3B1FA

Crystal structure of prephenate dehydrogenase from streptococcus mutans
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
290
structure length
286
Chain Sequence
AAAMEEKTIYIAGLGLIGASLALGIKRDHPHYKIVGYNRSDRSRDIALERGIVDEATADFKVFAALADVIILAVPIKKTIDFIKILADLDLKEDVIITDAGSTKYEIVRAAEYYLKDKPVQFVGSHPMASGAVAANVNLFENAYYIFSPSCLTKPNTIPALQDLLSGLHARYVEIDAAEHDCVTSQISHFPHIIASSLMKQAGDFSESHEMTKHFAAGGFRDMTRIAESEPGMWTSILLTNQEAVLDRIENFKQRLDEVSNLIKARDENAIWAFFNQSRQIRKNME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative prephenate dehydrogenase
publication title Crystal structure of prephenate dehydrogenase from Streptococcus mutans.
pubmed doi rcsb
source organism Streptococcus mutans
total genus 95
structure length 286
sequence length 290
ec nomenclature ec 1.3.1.12: Prephenate dehydrogenase.
pdb deposition date 2011-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02153 PDH Prephenate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3660.10 Mainly Alpha Orthogonal Bundle 6-phosphogluconate dehydrogenase C-terminal fold 6-phosphogluconate dehydrogenase C-terminal like domain 3b1fA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3b1fA01
2J3IA 3LC7O 4Z0PA 3V8BA 3ZH2A 4N7RA 3H2SA 1LRLA 1B3RA 4E0BA 5I7FA 3C85A 2JD0A 3OIGA 3FD8A 1JKIA 3OA0A 3PWSA 4FGSA 1H6CA 1HETA 4NFYA 2GN9A 2EG9A 1EDZA 1K6XA 4U7WA 1SPXA 3UICA 2HK7A 4R51A 1LC0A 1VSVA 5CPFA 3G79A 5A3JA 3QQPA 4KWIA 4OO3A 3VHRA 1QP8A 4AJIA 1XELA 5JLAA 2XPCA 1NVGA 1YQDA 1GD1O 2GRAA 3ANLA 3GUCA 3EGOA 1HLDA 3QIVA 4R1NA 4A5OA 1E77A 2NTJA 3U4IA 1J49A 3DAPA 1PL6A 4IJUA 1G1AA 3VZQA 4CQMD 4N5LA 5KNLA 1ZK0A 1GUFA 3IUSA 4CQLB 1UP7A 3EVTA 2DBVO 2H9IA 2JHGA 2QRKA 4MVJG 4PRLA 1RM3A 4ALJA 5ES3A 2WE7A 3PHLA 1AHIA 1ISHA 1E5LA 3ASVA 2YZ7A 1U9JA 3WNVA 1FDUA 3QVWA 4JJIA 4L9RA 3K73O 4NBRA 1P33A 1UXJA 4G2NA 4JJGA 4AG3A 5JDCC 4OH1A 4FS3A 3L4BA 3PYMA 4O63O 2VRCA 4XB2A 1B26A 4PZDA 1LXCA 1JAYA 3KB6A 4ROSA 2X5JO 3HB5X 3BTUA 4WK6A 3WSVA 4P4LA 5BR7A 3S2FA 2UUOA 4B3IA 5I7EA 3RC9A 3P7MA 2J5RA 2W4QA 5JAMA 2DBRA 1E0DA 3C3XA 4XQ9A 3Q2KA 1RYEA 1HT0A 2EW8A 4AJNA 4J91A 4BKOA 5GY7A 2WSBA 3ABIA 5DCUA 5B4UA 5AVOA 1VRWA 2X0NA 1QYCA 3AY6A 4BVAA 4IDEA 2WYUA 3GZNA 1PWZA 1VJTA 1M67A 3PJEA 4BV9A 2E37A 4BMNA 2IRWA 1TT5B 4CQMA 4LMPA 3H9EO 1KVRA 1WZIA 5A5FA 4Z6KA 3AUTA 3SXPA 2NACA 3HZZA 5JXWA 5BNFA 1LLQA 1B14A 2O7SA 4YBZA 5KIAA 4F6CA 3AOEC 1YB4A 2WJPA 4BS9A 3SC6A 2DTDA 4J49A 2FPGA 2B0JA 4IBOA 3CXRA 2NSDA 2P9CA 3KSDO 2C5EA 4FFOA 2VWHA 2ZKLA 2VZ8A 3KLPX 1IUKA 3PPIA 4URFA 1EBUA 2V7PA 1SO8A 3CUKA 3GC6A 4LVCA 4GWKA 4U6SA 2Z95A 4JJFA 2Y0DA 4QSMA 3KEOA 4NIMA 4QFCA 4A27A 4AVYA 5A9SA 2BKAA 1AN9A 3WGYA 3EHEA 4BOYA 1XKQA 1P9LA 1Q1NA 3KV3O 2I3GA 2VTEA 4DLBA 2PD6A 3WMXA 3DBVO 2G1UA 4B3JA 2GO1A 1HDCA 3RQSA 2AEFA 3ICPA 4YEDA 5G0TA 5DBFA 2PY6A 5CEJA 1GYQA 3TZCA 1BXKA 1R4NB 2VUSA 3WYCA 4ZICA 2GNAA 3VZPA 1XU7A 2QG4A 1TT7A 2PFGA 2AQKA 1NVTA 2OL4A 3UCXA 4CM6A 4RVDA 3IL2A 1UXHA 1EBFA 1VL6A 4RO0A 3LYLA 5L3ZA 1DC6A 5ILGA 1MB4A 2HMTA 1R4MA 4A7PA 5F1OA 2YV2A 4HFRA 2VNAA 3WYBA 1WDMA 4ALKA 4MKXA 2BFAA 2CDCA 4ZU3A 3WBBA 4B7CA 4A10A 1ADBA 3LLVA 1YKFA 3VPHA 4XIJA 4I9NA 1KY5A 3ZNQA 3L4SO 5IJZA 4E30A 3HDHA 5H83A 4FSHA 5EPOA 1PL8A 2YHIB 1ENYA 1LLDA 3RFXA 4D3SA 4BL5A 1KBZA 1LC3A 4YAIA 3OBBA 1UZLA 4JK3A 2FSVA 3V1TC 3D4NA 3GA0A 1J6UA 2IDZA 3AI1A 1DLIA 1T26A 2W2KB 1HZJA 1ZK1A 3RC1A 5TQVA 3O4RA 4LISA 4DXHA 2DLDA 3S8MA 5DCWA 5AXAA 5AXCA 1PR9A 2O7QA 5BNTA 4FB5A 5IFLA 4RPGA 3UF0A 3VTZA 2Q4BA 2DT5A 1ARZA 2DU8A 2X0RA 4CLXA 2BMAA 4DMLA 2FN7A 4LSWA 1I5RA 3H7AA 1ZZEA 4D44A 1WDKA 1JLLA 1V3VA 4EEXA 3WWZA 1R0LA 1A7KA 2FZEA 3BZUA 1O6ZA 2ZQZA 3HJAA 1QMGA 4DQXA 4H7PA 4PZEA 3PJFA 5A03A 4EUEA 4RPHA 5JY1A 4XKJA 2AG8A 3K31A 3UGKA 4BNKA 1WXDA 3JQBC 2GCGA 1LQUA 1ULUA 5JYEA 3ZU2A 1B8PA 3TFQA 4L75A 5A05A 1IPFA 3ROKA 4RPKA 1I2BA 3RFTA 4IDBA 2QZ9A 3ZNPA 5G0SA 2J8ZA 4K9DA 3U4HA 3PIDA 1U5AA 2Y1DA 1CYDA 1GR0A 4K1LA 1QG6A 4MVJF 3ZV4A 1PGPA 5JYDA 3ONDA 4GWGA 2AE1A 5B4VA 1LSJA 3JQ8B 3IS3A 2A92A 2JCYA 2Q1SA 1EFLA 3BAZA 3VDQA 3AU8A 3WJ7A 4DPLA 1YRLA 1X7HA 4NJOA 4MKRA 1JQBA 3IKVA 3VH1A 4DC0A 3F1KA 4CM8A 1P1FA 2Y66A 3GR6A 2EXXA 1GZ3A 3MOGA 5DDIP 4HADA 2BGLA 3JYLA 1ZW1A 4I5DA 4KOAA 5K9ZA 2JFGA 1Y8QA 4QEDA 3N74A 1ID1A 3GN2A 3HB4X 1DAPA 3WDSA 3U09A 2YDXA 4BKUA 2BGMA 5EINA 3D3EA 3ORFA 1E3WB 4MP8A 3EMKA 5AYVA 1HL3A 4GAEA 2VOJA 2I99A 1HYEA 1Y5RA 3KYCA 1XYGA 1KS9A 5G4LA 3KVOA 2YFHA 1C0IA 1EQUA 4L4XA 1E7QA 4Y98A 3ZWNA 1DLJA 3EC7A 3WGTA 4KZPA 5C7IO 3GY0A 1D8AA 3AOGA 3DL2A 1IHXA 2CMDA 4IJVA 3WJAA 3FCOA 4XGKA 1HDGO 4WECA 1PR3A 1P0FA 4W7HA 2AMFA 2I76A 3IP3A 3ASUA 3OETA 1EDOA 1K0UA 1BRMA 1P1RA 4JCOA 4YDRA 1PU2A 4RPLA 3HADA 3C7CB 3QLJA 4EZBA 1IE3A 3JQGA 5IDXA 3MTGA 4IPTA 4GGOA 1HE2A 1JKFA 3MOIA 2WD7B 2GASA 4P8RA 5DBGA 1BDBA 1PJSA 4MJLA 3PXXA 4ZQGA 3UKOA 3ZWMA 3AFNA 2GYYA 3GNSA 3PDJA 2Q1UA 4Y8VA 3GVPA 1V8BA 4NBVA 1MA0A 1ZKMA 2JL1A 4WCDA 1H93A 1JU9A 4ALMA 3LT0A 1YO6A 4ALNA 2DQ4A 2DUUA 4WPGA 5IDQA 5TF4A 4KTTE 1O95A 2CDBA 4IS2A 2JD2A 4LMRA 4M86A 5CDSA 5HS6A 3ZWYA 1J0XO 2PLAA 3RUIA 1X1TA 1LUAA 1ZK2A 2C7GA 4D46A 3KSZO 4NJMA 4GX1A 4WEOA 2IYOA 5JO9A 4IGFA 3INRA 1K2WA 3UCFA 1U8XX 4J9UE 4P22A 5T6BA 5TC4A 1ISJA 3TOXA 1H5QA 3NAQA 4B8ZA 3ETGA 1H94A 5JCXA 3ENNA 4TMFA 4D42A 3WQRA 2ZTVA 2Q2WA 1KC1A 1WZEA 4YRAA 4JROA 4FFLA 1NFQA 1E7WA 1GV1A 4CM9D 2ZTLA 4WLOA 3AOEA 1DIAA 5K0ZA 2I65A 1ZMTA 4UUMA 1ZNQO 2BI7A 5IN4A 4BO4A 3ZWAA 1PS8A 4LN1A 1OOEA 5BSEA 2RCYA 1NHGA 1GPJA 3LF2A 4KTVE 2G82A 3F4BA 5CPBA 5F3RA 3SLKA 4OXKA 1OFGA 2XXJA 4PG6A 1JAXA 3IC5A 3RSHA 1BW9B 4ZD6A 1C1DA 3PHJA 4YTEA 1EMDA 1DXYA 4Y67A 1S6YA 3S2EA 2I67A 3Q3CA 3ADPA 3I6QA 3C1AA 3Q9UA 1JWAB 3MJCA 1XQ6A 3NTOA 4R5HA 5DP2A 3GRPA 5T57A 3PVZA 2VCYA 4R68A 4B4OA 1YJQA 4FPXA 1DC5A 2YFQA 2FSSA 2J3KA 1VC2A 3D4PA 3WTBA 4ZJUA 4YQZA 1GV0A 3BMCB 3KZVA 2PH5A 4NU5A 4XYGA 4J4HA 4CR6A 5CAEA 3JD4A 4WLEA 5EQFA 1P3DA 1DIHA 1QORA 3HDYA 4QT0A 5U1PA 4TVOA 3W4IA 2VHXA 4M8SA 4MDHA 3CPSA 1GQ2A 3HDJA 1ZFNA 4IY1A 3FHLA 3AI3A 2G5CA 4FJ1A 4Q3DA 4UULA 5JCJD 4AJHA 4UVGA 3ROPA 3AWDA 1ZH8A 1Z75A 3JQAD 5DT9A 3BTSA 3OQ1A 4QFDA 2V6FA 3RU7A 3SVTA 4J0FA 4GLLA 1KEPA 1B0AA 3ZU5A 1ADFA 3U9LA 5F1PA 4BO0A 1B16A 4IJWA 3ON5A 3D7LA 1UH5A 1C1XB 1QR6A 4FGWA 1HSZA 1ONNA 1PQPA 1ZBQA 2OZPA 2X58A 3VZRA 1HEUA 4Z9XA 1QLJA 3QE3A 1VE9A 4RL6A 1NYTA 4FBGA 3GK3A 3DXFA 3FNGA 4B3HA 3WG9A 5AXBA 1GUZA 4XA8A 4E2ZA 4RORA 4ND5A 1N1EA 5DZSA 2B36A 4MIYA 1NXQA 5TT0A 3K6JA 4D41A 2P9EA 4BUCA 4RJTA 5HM8A 2I5PO 5ADHA 1NPTO 5KVQA 3HN2A 1KVUA 3G49A 1SEVA 2QZZA 2OOSA 3RU9A 1F0YA 4MP3A 1N9GB 1MLDA 1DC3A 1OC4A 4XB1A 5FFFA 1LDEA 5H82A 3TSCA 1QXSA 5JMPA 4RGBA 3IJRA 2Q1TA 4IMRA 2WYVA 1N5DA 1CEQA 1PTJA 4BB5A 1YJ8A 2O48X 5CDUA 3ZV3A 4HUJA 4NFSA 1YVEI 2V65A 3LQFA 4K6CA 1KETA 5JDIC 2QX7A 4Y6PA 3K92A 5JCJA 2ZJ0A 3WQQA 3JD0A 3NDJA 4CL3A 1ZJZA 3PK0A 2VOEA 3PP8A 5G0WA 3JQAA 1HDOA 9LDTA 5AXDA 5F5NA 5JY6A 1PJLA 3L6DA 1W6UA 2O3SA 1NX6A 3GH3A 4IMPA 5KJ6A 1DFGA 2CDAA 2NUAA 2Q4EA 1E1LA 2C29D 1KVSA 1U2GA 1Z6ZA 2GDZA 3EZLA 4IQ0A 4A0SA 1PIWA 3RIHA 1HF3A 2YYYA 4PLZA 3I52A 4XCVA 1I33A 1GCOA 4KUHA 2BF7A 4NI5A 1A9ZA 3E6AA 4R9RA 2BD0A 5JW6A 4GBJA 4IQ8A 1DB3A 3DTYA 1GL3A 2HUNA 2YHUA 4WEQA 1T24A 1BXGB 1ZSVA 2I6TA 4A03A 1OC2A 2H63A 1SAYA 3RASA 2EWMA 1AXGA 5I9NA 1QV6A 3TZHA 3ZWCA 3AUAA 2Y1GA 4GSLA 1D7OA 1KOLA 1HDZA 1VKNA 2PZKA 2BFOA 2C0CA 1WVGA 3RFVA 4NDNE 2PGLA 3RD5A 4GQAA 4HBGA 5EN4A 1PS0A 3DWFA 1MP0A 3DZKA 5I7SA 4TWRA 3QV1A 2XF8A 3CEAA 3VVBA 1HWYA 2NU6A 5CG1A 2QHXA 4J7UA 4BNLA 5FYDA 4BMSA 3RI3A 1EZ4A 3ZN2A 4BIIA 2OHXA 3GEDA 5JAZA 3JV7A 4LVUA 2RHRA 1NPDA 5DN9A 1UDAA 4NZ9A 4R1UA 1Z7BA 3IUPA 1JA9A 5IG2A 3CH6A 1YOVB 2OORA 3L9XA 3K2EA 1E6WA 3T4XA 1NP3A 3KYDB 1ISMA 3BTVA 4EJMA 3HUDA 2DM6A 3UVEA 2NLOA 1P1IA 2VRCD 1T1SA 4AJOA 3OQ6A 4F6LA 2HDHA 3INTA 1TEHA 4HV4A 5IN5A 4UEJA 3SJUA 3LT2A 1EQ2A 4WUVA 3OQBA 1W0CA 4CLRB 4I5GA 3GMSA 2B5VA 4J1SA 1M76A 2BH9A 5AQ1A 4UVHA 3X2FA 3EVNA 4G81A 4WNIA 3SC4A 4A73A 1YDWA 3D5QA 3WBFA 3RAJA 2OBYA 2SCUA 3V1YA 4BNYA 2Y1CA 4PGFA 1GFSA 4ZQFA 1XEAA 1L1FA 5KKCA 5ENVA 1H0KA 4CLEA 2EP5A 3COSA 2A9FA 3MJTA 1NWHA 1LSUA 1PGNA 3LLSA 5COQA 4ITUA 3C7AA 2J5KA 3F9IA 4FOOA 3KTDA 2HMUA 3TZQA 2GZ3A 5ER6A 4E4YA 2VHYA 4R1TA 4BO7A 3ICCA 1FF9A 2X0IA 2QRJA 4GKBA 1W4ZA 5L7TA 2GUGA 2VYNA 4NK5A 2POQX 1C3VA 1ZVMA 1LLUA 2A94A 3GGGA 5IXYA 2PZLA 5T5QA 2O4CA 5TJ9A 3O8QB 5K6AC 3GDGA 1N7HA 1MG0A 1ZXBA 3I23A 2J3HA 3GG9A 2GERA 5IF3A 3DEYX 2JFHA 3UUWA 1Z73A 4PRKA 1EEHA 4YYZA 3QRWA 1E6UA 1MXHA 1V0JA 3D3WB 4RLSA 4ESOA 1Y5MA 5A4DA 1BTOA 4CMIB 2VZ0A 4YT5A 3AUUA 2HO5A 4GVXA 1A27A 1GZ6A 1A7AA 3PQDA 4NBWA 2WE8A 4Q3NA 3QHAA 3U62A 2B4RO 1N7GA 4BQRA 1UR5A 1R4NA 1IZ0A 1P45A 2NV6A 3K5PA 3QVOA 5CEEA 4G65A 3LSYA 1HE3A 1PJQA 2X6TA 2RAFA 4D0RA 5HTOA 1ZEJA 4NK4A 2AXQA 2CUKA 3I6IA 4J43A 1X7GA 4FDAA 3AJRA 1GY8A 4EYEA 4ZN6A 2C54A 1ZCJA 3FI9A 3P2YA 3ENKA 3O03A 4AICA 1SZJG 5G4KA 3I9KA 3UHAA 1PL7A 3DBRB 4GX0A 2LDXA 1A9YA 1Q7GA 3JQ9C 3ZV5A 1E6EA 1Y9AA 4JGBA 3QWIA 4BNMA 4R3NA 3HQ4O 3K8ZA 1O94A 3IAHA 4BO2A 2ZCUA 4AJ2A 4MPDA 1A72A 1DPGA 3W8DA 4J2OA 3QY9A 3A9WA 2DPGA 1RPNA 4KQXA 4KUEA 2RH8A 3E82A 3D64A 3P19A 2O50A 3JYPA 4E32A 4RDHA 1P1KA 3LC2O 1J4AA 1B3BA 4OHUA 2DPHA 3VKUA 2PR2A 3H3FA 5BNIA 3VDRA 3IDSA 2UUPA 3S2GA 1V3TA 5A3VA 1UAYA 4KWHA 3DAFA 5B1YA 3GNTA 2HSDA 4TKMA 3ZHZA 3DZBA 4OSPA 2HK9A 4R4JA 2VT2A 4E33A 1N1GA 1XIVA 1HDYA 5TJHA 5T64A 5HRUA 5TS3A 3RBXA 1ISGA 1XSEA 1F17A 4QX6A 3SX2A 5TLSA 5HS4A 3GRKA 1WP4A 3ST7A 3PFFA 3GUYA 3G3EA 3I9MA 4L0QA 2BI8A 1U7TA 3VOSA 3QWHA 3PRJA 5F5LA 1UXGA 1C0PA 3E03A 3ROMA 4MVJI 3TL2A 1T1RA 3L6OO 4FFMA 1GUYA 3HWRA 2EJVA 2FPPA 3ONFA 1LEHA 4J0EA 1WDLA 2Y93A 1D1TA 2W2LD 3WFIA 3GT0A 4WLVA 1VL0A 4LCEA 2ZYGA 2YW9A 3E48A 3F5QA 4RVGA 4DQUA 2ZYAA 3R1IA 3K9QO 2HAEA 1X15A 3FSRA 4OAQA 1EE9A 1JTVA 1YE3A 3NJ4A 3M2PA 1L7EA 1K89A 1U1IA 4IGEA 3VH2A 3INGA 4O6VA 4WLFA 1PSDA 1BDMA 3H2ZA 3KM0A 4HFJA 1XA0A 1E7SA 4AL4A 4FJ2A 3JQ8A 4J6FA 1TLTA 4R5MA 5JBIA 3DBLB 1YL5A 2B37A 3LC1O 3A4VA 3KEQA 4I9HA 1PEDA 4BNJA 5I8WA 1EK5A 1F8FA 1XDWA 3MTJA 3TJRA 2D1YA 3GEGA 3OIFA 2EKLA 3RKUA 1Q0QA 3DMTC 1DIGA 1R15A 1GYPA 3DHNA 4L4SA 4BNUA 4Q3CA 1U5CA 1BMDA 2ZB8A 3B6ZA 4UAGA 2FZWA 2WDZA 4DBVO 2VWGA 1AGNA 4BKQA 1LDGA 2Y1FA 4CM7A 2P4HX 4M49A 3PJDA 3JQ6A 4CODB 4AJPA 2YQ5A 3R3JA 2NTVA 4KMSA 3RBVA 1E3WA 4XR9A 4OMUA 1Q0HA 3VKVA 2O3TA 4IXTA 4R1SA 4R16A 1KEUA 2AG5A 4J4BA 3WLFA 3DZJA 2PGDA 1DC4A 3GZNB 1P44A 3GQVA 4UUNA 5DOZA 3ZHBA 5CFZA 1KIFA 4R01A 3MJSA 5B12A 2V6GA 4CQMB 3DFZA 4MVJM 4Y6SA 3DBHB 4MVJH 4FW8A 3GPDG 1A4IA 2DFVA 1T25A 1YL6A 4NPCA 1LRKA 3K30A 3W4JA 4D45A 5C5IA 1E7YA 2W2LA 5L4LA 4E31A 5MDHA 4E3ZA 1G0NA 3NT4A 5CDYA 1Z82A 4HY3A 3H6KA 5LC1A 2X4GA 3DZHA 4E5NA 3RJ9A 2I66A 4CLOB 1DHTA 4M54A 4XZ3A 3M1AA 1ZJYA 3CMCO 2PK3A 3OJLA 4I8XA 4IDDA 2WMDA 3VPSA 3VPFA 4WLUA 2CSUA 2AE2A 3RWBA 4HFMA 4EJ0A 1E1KA 3BMQA 3GF4A 3OM9A 2WD7A 3ZU3A 4DMMA 1H9BA 2X22A 4NFHA 2GLXA 3D0OA 4PZCA 2JJYA 3PQFA 1XCBA 3U5TA 1MGOA 2HRBA 2GR9A 1YBVA 5A1TA 1Y81A 3WTCA 4DBZA 4H3VA 1A4UA 3JQEA 2IE0A 5C37A 4UVIA 4NG5A 1XR3A 1DSSG 1R12A 4Z9YA 1T4DA 4II3A 3HFSA 3TFOA 1DBVO 1WLYA 2O2YA 5U9CA 2CVZA 1ZSYA 1YGYA 3WICA 1YBMA 1SNYA 3WX0A 4GMGA 3IJPA 1NBOA 1U3UA 3WGOA 4XIYA 3HFGA 5L4NA 3CSDA 2C5AA 1PGOA 2ZJ1A 4XD2A 1Y9EA 4CV1A 4QECA 3W6ZA 2XXBA 3I3OA 1C14A 3CZRA 4B8WA 4N18A 4NHEA 1V3UA 1QSGA 2ZTMA 3MCVA 1CQJA 4UREA 3ZW9A 1PJ3A 1NAHA 2EEZA 2NU9A 1VI2A 2ILTA 3ULKA 4MO2A 3ZW8A 3QVTA 4FIZA 1OI7A 1I8TA 1SMKA 2NU7A 1R0KA 3FN4A 4JBGA 2D3TA 3CMMA 5EQDA 2FOIA 2D0IA 1HE5A 3FPLA 4DYDA 1EVIA 4J4TA 1F14A 1PJTA 3U4DA 4ND2A 4RZIA 4PIVA 3RVDA 5K6AA 3H9JA 3ONEA 3OHSX 4HFNA 1N2SA 3W8FA 4PLFA 1VSUA 3F46A 1CERA 8ADHA 2F00A 2F1KA 2PA3A 4CM4B 3JQ7B 3L9WA 1VLLA 1EFKA 3DZFA 2BFPA 3FNEA 1KVQA 3BTOA 1P0CA 4FFNA 1UUFA 2CF6A 3RUAA 4BGVA 3O9ZA 1QYVA 1FDTA 4FFPA 4DIBA 1MUUA 5JDCA 1DJQA 3NX4A 2VHWA 2GPTA 3FBGA 3RJ5A 1NWCA 3EW7A 4Y9DA 3WQSB 3TZKA 3A06A 1CF2O 1Y1PA 4RF5A 5FF9A 6LDHA 4FR5A 4E2YA 1WMBA 4B79A 5CDTA 1AUPA 3OEWA 4EJ6A 2J3JA 3MJEA 2R00C 4R69A 1EE2A 1H6DA 2CVOA 4BHTA 1ZSNA 3M6IA 5DNAA 2Q1WA 1U3VA 2E4AA 2HRZA 4PFJA 4WNCA 4Q3BA 3G17A 3PWZA 3D1LA 4I5FA 5I8ZA 4YWJA 2VHZA 3PLRA 2FRDA 2P5UA 1H9AA 2YJZA 5L4SA 1LLCA 4J9VA 2A35A 5HA5A 4S1VA 1LNQA 5KOIA 1M66A 5JAIA 3PHHA 4NMHA 1JKJA 2EIHA 4P4GA 4LW8A 2IEDA 2ZIZA 3AW9A 4LSMA 4DA9A 4B4VA 3PHGA 3DHYA 4IDFA 3ZZNA 5ITWA 5A06A 1Q2XA 4MVJP 2PH3A 5F1KA 3ROQA 2C07A 3LF1A 5L9AA 4D3FA 3QW2A 4C7JA 3NUGA 2Z1MA 1HDXA 3E8XA 3RUHA 3EAGA 1AXEA 1C1XA 2EF1A 3I9JA 4XGIA 2JCVA 1VL8A 4EEZA 1Y8QB 3BHMA 3OJ0A 3U49A 4O5OA 2B4TO 4IIUA 4MVJE 3UCEA 1EUZA 3I1JA 3AM5A 4J3FA 1JW9B 3FPCA 4F46A 3EK2A 3F6YA 3G0OA 4PLPA 1I0ZA 3MJVA 1EVZA 3WSWA 5MGBA 4BGEA 2PZJA 4CJXA 1O0SA 2OGUA 3KRTA 1OZAA 1FMCA 2IODA 4OKIA 1N9GA 3ZWWA 1Y8RB 4L8VA 4W7IA 3Q1LA 3DOJA 1DRWA 2HMWA 4PLGA 5JO0A 3NT2A 1N92A 3VVCA 1EUDA 2GD1O 3E9MA 3ETDA 2PGJA 3HE3A 4YRDA 4ZQHA 4PG5A 2G17A 2YV3A 4Q9NA 3OFSA 4WOJA 1BXZA 2EERA 1I24A 1HRDA 2AQ8A 2WTBA 3WFJA 3GGOA 2O23A 1GTMA 2X9VA 2AQHA 2C59A 1UZNA 1CIVA 3ITKA 3H9UA 5IAAA 5TGDA 2X23A 4OJNA 3IKTA 4ZGWA 5A5EA 1BHSA 3DZIA 1B2LA 4IINA 4KDFA 1MV8A 4OIMA 2O2SA 4ZQEA 3VC7A 4OQYA 1E3IA 4ALIA 9LDBA 1B8VA 1T2DA 1XG5A 3W4KA 3WOHA 1ML3A 3ITDA 1U28A 3OF2A 2DAPA 3OJFA 4XEHA 5IXSA 3TN7A 3GG2A 1PJ2A 4RV9A 3DMYA 4HXYA 4D0SA 3BMOA 2AHRA 3JQFC 3JSAA 3GAFA 1P31A 2D4AA 4IZHA 4YJGB 4BB6A 5EMHA 4G5HA 3ZHXA 5A9RA 3V2UA 4FFRA 3VAZA 1X1EA 4PLTA 2FR8A 5L95A 1DO8A 3WGHA 1BXGA 4BO8A 3DR3A 3CTMA 4UUPA 1BGVA 3I9NA 2HK8A 3DONA 1FJHA 2JAHA 1OBFO 2CY0A 2UYYA 4ILKA 1RM4A 5JSFA 1GADO 1RM0A 1HYGA 2OP1A 2PKQP 3JTMA 4QO8A 1UDCA 4YAKA 1EVJA 3X2EA 1F06A 4B4UA 3GVIA 2PV7A 1DDOA 5IZCC 3V2HA 4W99A 1XWFA 1PQWA 3EY4A 4RVUA 5DBIA 1G6KA 3JCZA 4II2A 4RQTA 5TNXA 4BNZA 1UAGA 1R0SA 2O3QA 2J5QA 4QUKA 3PJGA 2Y1EA 3KYBA 4KP7A 3H5NA 5JC8A 3LT4A 4OOEA 3JQBA 1PJCA 1ZEMA 3AUSA 3E18A 4BNGA 4PLHA 2ZQYA 2Z5LA 4W9NC 3OEYA 1GPDG 4BKRA 4XYBA 3F5SA 4CM5A 5J23A 2NQTA 1YH3A 1D3AA 5JC1A 8LDHA 1EK6A 2NVUB 3STHA 1R37A 2IZ1A 2NNLD 4BMVA 3GZ4A 3C24A 4K28A 3QJ5A 3AU9A 2Q45A 3AM4A 4ZA2A 2W98A 4CLRA 1XGKA 5KVCA 3NYWA 4RVHA 3V2GA 3PWKA 1I01A 4YJFB 2V6BA 3T4EA 1U8FO 2VT3A 3BHJA 2HU2A 5ER9A 1F8GA 3UFXA 4YJHB 1VJ0A 3AM3A 4N5MA 1ZO8A 2NADA 1SEPA 3RCBA 3CE6A 4WCFB 3I9OA 2VUUA 2FP4A 4AJ4A 4DQVA 2V6MA 1ONPA 3GDFA 4BO5A 1PJ4A 2P68A 1V9LA 4R54A 3ANMA 4JX8A 3U0BA 3LZ6A 2I3AA 2IZZA 4CQLA 3GAZA 4NQZA 2BLLA 1DRUA 2D5AA 4Z0TA 3AY7A 4DUPA 2ZK7A 3JYNA 3PLNA 4HP8A 4R41A 3TRIA 5FI3A 1I32A 3SJ7A 4MIEA 2E49A 4RQUA 2BGKA 2VYND 1R6DA 3VH4A 1RM5A 1QKIA 1I2CA 4CMIA 3JD1A 1IPEA 4OYRA 3NTRA 4GGPA 5HBRA 3HNPA 4LGVA 5GZ1A 3VPGA 4OKNA 2QYTA 2EHDA 1A71A 4D43A 1E1NA 3DDNA 1DIBA 4BNHA 3B1FA 5DOVA 1L7DA 3DFUA 4ALLA 4PG8A 1PQUA 3DHEA 4HNHA 2VWPA 2HKIA 3H65A 4EDFA 1NFFA 4PG4A 4U0JA 1E3SA 1IHYA 4CMAA 4L4RA 3K96A 4E12A 3Q6IA 2GSDA 4GH5A 4I9UA 1ENOA 5T8KC 2TMGA 4GMFA 4QTZA 3D4OA 1W73A 4WJZA 1PX0A 2DBQA 4LK3A 3AK4A 5JE8A 5EJ2A 1XU9A 1OMOA 3DOOA 3JD3A 5A02A 2IXBA 3BXXA 3RC7A 1QYXA 3MZ0A 3I83A 5BSGA 1ISIA 3VTFA 1ZK3A 3BYZA 1TT5A 4BO6A 5BQFA 1GYRA 3PEFA 4CMCA 1WWKA 3GMDA 5EERA 1SBYA 1ZXLA 3P2OA 1E5QA 4GPD1 3NT5A 4JNKA 2DC1A 2HMVA 4H16A 2DTXA 5KTKA 3M1LA 5FWNA 2ZCVA 4FQ8A 3NRCA 4H15A 4XX0A 3KSUA 5TIIA 5JAQA 2VRBA 1GCUA 1GEEA 1NASA 3JQAB 3ZV6A 3AY3A 5L45A 1DAOA 2Q46A 1GU7A 2OXIA 4CMJA 3TOZA 1B7GO 4ZRMA 3WNQA 4EBFA 4X54A 2X9GA 3WWYA 3N58A 3GHHA 2JKVA 4B7XA 1LTHR 4OM8A 4PLWA 3VPXA 4J90A 4CUKA 1VPDA 2CFCA 2CD9A 2Q49A 1MX3A 4Z3DA 3KUXA 3IP1A 4FOSA 3WIEA 1X0XA 4OXNA 2XAAA 4A26A 3WGQA 3WR5A 4CM3A 4ND4A 1O5IA 2D5CA 3BMNB 3FF4A 3F3SA 3JQDA 3NEPX 1B8UA 4IDCA 1R16A 1T2CA 2IXAA 3RBZA 5KVVA 3SBOA 1YXMA 4Z3KA 2EP7A 4RVFA 4IIVA 1ORRA 3V1UA 4GVLA 2ZB4A 4IQGA 3PGXA 4M87A 1A5ZA 5KJEA 3O26A 1O9BA 1KVTA 1TI7A 3NV9A 2PNFA 1WAMA 4LRTB 3ZCXA 2AW5A 4EUFA 2B83A 3DBLA 3QVXA 2HCTA 1OAAA 4CV2A 2DTEA 3I9LA 1BWSA 3Q9NA 1AHHA 2HJSA 2YHIA 4XRRA 5GZ6A 5TSDA 4OSOA 4RZHA 4ID9A 1IULA 4Z9FA 4EW6A 4RF3A 5G0VA 1M2WA 3RUFA 3OSUA 2DUWA 1JDJA 3PIIA 4J2HA 4YT2A 1GEGA 1DFHA 2RIRA 4R9SA 4RCVA 3U3XA 5JMWA 1H2HA 4DIOA 5L53A 5L40A 2W2KA 4U0KA 5A04A 3FNHA 3ZI0A 1G0OA 1X7DA 3P5SA 2Y68A 4AJLA 1KY4A 4YXFA 1I30A 2R2GA 2YY7A 3GNQA 4DYVA 3JQFA 4NBTA 5KKAA 3OH8A 4NBUA 3DBHA 5TX7A 1E3LA 3CZMA 2C82A 3GVHA 3UAGA 2Y05A 3NJ8A 3H5AA 4PG7A 3WYEA 4YRBA 2DVMA 3CINA 5H81A 2YUTA 4JP3A 2Q99A 4HNGA 4RDIA 4DWVA 2G76A 2FR1A 4PVDA 2GGSA 1BG6A 1LSSA 4TKLA 3NGLA 3FWNA 4INAA 1E1MA 4UEOA 1ENZA 1DEHA 4CLOA 4M1QA 3FTNA 3VZSA 1QYDA 1PZGA 4JLWA 5DCYA 4FCCA 2Q50A 3OICA 2HMSA 1V6AA 3FR8A 3PZBA 5B4TA 2P5YA 1PS9A 3HN7A 3WIDA 5KCZA 1LA2A 3HHPA 5IZCA 2P9GA 1E7RA 3EDMA 5JFOA 3QP9A 3W6UA 3S1LA 1Y7TA 4BGIA 3MJ4A 4UVDA 1NQAO 4YJDA 1JVSA 2LDBA 3E5MA 1LRJA 2C7VA 2CZCA 4IDGA 4CMKA 3A1NA 3ZWPA 1U2DA 1O89A 1LSOA 3LT1A 4Y6RA 3N7UA 3WXBA 1U4SA 3PQEA 3LDHA 4QQRA 3JD2A 2QYSA 2PTGA 1CRWG 4DC1A 3PYLA 1K6IA 1M75A 1Q0LA 4W9NA 4DLLA 3GN1A 4GKVA 6ADHA 1V35A 3D5TA 2HQ1A 5TT1A 3DOCA 1RJWA 1EUCA 3C8MA 3TQHA 5JDIA 1Z7EA 3M2TA 2VZ9A 4CLDA 1O8CA 1UP4A 4WCFC 5G4KB 1PJBA 2EGGA 3F1LA 1Z74A 5CP8A 2UVDA 3ZNNA 1ADCA 3C7DB 2VWQA 4YPOA 1HYHA 3KETA 4U5QA 4B7UA 1IOLA 2YV1A 4AJEA 4GX2A 4EITA 3L77A 1NQTA 1KEVA 3BIOA 1SOWA 2OFPA 2W90A 3V5NA 1E7MA 1EVYA 1H2BA 1NAIA 2B69A 2X86A 2TMDA 5IDYA 4CMBA 4OXYA 5L51A 1DJNA 4OL9A 3WS7A 4MKZA 1Q7BA 2GN6A 2WYWA 2O3JA 4L73A 2YQ4A 4YT8A 5DF1A 2ET6A 1B15A 1LQTA 3DQPA 3QA9A 3WGGA 1ZUD1 3KHUA 3R6DA 5KVSA 1YB1A 5CHEA 3UOGA 1ZMOA 2AA3A 4RF2A 5ICSA 4YQYA 4ONEA 4L74A 4QXMA 4BGUA 3TZ6A 3QSGA 2E48A 2OBNA 3UH1A 3OECA 4YACA 1LDBA 4JXKA 4J1NA 3PGJA 4CM4A 3JQ7A 1QYWA 1M6HA 4P4NA 3LU1A 1UP6A 3QWAA 4MIOA 2FHSA 3TWOA 1GQYA 5A9SB 3TF5A 1UZMA 3FBTA 1BSVA 2AEMA 2PWZA 5DULA 4P38A 3ZWVA 3B70A 3LK7A 1RYDA 2Y0CA 3T7EA 1DIRA 2RHCA 4FC6A 3BHIA 4IXWA 1PZHA 4TVBA 4WE3A 4EUHA 1NVMB 1K3TA 5F21A 4CV3A 1FK8A 1LJ8A 3GFGA 5EL0A 3FTPA 2R6JA 1QLHA 2I9PA 3WMWA 3EUWA 5COBA 4CL8A 4DRYA 4XRGA 5FI5A 2VNSA 2A4KA 4XQCA 5AOVA 4I08A 3UW3A 5L7WA 1R4MB 5T8KA 1F12A 5I9MA 4BNNA 3KLMX 3C1TA 4QO7A 3EYWA 3DB2A 1CQIA 1NFRA 1VJ1A 2NQ8A 3AFMA 5EIOA 2ZB7A 4GLOA 3H4VA 1FXSA 4E5YA 1NR7A 1NR1A 5IZ4A 2H1SA 4UVEA 1YBAA 3FWZA 2PKRA 4MOWA 1NNUA 1X0VA 3S55A 2X0JA 2UV8A 3GFBA 3RROA 5A9TA 3H3JA 1ULSA 2OUIA 3NKLA 4FD3A 2JAPA 2ZATA 4W82A 1N8KA 2HLPA 1SCUA 4LRSB 3IOYA 1K6JA 1P77A 4KUGA 2X8LA 2YDYA 2B4QA 4JN6B 3TL3A 1FDWA 1P74A 4XJSA 4TRMA 1MXFA 3PHIA 2J6IA 2NTNA 4HX5A 1WNTA 1XHLA 1YB5A 2Q2VA 4PCVA 1BW9A 1IZ9A 3E5RA 4CV0A 2O3UA 4JP2A 3RKRA 2FPIA 2BHLA 2GN4A 3K2BA 3H9GA 4TZTA 4YB8A 2UAGA 4E2WA 3O38A 4HKTA 5FEUA 3GGPA 1Y8RA 3R0IA 3B1JA 2EJWA 1T2EA 1Y6JA 4I5EA 2OO5A 1LU9A 3NDIA 4KQWA 5ILOA 4J1QA 4ND3A 3FRJA 5ENDA 4AFNA 4E21A 5C3MA 1MC4A 3WGZA 1IL0A 2BRUA 2PD3A 1AE1A 4O0LA 1LDNA 1BVRA 3PDUA 4OGWA 4Z0HO 1TB4A 4YCAA 5KJCA 3BMCA 4WASA 2D2IA 4PVCA 2B5WA 2QW8A 4F45A 3E1KA 4PN3A 4CMEC 4XWYA 1SB9A 1RWBA 1J5PA 3BMQB 4BNXA 4DVJA 3JYOA 1U3WA 1NM5A 4TQGA 4DREA 2VTDA 3GDOA 4CLHA 5DP1A 4WOKA 4C4OA 1ZIDA 2VUTA 3WB9A 3JQ9A 4CR7A 3TNLA 2GZ1A 3Q0EA 2OP0A 5KJ1A 4BNIA 1UJMA 2NU8A 2X5KO 2WD8A 4AJKA 5G0UA 1BVUA 5T67A 5LCXA 3MEQA 1DHRA 1HE4A 4BNTA 4FC7A 1NPYA 1QV7A 4RLHA 3OA2A 4UUOA 4YJGA 2X9NA 4XR4A 3ZNOA 1E3JA 3W8EA 3I5MA 1SOVA 1MG5A 1MFZA 1TXGA 3MWDB 3UXYA 4CM8B 3Q2IA 3SEFA 5COAA 5G2OA 4LCJA 2EV9A 5LDGA 1M6WA 5IDWA 1I3LA 1C0KA 1RKXA 1LI4A 1YS4A 2JD1A 4E2XA 4OOFA 4L76A 1ISFA 2H6EA 2AQIA 1JN0A 5EESA 1YWGO 1HZZA 1YQXA 1ZK4A 3OJOA 3GVXA 2FMUA 3QVSA 3DAGA 2RBEA 4M89A 2FWMX 1HDRA 1D4FA 2BFMA 2P4QA 1U3TA 2IZ0A 2W8ZA 3WLEA 2NVBA 1T4BA 4BNFA 1SB8A 3KYCB 4NNJA 2FY8A 3F4LA 2H5LA 3ZGYA 4BO3A 2DKNA 4CR8A 1TVEA 3EZYA 2JFFA 4J7XA 4JQCA 3T7CA 4YAGA 2NWQA 2RH4A 1I3KA 5LDHA 4O59O 4N5NA 3L4BC 2C2XA 4DTIA 4UEKA 3FNFA 1XQ1A 3TPCA 3ZWXA 2E82A 2P2SA 3B20A 2C2YA 3R3SA 4ZRNA 4JIGA 1NQ5A 4YA6A 3RUDA 3VH3A 3JYQA 4CMGA 4U8GA 3C1OA 2D59A 2JHFA 2NVUA 3NTQA 1GAEO 1WPQA 2X1HA 2WEKA 3JQGB 4XQGA 4DLAA 3HSKA 3OMLA 4J7CA 4AJJA 2Y1OA 1YL7A 3DZGA 4TRNA 1KEWA 2QIOA 4XGNA 4YJFA 3ZDFA 3ZU4A 4E13A 7ADHA 4XYMA 4PLYA 5L7YA 5CEFA 4J16A 3IMFA 4RF4A 5TRTA 4E5MA 5KJFA 4YAJA 1JWBB 4DIFA 2ZYDA 3DMTA 1MFPA 4K26A 4YJHA 4CMHA 4K6FA 2C20A 3H9QA 2B35A 1ONOA 3DO5A 4MP6A 1IY8A 4CM1A 4WCFA 1LBEA 4BV8A 1P1HA 3H8VA 2FR0A 1YONA 2GN8A 4WLNA 1VM6A 3ETEA 3MWEB 3OIDA 4M55A 4GX5A 2IEBA 2O4UX 4B4WA 4O1MA 4NJMB 3RC2A 1XLTA 3GPIA 3S2IA 4A2CA 4EGFA 1P1JA 4EI2A 3G1UA 4WKGA 4BQPA 4CM9A 2E6UX 3RUEA 5THQA 1U7HA 4ND1A 2Y0EA 1QRRA 4GI2A 2JCXA 4BKPA 1H6AA 1SC6A 4BO9A 4DPMA 4J1TA 5U4QA 2QQ5A 4RVSA 4XDYA 1PZEA 7MDHA 3BA1A 1HSOA 5C7LO 2DFDA 4E5PA 4GL4A 1C0LA 1I10A 2VYVD 4N54A 3OP4A 4R3WA 3PFWO 5JS6A 4TRJA 5GZ3A 4PLCA 4RPJA 5I7VA 3F47A 4CUZA 1TA4A 4TSKA 2AEJA 1D1SA 4W6ZA 1CWUA 4IUYA 4BO1A 2G0TA 1FDVA 1I3MA 3UN1A 3GLQA 1JVBA 1UDBA 4CUJA 3NGXA 2WM3A 1NQOA 3TDKA 3QWFA 3ZHYA 1R66A 2UDPA 2WWRA 4DPKA 1YOVA 2GZ2A 3GEMA 3ZWOA 3B1KA 4AJ1A 3KYDA 2EKPA 3AI2A 1LDYA 4FJ0A 3KBOA 1C1DB 1NHWA 2CF5A 2DBZA 1ADGA 5THKA 3A28A 2Q3EA 4FN4A 4C7KA 3HDQA 1GZ4A 3E9QA 1YDEA 4NU6A 4Q3AA 3KXDA 3DC2A 4BNVA 2P91A 3PTZA 4NH4A 3CKYA 1S7CA 4F3YA 3G1TA 4ZQBA 1KC3A 4OQZA 1HXHA 4WGGA 5I9LA 4DGSA 1PWXA 1DFIA 5BSFA 1CETA 3FR7A 5HWSA 1PGQA 3E9NA 1LX6A 3L07A 4MVJD 4YAEA 4XYLA 3Q11A 3NDRA 4IDAA 4KDEA 1IB6A 1H6BA 2QRLA 4HWKA 2D8AA 2PKQO 1Z45A 3I4CA 4D7AA 1MC5A 3PYXA 2CVQA 4JBIA 3JQCA 5JPIA 4YR9A 1KERA 4E5KA 5JNLA 2CNBA 4ZVVA 1CJCA 1FDSA 3ANNA 4BNWA 2NM0A 5CG2A 2ZTUA 4TROA 3KOUA 2VYVA 1HKUA 1I2ZA 2VHVA 3PZRA 4XJTA 3O8QA 1X14A 4E6PA 4MINA 4DL9A 5KWEA 1IYZA 1I36A 3U4CA 1I3NA 2OMEA 2VN8A 3BMOB 2IYPA 3L0DA 4ZHSA 3LVFO 4XYEA 5GMOA 1DOHA 3D3WA 4IZIA 1CDOA 1E92A 1U4OA 3SLGA 2PZMA 3WGIA 4W4TA 2O3RA 3BMNA 2HJRA 1T2FA 2ZB3A 4D3DA 4CPDA 1WMAA 3GHYA 4Q39A 4S3MA 3DTTA 2Y67A 5BT9A 5ICMA 1ENPA 1KYQA 2BELA 2VQ3A 1PGJA 1HLPA 1X13A 1GQQA 2X5OA 2X7HA 2Y99A 3W1VA 2XOXA 2Q2QA 5B37A 3ADOA 1LDMA 4U6QA 4NR0A 4JBHA 1HTBA 3ZWBA 5C7OO 4GSKA 3PI7A 4XQEA 5ITVA 1VKOA 3DBRA 3GVCA 3CIFA 3IQDB 2GF2A 4IS3A 1K5HA 3L6EA 2Z1NA 4TZKA 4YT4A 4YVFA 1W8DA 3A14A 3IIEA 2NVWA 2EW2A 2EGHA 4TRRA 3QWBA 4MVJA 3H5RA 5CDGA 1PZFA 3HG7A 1NTOA 3OJEA 4Q3EA 2PD4A 4IM7A 3RUCA 3GOHA 4PLVA 2R00A 1T2AA 1WW8A 5BSHA 1DRVA 4CMEA 1E3EA 2EKQA 1UXKA 4D79A 1UXIA 3I4FA 3KO8A 1GDHA 4I1IA 1Q7CA 4XDZA 4IJKA 1YQGA
chains in the Genus database with same CATH superfamily
5IAEA 3P97A 2J3IA 2AJBA 4JHXA 1L1QA 4LHYA 1A4XA 3V8BA 1ZD4A 1L8LA 1SUEA 4O8ZA 3W5BA 4DMRA 2PS0A 2ZJBA 1FDRA 4E0BA 4AWBA 2VJKA 3KSMA 2ADMA 2C3PA 2OLKA 3EXFA 3QLVA 3PT9A 5DWDA 3IO5A 2GN9A 4J07A 1RHJA 4F6RB 1EDZA 1Q5PA 2BM1A 2HK7A 4R51A 1M5UA 1Q20A 4RKEA 1VYUA 3OCCA 1C7RA 2DR2A 4IGKA 3VHRA 4L22A 4AJIA 4H59A 1GTG1 1XELA 5CB4A 2ZZMA 2XGGA 3D6AA 5HDBB 3ENQA 3UMRA 3C14C 3WV4A 1NZJA 1TK3A 3ANLA 3GUCA 3QIVA 1GZHB 1HLDA 4WBNA 3U56A 1UBUS 2W6CX 1E77A 3B7GA 1FYEA 3BIXA 3U4IA 3STYA 1PL6A 2QV7A 1BHQ1 4O1HA 4UBKA 4IJUA 5CXQA 1GTVA 5I9BA 2FMIA 1G1AA 4G5OA 5DI3B 4Q0MA 2OHVA 2JJ8A 1ZK0A 2X4DA 5AKYA 2ORWA 1DCMA 3EGCA 3R75A 3IUSA 5IKEA 3I5XA 1C9EA 2YZNA 3GP3A 2GLTA 3R3UA 4TYPA 1KDVA 3SZLA 4ALJA 2JHGA 2IBMA 2QRKA 1EVQA 3BXFA 4WHMA 1NVVR 5ALPA 5ES3A 3HR8A 3PHLA 5THXA 1D6MA 3M4YA 1AHIA 1MF7A 1L1RA 2QE6A 3A7DA 4JU9A 5A6SB 3C5HA 3JVDA 5LP6C 4KRXA 3EF0A 3QVWA 1XRLA 4PYRA 1F8YA 5BSMA 4C7XA 4ZYXA 3JTEA 3BWBA 1UXJA 1FS4A 2XTZA 2IC5A 3EEQA 4G2NA 1VLQA 5JDCC 2R25B 1H1LB 3L1JA 1RWOA 3JZAA 4BVJA 1SCJA 3AONB 2BR5A 4S24A 3R0QA 3B85A 4J0QA 5F9MA 5LZ9A 4HWSA 3L4BA 3OLZA 5EXSA 5KNBA 2ZVJA 4TLDA 4CF5A 3NAGA 1B26A 2VPIA 5FT9A 5CLHA 4Z53A 1JAYA 2ST1A 2AOUA 2X5JO 3DTVD 4IX9A 3WSVA 2H5JA 2JFZA 4HZUA 1JHYA 4KR0A 4X3OA 3S2FA 2UUOA 4BBAA 4H1HA 5I7EA 3RC9A 1CFZA 1GNVA 1V8DA 3GLVA 3I42A 3IXMA 3QQ5A 4FZJA 5KYXB 3VHLB 1JLKA 4DT1A 3C3XA 2PMFA 2XE4A 3M3DA 2EW8A 5DHTA 4AJNA 2R7KA 1O58A 4MDFA 3EDYA 3EIHA 2VYQA 1W1WA 3H6HA 5GY7A 2O59A 1V2GA 1XRMA 1XRRA 2AJCA 2OFOA 2ERYA 2DWQA 1MGPA 3TNDA 2ZYHA 2VA9A 2DHEA 3NWPA 1VRWA 3WIBA 1HDEA 2HQBA 1QYCA 5EMNA 4TVSA 4EW1A 2WVHA 3KSRA 5FULA 5GGYA 3AY6A 5CURA 2C2KA 1JPUA 1PR2A 2WYUA 1VJTA 4IJ5A 3PJEA 1ZIYA 3TDNA 4BV9A 4OV6B 3DXYA 2W8BB 3S29A 4E5UA 5LZ4A 1GRVA 4PM4A 1U0RA 1PR6A 3AUTA 5FUXA 1MEOA 4AM8A 5JXWA 5CNJA 2WIFA 2NV2B 1LLQA 1B14A 3QXGA 1QANA 2GM9A 4F6CA 3AOEC 1ZNXA 1OYVA 3HA5A 3G59A 3FMPB 5TY0A 4RD0A 3SC6A 2HR1A 2DTDA 5CVUA 3MUNA 2B0JA 2VK2A 3CXRA 2NSDA 3MQFA 1B6SA 1LD3A 3M5WA 5L3QA 4XXHA 2JKYA 4I8IA 2XUZA 4JS0A 4BLQA 2VWHA 1X7WA 3BRWD 4QXOA 4CNQA 1CZRA 2VZ8A 4Y18A 4DHWA 2KLHA 1XRPA 3LSTA 1N5RA 1WA5A 4BPRA 3PNQA 3CUKA 4U6SA 4HZIA 4GWKA 4P7KA 4GZ5A 3SQLA 4NIMA 4QFCA 2P65A 2QD3A 1R27A 3GCXA 3ACDA 5KTYA 2O5EA 3DTVA 4DWJA 4RVNA 3KV3O 2YWDA 3AR9A 1CX9B 1I0LA 2VTEA 3W3AD 1MH1A 1EBBA 1IBMB 2G6TA 2WTEA 3L49A 3R3YA 2LKCA 1JMVA 4B3JA 3RQSA 1T5LA 4RIFA 4YEDA 4IWNA 5DBFA 4EQ6A 1ZG3A 4H1TA 1BXKA 3TZCA 1VSQA 3GIDA 1G98A 4FX5A 3I92A 3OZCA 5BMVF 5EZYF 3VZPA 4C29A 1GCAA 4F5EA 1TT7A 5LBTA 1VE7A 1QZTA 3GI1A 5E4TA 4LXYA 3A9VA 2MIIA 2OL4A 1IY9A 1C3EA 5BN4B 5I8PA 3DPSA 1EBFA 4RO0A 5L3ZA 1ZXXA 3GLGE 2W6NA 1FYFA 5IMSA 5ILGA 1G38A 1PNQA 1MB4A 1SKUA 2GJAA 4Q4HB 1YT5A 5AJUA 1NW9B 5G3YA 4QG7A 5F1OA 2YV2A 5IAKA 2VNAA 2CNNA 3LCRA 4HDCA 1NTRA 2D13A 3I2HA 4ZU3A 1KYWA 4QLOA 3EIUA 5EUCA 5AW9A 2B20A 4A10A 2PX4A 1BJRE 4C03A 2BR4A 4DNOA 4JELA 1GNSA 3HZHA 4KXYA 4E30A 1E1YA 1NR5A 2W0SA 1PZXA 1R5BA 3SI7A 4FSHA 4GM0A 3WK7A 1TGVA 1XZ8A 1U0HC 4LC0A 3UENA 5EUQB 1HOXA 5FTKA 4EQZA 3RFXA 4BL5A 1U2EA 2QS9A 2IEIA 4V0RA 3OBBA 4KQEA 1DIOB 5IM4F 3T3IA 1J07A 4JK3A 3E22A 2GD2A 3BRWA 1KMNA 3BOSA 4O2RA 2R87A 1G19A 2HMAA 1Z7WA 1OXMA 4TL7A 3VR5D 2WKSA 5JNWA 4G5QA 4UNPA 4UTZA 3RC1A 4RELA 1CNEA 1IDOA 3NONA 2OYRA 2ZSEA 2JRLA 2ZRKA 4KFSA 1YA8A 2DLDA 3ZZUA 4MULA 1EJBA 2VATA 4G0NA 4MUKA 4P0PB 3NU1A 4WRRA 1E2NA 2O7QA 3GGJA 3HGMA 1J24A 1IM5A 2RI1A 5BWOA 3W3AA 4NF2A 1OXTA 2GBCA 4CL0A 1M34B 2DT5A 3NBFA 1ARZA 3IR5A 4CLXA 1EX7A 1ILWA 4L7VA 1MKYA 2QRPA 1X8JA 1JS1X 4XWWA 3HCEA 3VUEA 1WDKA 2E4WA 2OY0A 1TQ8A 1WO8A 2R5FA 1Z18A 5AFSA 2ON6A 2ZR0A 2HHJA 5FV7A 4HDKB 4N48A 2FZEA 4IH4A 1O6ZA 1ZM4A 2ZQZA 5AI8A 3F73A 4FFBB 1QMGA 2PDAA 1W93A 1GTJ1 3ZGXA 4RU1A 4C7BA 3LDAA 5JY1A 5A5GA 1IJKA 3K31A 1RI3A 2C98A 5BW8A 2R6AA 1YS1X 3TFQA 3EXAA 4L75A 4Q1FA 5A05A 3K70B 5AK6A 1G8JA 3OU2A 5BN3B 3T5AA 1L5HA 2WHYA 1I2BA 1O54A 2GWRA 2IYQA 3OCWA 1YQEA 2QZ9A 4IDBA 3L8EA 5FNVA 4DDVA 2QVGA 4JUDX 1TM4E 3FA2A 4K9DA 4RY0A 4TL9A 3GROA 1ITZA 5J40A 2OM2A 3NBYC 3PIDA 4UDNA 3SX4A 4G36A 4GYYA 3K6SA 1U5AA 5JH7F 3N9IA 1SG9A 1CYDA 1VRVA 1GR0A 2NUTA 1QG6A 2QU8A 2PCJA 1GPAA 3VYVA 1PGPA 1RXUA 3ZV4A 1G291 2W37A 1ZD2P 4LJ5A 4CFYA 5JD4A 3V8NA 2AE1A 3JWHA 1GLGA 2F64A 3IS3A 3U61B 2ZWVA 4PWZA 2Q1SA 3BAZA 1XWWA 3DEJA 2XB4A 3WJ7A 1FPQA 1UFRA 2V7EA 1W49A 3EGDB 4QYTA 3TI9A 1G8PA 2BEUB 2QGZA 2WJAA 4AU1A 3UGQA 4CEHB 4YMLA 4IQ4A 2AW3A 2ORIA 3UMGA 1IUPA 1CEXA 3F6SA 4MYDA 221PA 2CVPA 2CVFA 2KBFA 3H2BA 4NE7A 3V6LA 4DC0A 1CF9A 2NO0A 4GMDA 1P1FA 5DM1A 5AOBA 5K3FB 4X65B 3GR6A 4C6RA 3FJOA 4IIEA 4XOUA 2D5IA 4ZAVA 1ZD1A 3BS4A 2QXUA 3UWMA 5EJFA 1G17A 4HADA 1P7WA 4H7KA 2BGLA 3L18A 2A2ZA 2PM8A 3LQ4A 4UZSA 1RWQA 1ZW1A 2BOVA 2JFGA 4JJAA 1BS1A 2PSJA 2Q07A 2YHAA 3I73A 3KT0A 1ZN8A 3HB4X 3F3YA 3WDSA 1VBNA 4FYIA 4BKUA 3TCKA 3ORFA 3DAHA 3HUUA 3CUSA 2QL6A 4TUYB 3FTEA 5A3RA 2YMPA 3U31A 5B1SA 1NYLA 4MWBA 2J31A 2EC5A 1ZGBA 3KJNA 1DUIA 2WKPA 5G4LA 3KVOA 4PF1A 3KKEA 3DKKA 4WBNF 1NVAA 4L4XA 2N42A 1II9A 3CB4A 4TS4A 1YBHA 2QP9X 2LTAA 4MYTA 4YJ3B 3WGTA 4NZPA 1C2TA 4OXXA 2LNDA 1VPTA 2QE7A 3ENZA 3KUCA 4X8OA 1LLFA 4PFSA 8MHTA 3DL2A 1IHXA 2CMDA 4O33A 4RL4A 2IELA 3FUWA 4WA8A 1RJ9A 3WJAA 4XGKA 1SOAA 3TMYA 3WLIA 2QTLA 5C1DA 5CH5A 2OENG 4G5RA 4QOJA 4TN1A 3ISJA 3ZX5A 2ZT6A 3HP4A 1VMAA 3IP3A 3OETA 1XC7A 4NECA 1K0UA 4JCOA 1BRMA 4X9XA 4YDRA 1NRJB 3D6UA 4PAWA 2Q21A 3HADA 5D1NA 4EZBA 2D7JA 3JQGA 1DMSA 1HE2A 1JKFA 3A32A 4JQZA 3TLZA 1RI2A 5MHTA 3CVJA 3IAFA 4JAVC 3VNBA 4M22A 4QREA 1KMIY 3GVPA 1V8BA 1A7JA 4MRMB 1SOUA 3QF4A 1UWCA 3F7MA 3HHEA 2JL1A 3A9RA 3PJRA 2AH5A 2G28A 3BJMA 3QTLA 2OCPA 3LT0A 1YO6A 2VPTA 4OX9B 1AC5A 4ALNA 4G97A 1UC5B 3OEED 4WPGA 1TOAA 2OD9A 3DP7A 4YLGA 5TF4A 2PXAA 3EBLA 4UTOA 3HXPA 4HLCA 3SHOA 4QOGA 4LI3X 1C7IA 4YQEA 2CWDA 3UV7A 1KMCA 4OI4A 2ACKA 2UVQA 1ZITA 2MSEB 2YBDA 3AL3A 1XF1A 3ZWYA 4DZTA 1KDYA 5EIXA 2PZAA 1IBSA 1HM5A 2PLAA 3D8NA 3IDOA 1TFUA 1X1TA 1LUAA 2QRZA 3K20A 4QPJC 3RUIA 4BBZA 5JVDB 4WEOA 2IYOA 4FE4A 2RG1A 4IGFA 3UCFA 2D1RA 1U8XX 3ZVLA 1M2OA 5T6BA 1SA0B 5EQTA 3TOXA 4K9LA 5AVXA 2O2CA 3B48A 4B8ZA 3ETGA 2Y0BA 4CFSA 3IQIX 5KQGA 2N46A 4B4KA 1XOIA 1BQ4A 4DBLC 5KS2A 4RK1A 3OM0A 4TMFA 4TTPA 4YR7A 1XD2B 4HN2A 2JS7A 4ZMSA 3TXYA 2HH9A 3LWDA 2HNBA 5HXAA 3UGJA 1CQJB 2J85A 4CG1A 1PQYA 4EUNA 1ODSA 3EQ8A 4Z1MD 1XF9A 3IP8A 4WERA 1WEKA 4EI7A 1E7WA 1GV1A 1XDUA 4UD6A 4CM9D 2H2FA 1L5SA 1KEEB 1DX4A 1LVUA 2I65A 3R5JA 4W8HA 1EB9A 1OZ0A 5J2UA 2G07A 2BI7A 2P9JA 4O3MA 1WL8A 2C5GA 3OT4A 5HIMA 3TCXB 4BO4A 3MJDA 5DPMA 1EX9A 3V42A 1PT9A 2PYDA 3ADKA 3IVRA 3LF2A 4KTVE 2R7MA 1Z0AA 3ZTTA 1TYCA 2TECE 4XD7D 2WW8A 5F3RA 4JHLA 2H1CA 1KI2A 5M3BA 2PVCA 1U0EA 6REQA 4N0EA 2YFKA 1XVVA 3C43A 1BW9B 1FOEB 2ID4A 5IULC 4NZNA 3GGSA 4LOJA 1L7VC 4YTEA 2OKCA 2PUBA 1E2DA 1JVNA 1SY7A 4Y67A 4YCBA 1S6YA 1SD2A 4OP1A 4QXAA 1A9OA 2IZ7A 5JHHB 3N86A 2LD4A 1DELA 3I6QA 4OGFA 4WH0A 3VGJA 4B09A 3Q9UA 4U9IS 4YREA 2VYCA 4FFSA 5AMXA 4R5HA 5HKAA 3EXHB 1YSCA 4R68A 5AKHA 4F06A 4FPXA 1DC5A 3GLFA 3NORA 2WF8A 4KI7A 4FYXA 1YJBA 2FA9A 5DHRA 4CCYB 3EZXA 2VDPB 4YQZA 1JYSA 1GV0A 3LQQA 4XWKA 4L6AA 4LNUB 4OHWA 4PQRA 3KZVA 2PH5A 4D8TA 1SCDA 1I80A 2F59A 2OKGA 2QZ4A 4C14A 5KYNA 1XT6A 2ALJA 3GLHA 2DRIA 1YJXA 2XCLA 2HLDA 2HT6A 2CCGA 3VPAA 3QOXA 3S81A 1RQGA 4TVOA 5FRDA 4MV1A 3LKBA 4DSNA 1CS0A 3E81A 1Z39A 1A98A 1FNSA 2H0QA 3BN3A 3PFBA 1L5NA 3HDJA 1LX7A 4FYWA 1NVKA 1W5BA 3NEJA 4IY1A 1J1ZA 5DI9A 5FD8A 4AIRA 4B34A 4IHJB 2G5GX 2H2AA 1AUOA 2GOYA 3V8EA 4FJ1A 2G5CA 2NZWA 4Q3DA 5JSZB 4F2PA 3RB8A 3DDZX 3D6VA 3N2EA 3I6BA 4IUDS 1EGAA 1II0A 3QFFA 2OO3A 3ROPA 2A0FA 2VL7A 5DT9A 1YB7A 5HF9A 1XEXA 4JD5A 4QFDA 2V7WA 2YOGA 5BO5A 1Y42X 1OXSC 2OFXA 4EW2A 1E2HA 2AVDA 3O92A 1R0RE 3U9LA 3I39X 3WZ2A 3QLUA 4HOYA 2FVXA 3EBOA 3HO8A 4N65A 3SIPA 1NU8A 2X58A 4BLTA 4BZPA 1Z12A 5GWXA 4A8HA 1HEUA 4FLFA 3O3OB 4X90A 3PC2A 1OASA 1AHPA 2O5RA 4BDSA 1ZUWA 4FBGA 3UHPA 4BTEA 3N59A 3FNGA 5DXFA 4UEWA 5AXBA 5BSTA 1GUZA 3K70C 3H9CA 4RORA 1OTHA 5KEIA 1N1EA 2R8ZA 5DZSA 2B36A 1LK5A 2A0UA 5ALFA 121PA 2NVOA 5FKJA 2ZAOA 5HM8A 2WB4A 3KJXA 1E6KA 4PNPA 4AKEA 1WHTA 1YHNA 3WO1A 2QZPA 5K6RA 3Q8MA 3HN2A 5E7MA 1KVUA 2PV0A 4ZXFA 3G49A 1PP4A 3BILA 2QZZA 4ZVSA 3LZCA 4XWTA 8GPBA 1N9GB 1UK9A 2WIDA 5JRDS 1OV4A 3DTNA 1MLDA 1DC3A 4HVCA 5JXJA 3FHJA 1ABFA 4RQAA 3ESRA 4H6VA 2YZ2A 3TSCA 4COKA 4XH9B 1E5DA 2LKDA 5A0TA 3IJRA 3KP1A 3EXG1 2OYSA 3LIIA 4HGQA 1UKVY 5JADA 3EUAA 3T7AA 3V4ZA 5DE3A 3VNQA 3T1YB 4LV8B 3F7OA 4BB5A 2O5VA 2CUTA 2ACEA 1Z4OA 2EZTA 2O48X 3ESYA 2X2OA 2ZBEA 3JAKB 5E2BA 3TW8B 3C3YA 4NFSA 1YVEI 2V65A 3I61A 1DGQA 3G5LA 3W5CA 3H17A 3P5BA 2DQSA 3HMQA 1P39A 2B3TA 3FFAA 4K6CA 4WNYA 4CCSA 4G2TA 1V95A 3DL7A 1FUYB 3RTAA 4KRFA 3WQQA 2XT0A 3L7AA 2J07A 4G5YA 2H2GA 4U7GA 4UKDA 3PP8A 1X6VA 3OTIA 4LWQA 3RREA 5LWHA 2GK4A 5AXDA 4CIAA 4QICA 1IK6A 5F5NA 5JY6A 2O3SA 4IMPA 4R1PA 4H7HA 5CK4A 1BQ3A 5FTWA 5HUHA 1VB3A 4A0SA 2Z2IA 4K05A 2Z8YA 1OZFA 2L2QA 5IARA 4LYEA 2F90A 4AG6A 3FSGD 4HATA 3W5DA 1F3OA 4MS4A 3I52A 3OT5A 2HWYA 1KSJA 4PTYA 1GCOA 4Y7DA 4KK3A 4IO0A 1BU8A 2WVJA 2XNJA 3RJZA 4NI5A 1DCFA 4MI1A 3E6AA 4HL6A 2FPSA 4PYKA 5SZIA 4A2WA 4DVGA 1KQFA 2NTYC 2FEPA 4IH9A 4IQ8A 1R0YA 1DB3A 5LLTA 2WAXA 4WEQA 3WWCA 4KVFA 1ZSVA 2I6TA 4QUIA 1Z0FA 1CR1A 1M6VA 1AXGA 5I9NA 1QMPA 3PGA1 3ZWCA 3OQMA 1NG9A 3AUAA 1Y7PA 5CDFE 4D8WA 1Q16A 1AY0A 1UMDB 4TLBA 5BUCA 2XUKA 2CDRA 1PLKA 3JAMA 1KEZA 4XUCA 2F3TA 4HR7A 3B12A 3RFVA 4NDNE 2EOAA 2G1AA 3CIOA 3K1YA 2BGNA 3L6BA 2OCLA 3PE3A 1J2RA 4YNBA 1JLSA 3RTBA 3NFYA 1PS0A 3DZKA 3OOWA 5CLJA 4FX2A 4FBMA 3S2ZA 5DHUA 3UMYA 1VE5A 1XZJA 3WGLA 3QV1A 1QF6A 3LCMA 4HS9A 4CF6A 3OTHA 1HWYA 3VR3D 2ORED 1KA9H 2AFHE 1XBTA 2QHXA 4E4RA 5TMPA 3OURA 1A7UA 1KP2A 2BFCB 3KPUA 3RFFA 1N2CE 2A9JA 2XZDA 1Z5ZA 1OFUA 4IVRA 1NPDA 5D5QA 1M1YE 1IZ7A 1NLFA 1FA9A 1RBZA 5CYOA 4NZ9A 5EKTA 1JQLB 2B1RA 5C32A 5IG2A 1TU0A 4B75A 5I4KA 4UNSA 2HRCA 1QM5A 2RB5A 5HILA 2IFTA 3LUAA 5HF6A 5LYYA 4LS3A 3T4XA 2O8CA 4F9FA 3HPQA 3BTVA 4FU0A 3SCZA 3L4JA 1GNQA 1RYBA 1OR8A 2DM6A 4EY7A 3I5UA 1OFHA 3DYIA 2PLRA 4BFYA 1T1SA 1Z4LA 1VCOA 3OQ6A 4Y6GB 4AJOA 1IRXA 4F6LA 1N77A 4HV4A 3LL7A 5IN5A 3LT2A 4DIKA 3C7KA 1JHDA 1OFIA 1PHRA 4O4HB 1LF5A 4L27A 4NTZA 3AEUB 3SZOA 5LQCA 3HJBA 2Z9CA 1X39A 2FZVA 3NLLA 2A5YB 3GA7A 4UVHA 4WWHA 5AQ1A 4WNIA 1W581 3SC4A 3MQ2A 1QCDA 4KC0A 3W9BA 3FLAA 4N3BA 4EUSA 3Q0IA 1A77A 1SHZA 2Y1CA 3VKHA 2F2TA 2BFBA 4Q37A 1KK2A 1JJBA 4CLEA 4F0JA 2A9FA 4UC0A 4C0BA 1G5IA 1FVOA 1YDHA 2ID9A 3IUQA 1QNFA 3SS9X 5B7GA 3IR6A 4X20B 1V16B 3C7AA 3DA8A 3D8TA 4FOOA 4ZVMA 2W70A 1W36B 2GZ3A 2OHGA 2P9TA 1WX1A 1UC4B 2VHYA 5ER6A 3S44A 3I3SR 3TDMA 5I4CA 1T5OA 5FADA 2Q5LA 3WKEA 3KUDA 4GKBA 2QRJA 1R9NA 1FBTA 2GUGA 2J7KA 4PQEA 4GO1A 5L7TA 3I32A 3OZGA 1XAJA 5CIYA 1C3VA 1JJFA 4WVFA 1LLUA 3W05A 4M1MA 3L6UA 3SSOA 3WWDA 5IXYA 2PZLA 5T5QA 1JSXA 4LF5B 1AA6A 2EZ4A 2OWEA 1D6JA 4BVLA 2H9YA 4DJFC 3R8FA 2VJQA 4B48A 1QHHA 3VSBA 4O2AA 2FQXA 2VQFB 3I23A 2WHPB 1WS6A 2D5LA 2NZ2A 1C8BA 4DCCA 2O0KA 5IKOA 2XCTB 1MTZA 3RS4A 4WT7A 4PRKA 4JKYA 1XKXA 5EWJA 3PXEA 2JIMA 2JARA 3D3WB 4DM7A 3PXAA 4ESOA 1UEJA 5AHXA 5DK6A 5T4HA 1NI4B 4AN4A 3VHXB 4CMIB 1SXPA 1TQDA 3OX4A 2VSFA 4TYQA 1GZ6A 2M2IA 3BH6A 3PQDA 4JNCA 3WLNA 3EXHC 4NBWA 5AKLA 1DQSA 4I6JA 2B4RO 1JHAA 2CFSA 5TV2A 2D0DA 5JS2A 1UR5A 3NUZA 5JZVA 1IZ0A 3MMXA 4XTCS 2HIGA 4G65A 3LSYA 4JEMA 2RAFA 4MA0A 2QK4A 3FGZA 2CUKA 1RWMA 3AJRA 1GY8A 4ZN6A 4M7RA 5EG5A 3KJFA 1H85A 4IDOA 2FMHA 1MOSA 5IBRA 3T3PB 1I0IA 4BFZA 5K7SA 3E9DA 1S2DA 1J09A 2PWPA 4JJKA 2G83A 1SXJB 4C0KA 3JQ9C 3C3MA 1Y3HA 3ZV5A 4D9HA 1SHUX 3QWIA 4QGBA 4R3NA 4EJSB 3KC2A 2ZAIA 3UWKA 3ZZ1A 3K8ZA 2FDCA 2K5UA 4U4AA 1QRDA 4BO2A 1FQWA 4AJ2A 3VC3A 1TA0A 4ZCLA 3SKVA 5K5EA 5FBVB 3MA0A 1HLGA 1IM8A 1SFRA 4IZOA 4M4SA 4DN6A 3LUCA 1T9AA 1E0AA 3ZQ4A 4RHEA 1R00A 4QYIA 1RPNA 1PW5A 3AXTA 4I0WB 3MF4A 4XWOA 4I55A 3AERB 3KZMA 3I0MA 4LF4B 1M0WA 1OU4A 5BV2P 1QP0A 3K1ZA 4PZ0A 4Z99A 4ARCA 2FPUA 3SDBA 1B3BA 1YR3A 2XMCA 1GL9B 4TV9B 2ISQA 2Q2NA 1QIIA 5BNIA 2A5LA 3VDRA 4BMZA 2QTAA 2CNWD 3S2GA 5A3VA 3OIWA 2QDXA 1P4HA 3GNTA 3WSTA 2W11A 1QYRA 4TKMA 1OILA 1JQKA 5EJ8A 3H8JA 3THYA 1SOMA 1YU9A 4KG7A 2XWJI 3ELBA 4NZZA 2VT2A 1JDVA 4P36A 5FL3A 5JWHA 1ISGA 3G2KA 5D2CA 4YMWA 1QDLB 3GRKA 2F8SA 4EYGA 1GRQA 1A5SB 1J0EA 1E3TA 1UMCA 2HXGA 2P8JA 3HKDA 3PFFA 3QJYA 3G3EA 3ST7A 3I9MA 4EY8A 2RK4A 2BI8A 1U7TA 2NXWA 3VOSA 3PRJA 1CT9A 4RZQA 1TPYA 3JRNA 2FXIA 3UG6A 5K0EA 3AVTA 2GF0A 4G1VA 1C0PA 1SQ0A 2BKEA 1T1RA 4PCUA 2NO5A 3BCUA 5KQPA 1VPWA 4NX2A 5E6SB 3MFQA 2EJVA 1VDMA 3ONFA 2YIMA 1LEHA 1WKVA 1WDLA 2ODBA 1D1TA 3BB1A 2CXHA 5KYGA 2IS2A 2Q41A 3RVSA 4RVGA 1QFZA 4Z4CA 4LJ8A 3CC8A 2KQUA 2P5TB 4AZSA 3T0FA 5MFPA 2HU8A 5UKDA 3DVRX 1P80A 5CT5A 5KYUB 4NMMA 1OX4A 1FTWA 1K4YA 4DA7A 1RSZA 4M88A 2OO7A 4OLHA 1NXOA 3INGA 2DSTA 1Y6RA 1PSDA 3LA8A 1NNI1 3ETHA 3FDFA 4CTNA 1E7SA 2DPLA 5EP1A 4G4IA 1G8YA 5KC9A 1DZIA 3S1AB 1VGVA 3G8DA 1O9GA 2I4TA 4BNJA 5I8WA 4TYMA 5JMTA 2HJVA 4YRGA 2N75A 4NVRA 3VYRB 1F8FA 4AURA 3GEGA 1QS0B 3AIKA 4NDZA 3TLEA 2MYNA 4XPZA 1Q0QA 4A1OA 4EENA 4BX0A 5FPPA 1R15A 4BNUA 4C6TB 2C57A 1DKUA 1TLLA 3ZJTA 2RI6A 3E5HA 3A8TA 1V48A 1VPLA 5IKPA 3JATB 3LTEA 4JLUA 4YJ2F 3UGTA 1YCDA 3O91A 4LZWA 4JXZA 4MW1A 1C7EA 2XUPA 2ZT8A 5ALGA 1IN4A 1RRVA 1MCZA 4A6EA 4CM7A 1WU7A 2Y1FA 2P4HX 2H00A 4AJPA 4HYTA 1ANKA 2D62A 3OY7A 2YQ5A 1MA3A 4XGQA 3LKDA 4RNCA 1E3WA 4OMUA 3VKVA 4R1SA 2BSXA 2AG5A 2ZSDA 3AIIA 5FQOA 5T6MA 3U7QA 3WLFA 3GQVA 1Y1KE 3Q5GA 4S04A 4IQFA 1R0ZA 2GESA 4TQUS 1JJAA 1XMXA 1ZNWA 3A4NA 3CZPA 4MVJM 5K0JA 4FW8A 4WCVA 2J45A 3WADA 1T25A 5DNYB 1TM7E 4NPCA 4Z9AA 1NN1A 1HORA 3K30A 5LZ2A 4UARA 3AF6A 4JYAB 3ZXYA 1E8MA 5L4LA 2NP7A 5L3SB 4E31A 5KHAA 3NBAA 2OBFA 1KP9A 1QTNA 4GZ3A 5ALUA 4B35A 5AHOA 2OSBA 3ZCSA 4RMJA 2A6PA 2I6GA 4TL6A 5DRTA 3ZZ0A 1TYDE 3H6KA 3C8HA 3UHFA 1R6VA 3OT1A 1B0ZA 5D5PA 1MVNA 2BC9A 4ZVNA 4E5NA 4L2IA 4NPHA 5WRFA 3VJKA 4XZ3A 2CUZA 5KYWA 3K15A 3K4PA 3CMCO 2WMDA 1FNDA 1UOQA 3ANTA 5DIZA 2WIAA 3CRRA 3ROXA 1AKWA 4WLUA 3VPFA 4ZI3A 1U8AA 2FYTA 2J33A 4KFTA 1DKMA 3KB2A 3MWJA 4I50B 1PTKA 3BAFA 4W1QA 3JX9A 4EJ0A 4PAMA 1E1KA 1G21A 3BMQA 2ZJFA 3IB6A 2Y71A 4NONA 1YJ5A 5CCDA 2HGZA 4DMMA 1J8DA 1EM6A 3KELA 3ORYA 1TKAA 2G06A 2QQEA 1MD9A 1OT3A 4IEEA 4JQSA 1B2RA 3HRIA 5DSZA 3WE7A 4A36A 3PQFA 1R8YA 3M6AA 3U5TA 4NSNA 4LEIA 3WRXA 1MGOA 1V37A 4Z2YA 1MVLA 2C2ZA 4R2IA 5FL7D 4DBZA 3U16A 2OYCA 1FUEA 3GFOA 2IW3A 1IWPB 3QPAA 3F4KA 2CT8A 2A67A 2CV1A 1KBQA 1JFLA 4OHOA 4CTJA 5FUQA 5CCBA 4AMZA 3N7AA 3HFSA 3ROTA 3TFOA 2QF7A 3FETA 2O8FA 1WLYA 2JJMA 4HCJA 3RH0A 4AD8A 4H77A 1P6UA 4WN9B 1QHGA 2DZDA 2Z30A 3S40A 3WICA 3FVRA 1GGKA 4WFJA 1W36C 4OLFA 1Y3BE 3RTDA 4GMGA 2VXOA 2C7BA 1L5MA 3HCOA 5K20A 1NBOA 1JA1A 3RTEA 1CEEA 5DU2A 3U2QA 3ZDEA 4G84A 3HFGA 4IVQA 3ETLA 4KO2S 4HQLA 2CN1A 1PGOA 4WOBA 2D7CA 4XD2A 5L4NA 2I54A 3IAM1 4CV1A 5FOWA 1QGDA 3RYHA 4UXIA 3UAWA 3CZRA 4GP7A 4KKXB 5CTAA 4B8WA 1N78A 4NHEA 4O4LA 4D9FA 1ZM2A 4KYTA 3ZW9A 4ZOCA 2ZXEA 4JDUA 4QTUB 1VI2A 1WOYA 4ZEWA 3LDUA 1KORA 1SPBS 2H3HA 1IQUA 4MO2A 3S7ZA 3TD2A 4Y30A 1V6SA 3RDPA 3SS7X 4FIZA 1OI7A 2VAWA 4RAQA 4EABA 1G3MA 3FN4A 2AZDA 3NIWA 4JBGA 3K0FA 2D3TA 5EQDA 1E9FA 1RJGA 3O93A 2JLVA 1A88A 4D0LB 4J4TA 3T12A 3SJBA 1TW2A 5KMGB 1SGWA 3U4DA 1THZA 2PFKA 4RFSB 2ZJ4A 1NKTA 4O2AF 3RVDA 1V11A 3H9JA 1R4ZA 3OHSX 3ABZA 4D5EA 2MSNA 4LZOA 4DKXA 1JQDA 4N8DA 1EP9A 1AQIA 2OWDA 3H5OA 3DVQX 8ADHA 2EVWX 2GCEA 4HDMB 4P58A 4ARUA 3CVYA 2WFZA 3QOWA 5LP6A 1F2UB 3QEMB 3CUWA 4FIDA 4Z7NB 1KVQA 1VBFA 1P0CA 2XT6A 3BTOA 3FOCA 4RJJA 3RUAA 3D6HA 2X1MA 2CE2X 1PKXA 3EAFA 4FMDB 4MLCA 5JDCA 3I6MA 4TM8A 3RABA 2RKBA 1I4LD 1SXJC 2B92A 3ICVA 3E3AA 1P3Y1 3WQSB 5BURA 1KP3A 1GXSA 2V7UA 2NW6A 2FRVA 4X7BA 4RF5A 5HFAA 4LOAA 4EJSC 4B3MB 3SQOA 1C8LA 2IPNA 4IOKA 5DTJA 3HCBA 1KAMA 4QDOA 4Q05A 2J3JA 3C3EA 3U44A 2P6RA 3MJEA 2R00C 4L72A 1D7AA 1W94A 1Z16A 4PYNA 1H6DA 3F49S 4M9SA 3FNQA 2F4NA 2G1KA 3M6IA 4DR3B 3AZPA 1X1CA 4ZOEA 4JA2A 1K8ZB 2EF0A 5I8ZA 1C0EA 2VHZA 2QN6A 3CLUD 4D9NA 3KXIA 2ZI9A 3DVSX 1LLCA 2Z57A 3DBOB 5HA5A 3AUFA 1ULAA 4HDSA 1PR1A 3IT3A 3HKCB 4ETWA 5KOIA 1M5RA 1Y9ZA 3E61A 1JKJA 1F9AA 4NMHA 5HZHA 4DKJA 5FUYA 3LRPA 4KBYA 1XTJA 2ZIZA 5ARBA 1MOZA 2YV5A 1B42A 1MDFA 2ZUCA 4I55F 2P90A 2WIKA 5IBCA 1TZ2A 3PHGA 3AHJA 3ZZNA 5ITWA 5LSAA 4O4IB 4MVJP 3TZLA 3W2FA 5F1KA 4JOBA 5L9AA 3BREA 4W8OA 2EFHB 1CG6A 2WKWA 1HDXA 2A0WA 3E8XA 3NUGA 3TW0A 1CP2A 3VM6A 3FFBA 4KITB 1C1XA 3I9JA 1W87A 2C8LA 2WV7A 4GPAA 1L8XA 2NSLA 4XGIA 1VXOA 3O82A 1MAAA 3IQZA 3BHMA 2AEEA 4LK2A 4TLAA 4JV5B 2PX6A 4O5OA 1HO3A 5LYJB 1F9EA 5BUQA 2PL9A 4J3FA 4PAOA 1JW9B 1U8CB 1ECPA 2AVNA 1IC6A 2G36A 3M5PA 3EF3A 4QPPA 3G0OA 5E3JA 4F46A 3HL0A 4JYZA 3HBMA 4PLPA 1I0ZA 3PWTA 4LKOA 4Q9IA 1HG1A 4RMGA 1QQAA 4OLAA 4KXUA 5FTJA 1IY2A 1UJ6A 7REQA 1O0SA 3IKMB 4ZTUB 1OZAA 3BQMB 4TXLA 2VP3A 3CRW1 2JBAA 2F9LA 2I55A 4HMQA 1D6SA 3OHMA 3V55A 4BLPA 4OKIA 2QIPA 3ZWWA 1LW7A 2OV6A 1CUBA 1GPMA 1JR6A 1FUKA 4W7IA 5FA5A 3UZUA 3VPDA 3TXAA 4AZ0B 3DOJA 5I7RA 1Q44A 3NHJA 4PLGA 5IT9A 4KR6A 2YC2C 3C3WA 1YQQA 2YRWA 3T52A 3H11B 1MX9A 2EYUA 3E9MA 4KO8A 5CDHA 4CW7A 4LF7B 4K0KB 2MHCA 3SKYA 3U3RA 1NG1A 1PQ4A 3O4GA 1IG3A 4C7OA 2ATEA 2YV3A 4URXR 4WOJA 1BXZA 3N28A 5HP4A 3WNDA 4KFCA 1I24A 2VDUE 2RONA 4B0OA 3V3TA 3U7RA 2XRZA 5EVCA 4EKDA 2C59A 4LJRA 4ZYWA 3LO5A 3LUHA 2X23A 3IKTA 5YASA 1HQDA 4ZGWA 1JSRA 3DZIA 1B2LA 4ZQEA 1MV8A 2O2SA 4TXHA 3VC7A 1N6LA 4XVRA 2O54A 4ALIA 5DW3A 4AZWA 3GJ6A 3K0BA 4FWBA 3W4KA 3PQ4A 2X0FA 1JEEA 1U28A 2I34A 3CHYA 2D4HA 2JK1A 3IOMA 3GG2A 5F5XA 5LMCA 1PJ2A 4KB5A 4RV9A 3S7TA 2BDEA 4YO7A 3Q10A 4YP6A 5H3CA 1YS2X 3BMOA 4F2GA 2AHRA 2H2WA 3AEKB 3KDAA 2IBSA 3WB1A 3JSAA 3RNOA 4A92A 5FBLB 4BB6A 5EMHA 4V0QA 1E9BA 5A9RA 2ZB2A 3V4SA 3V2UA 1K9VF 4FFRA 5IJWA 2BGIA 4K9NA 4PLTA 5IWAB 1D2AA 4G09A 3HO1A 4EA9A 4OQQA 2IHBA 5A3SA 4NNOA 1ZU5A 4B87A 1S2LA 3NVMB 1CUIA 2P6OA 4ROTA 5CYFA 4DSTA 4URVR 2WB2A 3IE2A 3RQIA 4G0XA 3MPOA 2I3DA 4ZTZB 2JVKA 3C41J 4EA8A 1ZVVA 5HOEA 2EDCA 2ID8A 1GADO 1HYGA 2NXCA 2R751 2BMVA 2FZGA 3BQ9A 1Z5NA 3OQJA 4HTFB 3EIFA 3VYWA 4YAKA 4DNFA 2C95A 5CHYA 4DNPA 4QT4A 2PO7A 4DZRA 1OXKB 1M0SA 2ZRLA 3DKVA 2PV7A 2FX2A 2WMNB 4OATA 4MQ4A 3A31A 3KPWA 2GTPA 1DDOA 1JJIA 4MUGA 3OTWA 4R05A 4R8VA 5IZCC 3BKXA 1TVCA 4L3WA 3RIGA 1PQWA 3H75A 2IUFA 1O87A 3IVGA 3X1WA 1GILA 4KYUA 4EP1A 4BNZA 3GWZA 4K9RA 3HUEA 3G7NA 2C9CA 4C4RA 5LJLA 1UAGA 1RWXA 2VKTA 3LBYA 2IUUA 3K1AA 1R0SA 1U2DC 4OJTA 3PJGA 1E32A 1T2UA 4QU9A 2ECKA 5JC8A 3HM9A 3LT4A 2IYSA 5GVSA 1ZQ9A 3HCAA 3OTQA 4NFLA 2QSJA 5EIBC 1RZRA 1MNAA 1Q0SA 4M1TA 4DHEA 5EHZA 2GEUA 4DR7B 2ZQYA 1C9JA 1J97A 1EH5A 4W9NC 2NN3C 2OCXA 1R50A 1NMQA 1GPDG 3ESBA 2OZLB 3PBKA 2ZRNA 3G5AA 2QUIA 4GBMA 2ESRA 1SUPA 1THGA 2NNLD 5FO0A 5ALOA 4GD3Q 1CUZA 3GZ4A 4XLLA 3M4XA 3C24A 4NWIA 3AU9A 3AM4A 3K3PA 3PITA 4ZA2A 1TTQB 4OHZA 1XGKA 4CLRA 3NYWA 1T8SA 3P9XA 4UXJA 4YJFB 3NHWA 2JI8A 4B9EA 4BLRA 2DXIA 1KJWA 1G63A 2PSDA 1WTAA 1VECA 3GXOA 1TCBA 3DEHA 4AB1A 4P3PA 4XASA 2QY6A 2GI4A 3BGIA 1JU3A 1DBWA 2PLFA 1U8FO 2KBEA 2P69A 2I8AA 2VT3A 3V33A 3OLQA 5ER9A 2Z3ZA 3PC7A 4EGQA 5CNKA 5LZ8A 2V7GA 3CEMA 2JFQA 4JYCA 2P6UA 4YJHB 5CAEB 2AUMA 2NADA 5A7HA 1ZM7A 4D25A 1UJNA 2H51A 1V8FA 1Z36A 4M0PA 2VUUA 2ZJ7A 3H18A 2FSVC 4AJ4A 4AKTA 1GGVA 1WM1A 2R79A 3VYSB 1J9GA 2I03A 1PJ4A 4MKHA 2P68A 1FC0A 4F71A 1XJCA 1M7BA 5TPWA 5DI3A 3ROGA 1HDIA 3T7SA 1TJ4A 2X41A 4HSGA 4DUPA 1BX0A 3P9PA 3K9HA 4WZBB 1CJUC 3QBVA 2J3DA 1DRUA 2WUVA 3LVQE 3M49A 3DMGA 1J1UA 1G20B 2A30A 3HEBA 1N8TA 3V4FA 1A8IA 4Z7QB<