA 5ALWA 2QBYB 1A9RA 2XKBA 3PBKA 4Z0HO 3RSSA 4DIEA 1NSTA 3KQPA 3JD3A 2PX3A 1SGWA 4YCBA 2VCYA 4CCWA 4UM5A 1T5IA 1P2SA 5D00A 3DF7A 3UXHA 3THWB 3KR2A 2HH9A 2QLLA 4HFRA 1RXWA 1BVHA 3FIUA 4LHVA 5EIXA 1EX7A 4LDJA 2JCGA 4RELA 2RHLA 3N8IA 2YY6A 4H0FA 4LOAA 2ZANA 3PQ7A 1HYBA 2VUIB 2HEIA 5HG0A 3RG2A 3CURA 2TECE 2FPLA 2C4VA 3U44A 1F8GA 5KQSA 4BNFA 2EJUA 5ELMA 4KPYA 2NT4A 3SXUA 1KEUA 1WXDA 1G1MA 1YR9A 3H42B 2PZJA 1RC8A 1WBJB 4DYHA 5AJXA 1CXZA 5FKJA 4ILKA 3HL4A 1IMJA 4GVLA 2P3LA 3HVJA 3VOTA 1YA8A 4I4LA 1TQ6A 4K9OA 4LSGA 1P0CA 3T5BA 4CDNA 4EJ0A 2WVGA 1QNLA 2AIRA 1D04A 3AG5A 3BGIA 1F8FA 4NYMR 3VAZA 4XEUA 2XPCA 4JZKA 4NYIQ 2FF7A 5CDHA 3GRVA 1L8OA 2IHKA 2RCYA 3AESA 2JZNA 3BGDA 1DEKA 1NQ5A 3VHLB 3IMEA 1AS0A 3IAAA 5AUPB 1E0JA 2BGTA 1ECFA 3P2YA 2EYUA 2TMGA 5D87A 5LOVB 2OKGA 3OESA 3A27A 2CJFA 1T9HA 5EHNA 3V1UA 4FWTA 3E48A 2ZUDA 3UUFA 3CZAA 1QB8A 3HVIA 1HGXA 2PFSA 2XT0A 3DZHA 4R5MA 4B73A 4CMEA 1DG3A 1OXTA 1BHSA 1ZXLA 4JB0A 1TI7A 2DH5A 4BGVA 5K4HA 3H4TA 3K0KA 1M2FA 4ZT2A 2ENWA 2CHVA 3DVLA 2HQRA 1DAPA 3LUDA 4NZPA 2A0FA 3I8SA 4LHWA 4ZAYA 4GQIA 1DIRA 3MGBA 3ZD6A 4B40A 3M1LA 1USVA 2X8AA 2SCUA 4DM7A 1G6KA 1SOMA 4MR9A 1WHTB 4KSCA 4ZYLA 3DBVO 1U2ZA 1Z7WA 3SSMA 1JIIA 3T0GA 5HJEA 4YCCA 3C15C 2AI1A 2FN7A 1Z4LA 1HOXA 3IEPA 4FLEA 4Q47A 3RARA 2QQ0A 3FDFA 4TROA 1NMSA 1II8B 1VXRA 2XECA 2R00C 2I3AA 2Q3FA 2QMQA 2D74A 4OF4A 2H92A 3PDCA 1QC5B 1TCBA 4KQEA 3KKPA 5EJEA 1M2VB 1ZL2A 4F7DA 4BFTA 3QUCA 1HYQA 1FLAA 1K08A 2XGOA 2GCPA 2GAOA 3HV0A 3AL2A 5E0KB 1Y4DE 1UAAA 4U2KA 4GP7A 2GD2A 3KXIA 2Q46A 4MCAA 3MHTA 1FRQA 1E66A 1MC4A 1GCAA 3WP0A 5KX5B 5F7ZA 1N6PA 3C5CA 3FPBA 4R0NA 4CIYA 1IXYA 4DSTA 2MOKA 1D5WA 4K9PA 4M2LA 1KVQA 3KVOA 4BLRA 1JH9A 1K7YA 1WPRA 1MFZA 3LYHA 1LK7A 3TPCA 1T3TA 1D2NA 2GD1O 2QS9A 4OMUA 3R9KA 5JCJD 5IFLA 2P1DA 3JQBA 1EAYA 4K9QA 2XUZA 1FX0B 2PXXA 3AGQA 3UATA 3ZCRA 1JLLA 3NXKA 3QXCA 2C4UA 2X4LA 5K3FB 2FZWA 3UNXA 1J6UA 3AR9A 1TCVA 4HI0E 3DLTA 4X1KA 4IIBA 1E0KA 2A14A 4FMDF 4AIIA 5KVAA 4K05A 1N5LA 1S2MA 1VP3A 4QYMA 4U9IS 3MCTA 3DKRA 4PGMA 4LF5B 4DV1B 1O89A 3IX7A 1FX1A 3C14C 4RPCA 1PG5A 5CXSA 2JGLA 1LZKA 3CXRA 1W46A 4YUWA 2FPPA 1WCYA 3PNQA 2VAWA 4FMCF 4WBXC 1HE8B 1E60A 4X54A 3ZV3A 2PUBA 3DBIA 1NV8A 2W43A 2A1UB 1TT5A 4N65A 3T9EA 4XB6B 4DW8A 5HVNA 2JAQA 5TJHA 1W1WA 1QKJA 5DMHA 1W88A 1M2GA 4HNUA 2X4GA 3DT6A 3H8SA 4AZ0A 1KI2A 3CZQA 3U7HB 2WJVA 5KWIA 4NG4A 3RJ9A 1NQXA 3AB7A 3IQIX 3TUZC 1EIZA 5KJCA 3Q8XB 4MZDA 3TLBA 5FPTA 3L92A 4M0LA 4OFWA 3AF0A 2VK1A 3ZC3A 1YACA 3ONEA 1DXYA 3QKIA 5LYJA 3U26A 3NANA 1SQ6A 4UOEA 5ADWA 4ZYXA 1CUGA 1V3VA 5J5VA 4PHFA 2H3EA 3OT4A 3D6TB 1OLXA 4QFDA 1MJHA 4D9BA 1QP8A 3P1JA 5TSDA 3O4JA 1TIBA 2ZBFA 3HLTA 3B60A 1BDIA 4ENSA 4DADA 3F96A 3NPMA 4M8IA 4WACA 3EG5A 4FILA 3I76A 2OWDA 1JDUA 3NUQA 4UE6A 1UFQA 5BW6B 4CFZA 1R12A 4XCXA 2BP7B 2OLEA 3QPBA 4CKBB 1X8XA 1UK8A 4HAOA 4DV6B 1MABB 2ZT8A 4C0JA 2DFDA 2VNJA 4OOFA 2WM3A 4BTLA 2FSGA 1A2OA 4GHWA 3AVUA 1GNQA 1GFWA 1YHYA 3LK7A 9ATCA 1ZJ4A 2ONCA 3DBLB 1LY1A 3TAUA 3DDHA 1MW8X 4ZO9A 1K6EA 4MR7B 1IQRA 1MHPA 1HNNA 2JGAA 4FI3C 4I55F 4PAWA 4Z99A 3TWOA 3HWRA 3FYTA 3I61A 1CY1A 1O0SA 2X3FA 5KNCA 2G04A 2XQGA 1P0FA 3EYAA 1KI7A 1ZGBA 2XVYA 1SCBA 2VDNB 3FDIA 3H2JA 4K7JA 2ZRGA 4MPTA 4R2LA 4JENA 2X0RA 2X2FA 1E1QD 2D59A 1NE2A 5IG2A 1FFYA 4U2BA 2JVIA 3EXG1 2VZ8A 1EM6A 1IHOA 3DE7X 1NVVQ 2ZB7A 4XUDA 3SHOA 4FCCA 5FA6A 1XMQB 1K8QA 3AT1A 2UYQA 4JLWA 3UWOA 3H05A 3EVFA 1XDUA 3EFBA 3OETA 4UTPA 1VE6A 1LSOA 1Y9JA 1L4KA 2HY7A 3VZDA 1DEXA 1CUZA 1Z8HA 2F6RA 5CHYA 5CVUA 2PBLA 1AGYA 2ZITA 2WUEA 3NC1C 4ND8A 4UU1A 3P0IA 4PZYA 5GTDA 3F5QA 3R0IA 3UMMA 2BD0A 4N18A 4BPRA 1Y7LA 1JG6A 5H16A 3A2KA 4O0LA 4FGWA 1PJ3A 1HUQA 1KMQA 4A8JA 2NSHA 1G9XA 5U4XA 4E08A 4RCYA 1GY8A 3BFJA 4AJOA 4E13A 4UTNA 1S2IA 1UKAA 3ZWAA 1L9XA 4YAGA 5DK4A 3JATA 4B3GA 4GPBA 5AVXA 1R9MA 1VKJA 5A05A 3GLTA 1H2YA 1QCCA 2NZWA 5E0OA 5IAEA 1GZHB 3HCDA 4F38A 1YKGA 2JKVA 2XYVA 4XWAA 5ALXA 5FCDA 1MCZA 3EFEA 3HJNA 2J3QA 2O48X 3AF6A 3REOA 4CF6A 5KYXA 1T0PA 3A31A 2HBZA 1N5OX 3DE1X 4O8CA 3LZCA 4TXLA 4MUKA 5IJWA 2C5AA 3LPDA 3LUGA 5EE9A 5EXPA 1V2HE 5KAMA 4D8VA 4E94A 2QNBA 5DWVA 1QUEA 5FX2A 1W4LA 3A1EA 5D86A 3QX9A 4IL5A 4BMYA 2D0PB 3MQ2A 4RD4A 4WLOA 5AM4A 5HA5A 2D7JA 5CFZA 3A4TA 4R69A 3DOEA 1LXCA 3P2EA 3NQ41 3JQBC 3AEKB 4LX8A 1TU3A 2MYTA 2QRZA 3QX7A 1U4SA 4FOLA 4C4OA 1N8KA 4I9HA 1AZLA 4G56A 4IUBS 1E2PA 3A6LA 2K7ZA 1CUIA 2OD2A 1A0OA 4YV0A 1O0BA 4NONA 1DO0A 3NT4A 5JCPA 3FMIA 3HO8A 2Z5GA 3IT3A 5B2ZA 1BWRA 3CFYA 3V1NA 3E9ZA 4RQUA 4MGEA 2O2GA 2PJUA 2NVUB 1IIRA 1FFXA 4IIFA 3PL5A 3JQAA 1S2NA 2UXCB 1TM7E 2F59A 1G2IA 3OM0A 1UEJA 4XX1A 3FOZA 1QWOA 1N5IA 3O6VA 1NQAO 5KDLA 1C3EA 1RRGA 2CMFA 1CDDA 1U3CA 5EXXA 1P6QA 1XTIA 3HXKA 3MCAA 3ZJTA 5DM4A 1DTEA 4MQUA 1PZXA 4K8OA 1N3YA 1TEXA 4M46A 1CY2A 5AM5A 3WGQA 1IY8A 3PHHA 4E5KA 2WP8J 4XX0B 3X44A 2JAHA 3EVNA 4YCLA 2LGJA 4KXFB 4D8WA 5ALDA 4F6RB 4MR8A 4F85A 1A27A 4KE7A 4YMVA 4J7AA 4R3WA 3ZHXA 3ZU3A 4Z7QB 4MYUA 1U5BA 3LFHA 3PFFA 4L51A 4N54A 3EDQA 5SYNA 5GV8A 2B8JA 2H59A 1JECA 3HCWA 2IHJA 3STYA 3MT8A 3STVA 4DT1A 1EB8A 4QQ8A 4FFPA 3O1JC 1A95A 3AONB 2WA2A 3FCCA 2OO3A 1NDUA 3F97A 2M6LA 3V6LA 1UKYA 4ALKA 4Q7QA 4UZSA 1E3LA 1YVRA 4A27A 1VIYA 4UAJA 3TGLA 2QSUA 3EGXB 2NZXA 1M1YA 3HC7A 4NCJA 4QRDA 4UD2A 4XFJA 5C8DA 3U7GA 4P22A 2IYPA 4HYQA 1BS1A 3DVRX 3K5HA 1JW9B 1T26A 1YDWA 4DIDA 2BGKA 4XTCS 3MF4A 2XGJA 3T3OA 1F6DA 5F4ZA 2YBDA 2VHEA 4BJ5A 1OYVA 1SQSA 4ZDIA 1MQ9A 2R96A 1JZTA 5BSTA 3ICWA 4P58A 4FJ0A 4TT8A 1KOFA 3W05A 3AH8A 1BA2A 3IJ5A 5JFTA 4PC1A 4LDPA 3H5OA 1LI7A 4KQIA 2WP0A 4V0KA 2NUAB 1U8EA 3B6ZA 1V5WA 3EISA 3KSMA 3OMLA 1I9CA 2OUIA 3TRJA 1EIWA 2HADA 3Q9SA 2GZ1A 1QLJA 1BHO1 3S68A 4BXOB 2I6GA 3HB1A 5KIAA 1H8EA 4I50A 4L5IA 1QJ4A 5GONB 3G2HA 2C61A 2PR2A 3G89A 4YS6A 4BFWA 1VCIA 2PZEA 2QN7A 3FYUC 3EW7A 1JDSA 5FWYB 2C5LA 1DAKA 4DIOA 1G21E 4KVFA 2GEUA 3BULA 2QDKA 3BK2A 1QRAA 1L7AA 3RGWS 2IYXA 3MJTA 1S2DA 2IEIA 2JLSA 3B1FA 2PMKA 3ANNA 3P8ZA 4G85A 1XGKA 2MR6A 2R5NA 2FSHA 2YRWA 4GPIB 4N5DA 3JYPA 1Z4NA 3DOHA 3TVTA 2O4UX 4WRRA 4XDGA 5TPZD 1LKZA 2I4OA 2I3ZA 2R84A 4KQ1A 3KG2A 2BUCA 2CV2A 1CHNA 1AQJA 2DHQA 1DL5A 3MS4A 3ZIAA 4JXJA 2V4UA 3BZWA 1CQXA 1VSQA 1H5UA 4YMSA 5DP2A 4J0HA 2ENUA 1SQ5A 5D2CA 1LBTA 2BMWA 1Y81A 2HMTA 3QSGA 1F9EA 3DHVA 2PMDA 4K88A 2XR1A 4PFQA 2C9BA 3ORHA 3TW6A 3WKCA 5C9ZA 2G40A 121PA 5IABA 3TG8A 4QYXA 4FQ8A 3T3PB 2C1EA 5EJ9A 4C0BA 3MJRA 4GC9A 4OQ4A 2WNHA 4EGAA 3K8OE 4OHXA 4DLPA 2FW7A 4FI3F 5AOBA 2DFPA 3RRNA 1HORA 2FVXA 3D6NB 3HFSA 1Y1SA 2YASA 1MU0A 4MKZA 3RYFA 3VYWA 4XRRA 1W4RA 3EEIA 1NRWA 3OIYA 4R8LA 2AE1A 1IOWA 4A0RA 1IC6A 3KZKA 1C9JA 5IVPA 5D6OA 4ZHQB 3EUAA 4TN5A 4CLOA 5KNBA 3GV0A 3FDJA 3ZLUA 4KIFA 2WSMA 5FUBA 4XJXA 1E6CA 3E27A 1NULA 4ETIA 2VLBA 1JKJB 3W5DA 1SXPA 3CF6R 5E4FA 1CJBA 3AR5A 3FLEA 2ABWA 3QVSA 4UCXA 5JSHA 5C1IA 5FBVB 5P8WA 3NGMA 4NPHA 1B1CA 1SUEA 3DZJA 4W63A 4BZZA 4A8JC 1I1QB 1HSOA 1P4RA 3VOSA 4ARBA 2MYNA 1JFSA 4G1VA 1XTUA 2CFCA 1CS0B 3LX5A 4JYZA 3RSOA 1IWBB 1E1DA 2QUBA 3VZCA 2JAPA 4TKVA 5AW6A 5H5JA 1TJPB 1XXLA 1YZUA 4UHJA 3GFVA 5ANRB 3ZWKA 1V7QA 5EIAA 2NLOA 4R51A 3NWPA 2DR2A 1X86B 5LP1A 1KRWA 1F5SA 1AK9A 1G42A 2MSEB 4KFSA 2WSSA 5FA8A 1NSFA 5KCMA 4MI1A 4DCGA 4HTFA 2CXQA 3EF1A 2ST1A 3KETA 1DEHA 3OLCX 1I80A 1FEZA 2VHYA 4TL7A 4IX9A 4MW1A 1NF9A 1RRKA 2GEJA 3FSJX 3HRIA 3HJRA 3ZCXA 1RBZA 1LPSA 1OUMA 3P2IA 3F78A 3TE6A 3VR0A 1VE1A 2XZDA 1OI4A 4IAOA 5HEKA 1WSBA 4KO3S 1PBTA 2MU1A 2DC1A 4Q6WA 3IR7A 5AK4A 4R7ZA 2Q3BA 4M36A 2HF8A 1NJSA 4ZCPA 1QOQB 5I4CA 1H0HA 4I50F 1Z6XA 3INRA 3NHBA 2WIAA 1XA0A 4K9DA 2NYVA 3NO4A 4HXFB 4O2BA 3JAKB 2HIHA 3WRXC 2QMHA 5FYDA 3GJYA 1XZPA 4IUDS 4LYGA 1PG0A 1PU2A 3QTLA 1PZNA 1U65A 4PZLA 5IP5A 1EX6A 3RANA 2E3JA 4LJ9A 3N2NA 1SIOA 3O4GA 1VYHA 3MWLA 3OP4A 2PS1A 2MSDB 2UUCB 3QUQA 4HADA 2ZLBA 2FMKA 1PLKA 2BEVB 3DVQX 2DULA 4WNYA 5TE9A 1P3JA 1A7UA 1UMCB 2YJGA 2ZZMA 3E2MA 2ZRNA 5AHKA 3TTVA 5CLJA 2JGDA 3KO8A 3ZVMA 4D97A 2QQEA 4B43A 1N7GA 4QPCA 2J87A 4B33A 1Y5NA 3A9SA 1ATZA 1POXA 2R4UA 3HJUA 1P9NA 2IP1A 4IINA 4WGFA 5FRDA 2ATVA 2C99A 2COKA 3VYUB 3KZNA 3QVTA 2JHGA 4O4LF 4BZWA 2NO1A 2FZLA 1DDIA 4CKCB 4UMVA 4URUR 5ALSA 5E6RA 5SZJA 5JY1A 4DEXA 3ZUPA 3Q0IA 3ROGA 3OHPA 4I3GA 1VGRA 2ZYRA 1J2RA 3WLEA 3PYMA 4WY8A 2PMEA 5BQFA 1KSGA 2PLNA 3H1FA 3ISTA 4R68A 1II0A 3WYGA 4QYTA 5F9HA 2IUEA 2XRZA 1PBNA 3PR3A 4NECA 2AFIB 2Q5LA 3VKHA 2BUBA 4G07A 4D8TA 4F3KA 4L5CA 4PQRA 3OLXA 1KBOA