3B1FA

Crystal structure of prephenate dehydrogenase from streptococcus mutans
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
290
structure length
286
Chain Sequence
AAAMEEKTIYIAGLGLIGASLALGIKRDHPHYKIVGYNRSDRSRDIALERGIVDEATADFKVFAALADVIILAVPIKKTIDFIKILADLDLKEDVIITDAGSTKYEIVRAAEYYLKDKPVQFVGSHPMASGAVAANVNLFENAYYIFSPSCLTKPNTIPALQDLLSGLHARYVEIDAAEHDCVTSQISHFPHIIASSLMKQAGDFSESHEMTKHFAAGGFRDMTRIAESEPGMWTSILLTNQEAVLDRIENFKQRLDEVSNLIKARDENAIWAFFNQSRQIRKNME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of prephenate dehydrogenase from Streptococcus mutans.
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Oxidoreductase
molecule keywords Putative prephenate dehydrogenase
total genus 95
structure length 286
sequence length 290
ec nomenclature ec 1.3.1.12: Prephenate dehydrogenase.
pdb deposition date 2011-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02153 PDH Prephenate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3660.10 Mainly Alpha Orthogonal Bundle 6-phosphogluconate dehydrogenase C-terminal fold 6-phosphogluconate dehydrogenase C-terminal like domain 3b1fA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3b1fA01
3FTNA 4KMSA 3W8FA 3O9ZA 1IB6A 1R4NB 2O48X 3K96A 4MP8A 3A4VA 2A92A 5ITVA 1Y9AA 4U7WA 4BNHA 1ADCA 3PHLA 2C7GA 4WOKA 3ZDFA 3DEYX 4ZQBA 1DOHA 5JY6A 3OETA 2UAGA 4CM6A 3DAGA 1ZNQO 4LCEA 4XB1A 2ZQYA 2HRZA 1VL0A 4RLHA 1X1TA 2AQIA 4HWKA 3CXRA 4GX0A 4IJVA 4BHTA 1Q0QA 3Q9UA 4FGWA 3VPSA 3WG9A 1X15A 3IMFA 1Y8QA 2EV9A 5I9LA 2I76A 4OQZA 4JIGA 3F47A 4FC7A 4HFNA 3BHIA 4MVJI 3ZGYA 2RBEA 3ZV6A 4E30A 2DT5A 3GR6A 3NYWA 5H83A 4TKLA 2P9GA 1AGNA 1PQPA 5IN4A 2EGHA 4CR8A 1I32A 1HDXA 3C7CB 4OH1A 1HKUA 1SPXA 3KRTA 1SAYA 4GL4A 1W0CA 2DAPA 2GLXA 2B5WA 2PV7A 5DCYA 1LRLA 3H4VA 1O94A 3ZZNA 2Q2WA 4XJSA 4H16A 3PGJA 2HK9A 3ONFA 4MVJG 1XA0A 3X2EA 2DTXA 1GR0A 1DFIA 1KVTA 1I01A 1M6WA 4B4OA 4J9UE 1HXHA 1O9BA 4B8ZA 3HN2A 3KO8A 4ZGWA 1Y8QB 4ZJUA 1ISGA 3PWSA 2OP0A 4JK3A 3PJFA 4IDFA 3ZWBA 3LQFA 1VSVA 4MKZA 4N5MA 5DP1A 2W2KB 4FW8A 1NAHA 3RBVA 5C5IA 1YL6A 1FDUA 2AW5A 3ONDA 3GG9A 2BFMA 5JO9A 4YT4A 4I9NA 3F9IA 5A5FA 1XKQA 5TT0A 3AOGA 5COQA 4DL9A 1NFRA 4F6CA 3WMWA 3OIFA 2GN4A 5HTOA 4GVLA 4WK6A 4NDNE 1JAXA 3JQ7B 3WBBA 5ITWA 2YHUA 3I83A 1GFSA 1I0ZA 3DMTA 1ZXBA 4C7JA 5MGBA 4NBUA 1AHIA 3ANMA 1MXFA 3G49A 2FMUA 1RM0A 4BL5A 3NTRA 2X9GA 4Q3EA 1XHLA 2Y1GA 4PG6A 4XQ9A 3S2GA 5CDGA 1GYQA 3WYEA 4IZIA 5KKCA 4NIMA 5TX7A 3V2UA 2DBQA 2X4GA 2X86A 1L7EA 2IZ1A 1NQOA 1ZFNA 5TSDA 3ZU3A 3DXFA 4R1TA 4NJMA 2NVUA 3PHJA 1MX3A 2PY6A 3I9MA 2E6UX 5ES3A 2WD7B 5BSFA 4TRRA 3RJ5A 2BRUA 2P91A 1I30A 2UUOA 1XR3A 4DMLA 4B4UA 4EJMA 3BMQA 3OJ0A 3QLJA 3S55A 3H9UA 1VJTA 5EPOA 4CR7A 3ZN2A 3FD8A 1B0AA 1BVUA 2OL4A 3GNQA 3H9JA 1LRKA 1N1EA 4WNIA 3RI3A 1WMBA 2LDXA 2HJRA 2I3AA 4RV9A 3U62A 3UAGA 1X0XA 4N7RA 3H7AA 1N8KA 4HUJA 3ROPA 4NFSA 3OIGA 1P0CA 1PGOA 1YS4A 5I8ZA 4A26A 1I3MA 1SB8A 4ZICA 4TWRA 4GSKA 3C1AA 2NVUB 4CMKA 2QRLA 1GAEO 4DPMA 2HUNA 4OGWA 1LC0A 3PZRA 5B4TA 1MB4A 3PPIA 2W2LD 1HLDA 1N92A 4K28A 1YDEA 2E82A 3M6IA 3BMQB 1V3TA 2QQ5A 2G76A 5C7OO 4JP3A 3EZYA 2FWMX 3GVPA 3E18A 5G0TA 3PYXA 3RC2A 4ZHSA 1GTMA 2X5JO 1GDHA 1P45A 2GN8A 2V6MA 4WEQA 4BNVA 3ROKA 3JD3A 3ZW8A 2IZZA 3PHIA 1HYGA 1UXJA 4GX1A 3V2GA 1Y5RA 4TVBA 3WX0A 1LRJA 3I4FA 2NTVA 3WDSA 4D43A 4FSHA 4F3YA 7MDHA 3AK4A 5IXYA 3QW2A 4R9RA 1P1FA 4H7PA 1ENYA 5IDQA 1F17A 5F21A 2YFHA 2PD4A 5I9MA 1T2CA 3ZWAA 3CINA 3WYCA 1C3VA 3ZV4A 1HE4A 1JN0A 3SBOA 4A5OA 3E5MA 3GNSA 3U4IA 3L77A 1IZ0A 4KP7A 3NJ8A 5IDWA 3VH2A 2JAHA 4FC6A 3IS3A 2WYVA 5KVQA 3SLKA 3ZWOA 1V8BA 4RQTA 4BO2A 3EHEA 1NPYA 1BXZA 1WMAA 3WGTA 4CM4A 4KQWA 3TZKA 1TXGA 1H5QA 4RPLA 2HO5A 4W4TA 5JAQA 4AVYA 3ZH2A 3R3SA 4NH4A 4LSWA 1ZSNA 3GVHA 4KZPA 4J9VA 3KV3O 4AJKA 1BSVA 2BHLA 4OJNA 4MDHA 3ZI0A 3KHUA 5AXCA 2B36A 3L6EA 5JCXA 2FPPA 1LBEA 1XIVA 4I5GA 1ADFA 1RYDA 4WLOA 2C7VA 2DUWA 4JLWA 3RWBA 2JCXA 2PD6A 1TEHA 4QECA 1YDWA 3JQAA 2EGGA 1GQYA 3I9LA 3F3SA 3UCFA 3E03A 1O95A 1SEPA 3GC6A 3E8XA 4RL6A 1WXDA 5F5LA 2Y1OA 3FRJA 3KETA 3GLQA 1P3DA 3F1KA 4U0JA 3MOGA 2YW9A 1O6ZA 4GWGA 3HADA 2X0JA 3B1FA 4J2HA 1R0SA 3ROQA 5JFOA 1VLLA 3P19A 8ADHA 1C0PA 4HFRA 3WSVA 4TMFA 3OJEA 4DBVO 2VUSA 3L4BA 1G0OA 3RUCA 4YT5A 4DXHA 1KS9A 5I7SA 2IDZA 3ETGA 4PZCA 2ZQZA 3GHHA 4IXTA 1E3SA 1UP6A 4WEOA 2Y67A 4Y67A 2X0IA 3EY4A 4RF4A 3FR7A 2X7HA 3OECA 3LT2A 3ETEA 1D1SA 3IJPA 1LQTA 4CL3A 1C0LA 2PR2A 4ILKA 4GGOA 2UYYA 5L7YA 2B5VA 3PP8A 4FFPA 2C59A 3B70A 4FOOA 4BNWA 1V35A 3HG7A 1Z7BA 1Y9EA 4ONEA 4BGEA 4QEDA 5JBIA 4PG5A 5I9NA 1SNYA 1LNQA 2Y1EA 4J4BA 3DBHB 2G5CA 2BGMA 1JA9A 3Q0EA 3ZWWA 3E82A 3GZ4A 5TF4A 4NMHA 1DRVA 1K6JA 3EVTA 1XWFA 4P22A 4PLVA 3OIDA 5JYEA 4BKUA 1PTJA 2POQX 1CWUA 4AJ1A 1LSJA 3VZSA 1XLTA 1T2EA 2EP7A 2O4CA 3EYWA 3RSHA 4I08A 2JKVA 3MWDB 4WASA 3RBXA 2AG5A 3BIOA 3UHAA 2D3TA 3DZBA 4RVFA 4FCCA 1DDOA 2X8LA 1QLJA 4MVJH 4E2XA 3JQAD 5KIAA 2PH3A 1HDOA 3A28A 4ALLA 1OMOA 5ENDA 4IY1A 2J5RA 4QQRA 4FGSA 4XR4A 3WLFA 8LDHA 1LDBA 4Y9DA 3AI1A 1JQBA 3L4BC 3OM9A 4BKPA 3FF4A 3WGOA 4J16A 1OBFO 2GASA 2LDBA 3I6IA 4TSKA 4YAJA 4ZQGA 5ER9A 3STHA 1YBAA 2Z1NA 4Q39A 1B7GO 4EJ6A 1JAYA 4FOSA 3D1LA 1HE5A 1FF9A 1WZEA 1U7HA 5FFFA 3ONEA 3WWYA 3AFNA 2J3HA 1Z45A 5A5EA 4YCAA 4XJTA 1ZJYA 4YT8A 1U5AA 3WTCA 5CG1A 1P77A 2VCYA 4D3SA 5JCJD 4CR6A 3O8QB 4NFHA 1QP8A 4DREA 4UVIA 2JCYA 2A9FA 1XQ1A 2Y1DA 4GH5A 5DCUA 5EESA 2JHFA 1DC6A 4J0EA 4E5YA 4TKMA 4LK3A 1LX6A 4BOYA 1IPEA 4EW6A 4I8XA 2VQ3A 5F3RA 4YXFA 1KVQA 1WDMA 3AUTA 3HFGA 1PQUA 1U7TA 1E3EA 3KXDA 2PWZA 2VNSA 1LLCA 2J3JA 2PGDA 4AL4A 3ICCA 3RCBA 1PJ4A 2Q45A 2JFHA 1WZIA 1QR6A 3DFZA 5CP8A 1HL3A 4RVSA 1LLUA 2B4RO 2VHVA 1J5PA 3D0OA 4CM7A 1HYEA 2DBRA 1PGPA 2HRBA 3GMDA 1PL8A 1UXKA 4CMEA 5A03A 4FIZA 3NJ4A 1YB5A 1NHGA 3P5SA 4NBWA 4U6SA 4YJHB 3S2FA 4JBHA 2X9NA 1H0KA 3TL2A 3A1NA 3NKLA 1ZVMA 5AVOA 3LT4A 4XIYA 1X13A 4ND5A 1PJCA 3TFQA 1UDCA 2EIHA 4KDFA 1TT5A 1U5CA 2CFCA 4PLTA 2Q1TA 3IKVA 1KERA 1CRWG 3OICA 4OHUA 2O2YA 4IBOA 4IZHA 2Q50A 3HE3A 1RWBA 1ZMTA 2GZ1A 4RZHA 6ADHA 4D41A 4L75A 5KJCA 3WTBA 5FI5A 4K6CA 4RPHA 4ZQFA 1AE1A 5EN4A 1U28A 3PI7A 4R41A 4ZQHA 4AJEA 3MJSA 2PH5A 3W6UA 1NQ5A 1MG5A 4MVJM 4PVDA 4BNZA 4CJXA 1WAMA 3HDJA 4JP2A 3CSDA 3KOUA 3Q9NA 5DNAA 4R5HA 4NQZA 1LLDA 1LU9A 4J49A 1KYQA 4OO3A 1NVTA 1OFGA 2HSDA 1PZEA 2VRCA 4J6FA 4N18A 1KC3A 3NDJA 2GRAA 1UUFA 3HSKA 5T67A 1RPNA 3OP4A 3ENNA 3UCEA 1P1RA 2VYVD 3WIDA 2ZJ1A 4DQXA 1KEPA 1ZEJA 4M89A 2DPHA 4CLRA 5JPIA 1ENZA 5JDIC 4BO6A 3WGQA 4CM9A 1T26A 3JQ8A 4TQGA 1D8AA 2HQ1A 3DFUA 2JJYA 2C2XA 1ZO8A 2QRKA 2GO1A 2ET6A 1NFFA 3KYBA 1M6HA 4YWJA 1KEWA 1PGQA 4J7UA 1RYEA 3GG2A 1U3WA 2O3UA 3DHEA 1GCUA 3GFBA 2YZ7A 1Q0HA 1NBOA 4NK5A 3S2EA 1PJQA 5L53A 3WQRA 3AY3A 3IQDB 4UREA 1H6DA 4EEZA 4QX6A 3WICA 4EI2A 2FP4A 2NNLD 4BO0A 2V6BA 4IMPA 4RF5A 4TRMA 2DTDA 4IGEA 3PEFA 4OSPA 5TLSA 1A7KA 4E13A 3S8MA 5G0SA 2C2YA 4YDRA 4IDCA 1AXGA 3UF0A 1JKIA 3C3XA 1Z73A 3JQ8B 2AG8A 4Q3AA 5K9ZA 3R1IA 1V3UA 3FPCA 4RPKA 3C7AA 4B7XA 2G1UA 2GYYA 3TDKA 4XWYA 3LF2A 4RJTA 2YQ4A 1E0DA 2A35A 2OO5A 4LW8A 1U1IA 5IXSA 3ZWVA 4IDBA 4XEHA 3PYLA 4E2WA 4A7PA 4ITUA 2NTJA 2FY8A 3TQHA 3G3EA 3DOCA 5DBGA 3KYDB 1V9LA 3H3JA 5LDGA 3GZNB 4LMRA 4WLVA 4ZVVA 3R6DA 4FQ8A 2VYNA 1GUZA 5I8WA 4A27A 1Y6JA 3M2PA 1X7HA 4MKXA 4YVFA 3ZHZA 4AJNA 3L9WA 4IQGA 3CMMA 1HE3A 5L45A 3T4XA 3LC7O 2F1KA 2RH4A 2AXQA 3HWRA 4FFOA 4XD2A 3RBZA 1I8TA 2DFVA 3VHRA 1K6XA 2NLOA 4G5HA 4PN3A 5U4QA 3H5AA 2H9IA 3PTZA 1EBFA 2WYWA 3QRWA 4FFMA 2W4QA 4GMGA 4L4XA 4JJGA 3ZWXA 1R12A 4NR0A 2NU8A 1GEGA 1LUAA 4R68A 1PZHA 3LLSA 3BMNB 1VJ0A 1P31A 1ENOA 4JCOA 3KYDA 3E48A 4RCVA 3MJTA 1D4FA 4R69A 3WBFA 2R00A 5JC8A 1BXKA 3DWFA 1CF2O 1R66A 4MVJE 3DZHA 3U3XA 1MFZA 1W6UA 1ADBA 3PDJA 2FR8A 3FBGA 4WCDA 5DCWA 2OFPA 2PZMA 4CM3A 4B7UA 2DC1A 5IZCA 3RU9A 1EUZA 1GZ6A 2VRBA 4YRDA 5I7EA 1HSZA 1N7GA 4J7CA 3MCVA 4PRKA 3JYOA 5HS6A 2W8ZA 3K5PA 4I5DA 4RVGA 5CHEA 3TZ6A 1MUUA 1C1XB 4IS2A 3RUAA 4LISA 1YL5A 3WFIA 4R4JA 4E12A 1N7HA 1ARZA 2IYPA 3R0IA 4RQUA 3WGGA 1G0NA 3DHNA 5F1KA 2IRWA 3BMNA 5H82A 4Z6KA 1BGVA 4IIUA 1L7DA 5TRTA 3GGPA 5GMOA 1MFPA 3QE3A 4ND1A 5AOVA 4J4TA 3H65A 3DOJA 1SO8A 3CH6A 3VKVA 2RHCA 3RROA 2P68A 1I36A 2B4QA 4ZA2A 1ZW1A 3NTOA 3LC1O 2Q49A 3RC1A 4BNLA 2BLLA 1EVJA 2CD9A 5AXDA 3F5QA 2AQKA 3I9JA 5F1OA 5A05A 1IULA 1GQQA 3HDQA 2JCVA 4FD3A 4BO4A 3B20A 3UXYA 1C1XA 3JYNA 3ADOA 3IP3A 4KWIA 3BTUA 3KZVA 3TN7A 1DHRA 3TF5A 3COSA 2Q2VA 3AOEC 3JD0A 3ZWMA 4AJLA 2X22A 5G2OA 4DQVA 2Q2QA 1E3WA 3I52A 2EERA 4Z0HO 3O03A 1CQJA 4GPD1 1I2BA 5COBA 1U4OA 3BTSA 4XZ3A 2Y0EA 3RC7A 4OIMA 2GERA 4B3JA 4LGVA 5A06A 1UXHA 2IYOA 5A3JA 4RF2A 3IAHA 4JJIA 4R16A 3ZNPA 3I1JA 4RVDA 1LLQA 3DR3A 1JWAB 3CZMA 1GV0A 1R37A 2Y0DA 2B35A 3QVSA 1PJLA 4GBJA 4R5MA 4CL8A 1C1DA 2J3KA 2EKPA 3M1AA 5DF1A 3PFWO 1E3JA 4KTTE 4CODB 3DTYA 4BNTA 3KVOA 2ZB7A 4KWHA 4RVHA 2XOXA 4DIFA 5DP2A 2TMDA 5AXBA 5LC1A 4XDZA 1E77A 2HMWA 3QY9A 4Q9NA 3I3OA 3V2HA 2VOJA 4DLAA 4L76A 4BNNA 2C0CA 1E7YA 3RKUA 5JNLA 4E32A 3G1TA 4LVUA 3GT0A 4K9DA 1NVGA 2GF2A 3O4RA 1P74A 1PX0A 1EQUA 1K3TA 3WSWA 5A9RA 3KTDA 4DA9A 5DOVA 5JDCA 2Y68A 2YV2A 3WLEA 4EUEA 4M55A 2Y1FA 4YJFB 2I5PO 3AOEA 1EZ4A 2G17A 3NGXA 3RFXA 4ALMA 3GHYA 4XX0A 4DC0A 2Q4EA 1Z75A 3T7EA 2P4QA 4RPGA 2EG9A 2CNBA 1NR7A 4JBIA 1JVSA 2PKQP 4FBGA 1NP3A 3VTZA 4J2OA 1B3RA 2VZ0A 3DBRB 3G17A 4DYVA 1E1MA 1ZCJA 3MJVA 1JTVA 2GPTA 2QZZA 2OBNA 2BD0A 1GQ2A 4II3A 5BQFA 3WNVA 2B37A 4RO0A 4AJIA 3K31A 1ZEMA 1ML3A 5HBRA 1UR5A 3RD5A 4Y6RA 4IJWA 3ON5A 2FRDA 3OEWA 4B3IA 3V1TC 3ZWPA 4E21A 5KJEA 3ASUA 3OSUA 3DONA 3GUYA 1DIAA 1DEHA 3CZRA 1YQGA 5A9SA 3RU7A 4U6QA 2P5UA 4GKBA 3L9XA 1SBYA 1HF3A 1ID1A 2G0TA 3VAZA 2EW2A 2BELA 2E49A 4DTIA 3W4KA 4PLZA 1OAAA 4GSLA 3JV7A 4P4NA 2D2IA 4OL9A 1R4MB 2O50A 1AUPA 3LYLA 2HK8A 3EUWA 2EEZA 2ZB3A 3M2TA 3NTQA 3UOGA 5IAAA 3U09A 1QMGA 5EL0A 1V3VA 4YR9A 2DBZA 3ETDA 3C24A 3CEAA 2X5KO 3F1LA 3TL3A 2SCUA 3DBLA 3F4BA 1E6UA 3PXXA 4I5FA 1JKFA 3RJ9A 3VVBA 5JDCC 1KEVA 1E6WA 2AQHA 2I99A 2FZWA 4B7CA 4WKGA 3C8MA 5DBIA 2JD1A 1SB9A 4BGIA 3X2FA 5H81A 5A9SB 3JD1A 2ZJ0A 1A7AA 3JQ9C 5EERA 2I9PA 2BF7A 2J8ZA 2VTEA 5LDHA 1P0FA 2H1SA 1PU2A 4PLYA 2NU9A 3H5RA 3U0BA 1PJBA 1HE2A 2ZCUA 1R4NA 1CETA 1NPDA 4UUOA 4ALJA 1QORA 2ZTVA 1J4AA 1ZK0A 1D1TA 2QYSA 5MDHA 2XF8A 3UCXA 3UH1A 3I9OA 1IPFA 4D46A 5A4DA 4DYDA 3DBLB 1T25A 4GKVA 2YQ5A 1RM4A 2GZ2A 5DN9A 1IZ9A 1PS9A 1PL6A 2NUAA 3WFJA 2YY7A 5EIOA 3SLGA 4IPTA 5BSEA 1ZJZA 1VI2A 4YRBA 3RFTA 4MVJA 1B14A 2QIOA 3ZV3A 4NBVA 3QJ5A 3TZCA 2F00A 4E6PA 2BGKA 1OC4A 1XELA 1H6CA 2DM6A 3OBBA 4FFLA 5DOZA 4WNCA 1IUKA 1BHSA 4NJOA 4XR9A 1Z6ZA 4YEDA 1E7QA 3B1KA 3L0DA 4FFRA 4JJFA 4OOEA 4E5PA 5AQ1A 4PCVA 2FSVA 2NQ8A 3GRKA 1NM5A 3B6ZA 1LA2A 4XGIA 5B37A 1D3AA 4CQLA 3OQBA 2PKRA 2J3IA 4WLFA 4D7AA 1QG6A 1NFQA 4DPLA 4DRYA 5DULA 3JQ6A 1VE9A 2HCTA 2R00C 2XAAA 4E2YA 4EBFA 3ZNOA 5DDIP 1LXCA 5TC4A 4O1MA 1UJMA 4DBZA 1H2HA 4WLNA 3BYZA 3AJRA 3JQFC 2Q1SA 4Q3CA 4KQXA 4R51A 3VZQA 2YHIA 3I9NA 5JW6A 4GQAA 4Z9XA 1Q7BA 4MIYA 3GUCA 1GD1O 2PZLA 1EFKA 3PFFA 2W2KA 3UKOA 2FN7A 4CLXA 5B1YA 1GU7A 2HAEA 3AWDA 3GAZA 2QRJA 2Z1MA 3K30A 3Q6IA 4CQLB 2DLDA 5IN5A 3TOXA 1CQIA 2JD0A 3LK7A 1JWBB 2AEFA 2PZJA 4LRSB 4S1VA 4XYBA 1Y7TA 2VTDA 4IXWA 2J6IA 1IHYA 4RZIA 3WOHA 1EK6A 4ALKA 1DHTA 4AJJA 4QUKA 4ZRMA 4E4YA 3WB9A 3AY7A 5EQDA 2VUUA 3KSDO 4EZBA 1QYDA 2JL1A 1HWYA 3D4PA 4I9HA 3FPLA 4U5QA 4BNYA 1T2DA 2NVBA 3JQ7A 1Q2XA 3EK2A 1LSOA 3NV9A 4RF3A 1UZNA 5LCXA 2DPGA 2WSBA 3D4NA 2YHIB 2YFQA 4M54A 1ISIA 4LSMA 1YJ8A 3SJ7A 4GI2A 5T5QA 4OXKA 1QV7A 3WXBA 4CUKA 1DFGA 3JQDA 1O89A 3D5TA 3V1UA 3Q1LA 1MA0A 4BO3A 3KLMX 3H8VA 2CVQA 2Y0CA 3ZHBA 1V6AA 1X1EA 4E31A 3LZ6A 1X0VA 3TOZA 1MV8A 4NJMB 4UUPA 1R16A 2V6GA 2RCYA 1N2SA 3AU9A 2CZCA 4JQCA 3ZU4A 4YB8A 2QX7A 4D0SA 5JMWA 5KNLA 2JAPA 1MP0A 3DO5A 4FJ2A 1VKNA 2UDPA 3ZHYA 1GL3A 1QRRA 4UEKA 3V1YA 1EFLA 2VNAA 3F5SA 3BHMA 4XYGA 1PJSA 3GK3A 4KOAA 5B12A 4YT2A 1YB4A 1H9AA 2YDYA 1DIHA 2W90A 3GN2A 1K0UA 1IYZA 4BNXA 3ABIA 5CG2A 3C7DB 1YBVA 1UAGA 5CFZA 2QHXA 2RIRA 3S1LA 1GUYA 4BO8A 5JAMA 3ZNQA 4YA6A 4BMSA 4YAEA 3D64A 3FCOA 1NX6A 1ZK1A 2VT2A 2DQ4A 3QV1A 4J7XA 3FBTA 2O3SA 3EW7A 3UN1A 3IUSA 3GEDA 4CQMD 2O3TA 4E2ZA 1EBUA 1MGOA 3IDSA 2D5CA 2HMSA 2HMUA 3F4LA 5A3VA 1IY8A 1U2DA 1W73A 4Z0TA 1VM6A 5JE8A 2NU7A 3MTJA 4BGVA 4QT0A 1VPDA 2NQTA 2ZTMA 3DBVO 1I3NA 4HFMA 5J23A 2I65A 3H2SA 3H9QA 1PS0A 3F6YA 2QG4A 3L4SO 1LDGA 1KETA 1RJWA 1YE3A 2IZ0A 2ZYAA 3PJDA 5G0VA 4B79A 1B8PA 1ZK3A 5G4LA 4Y6PA 5L40A 3ZU5A 1K89A 3ANLA 3GRPA 3T4EA 4G2NA 4NBRA 4NU6A 1WW8A 1NTOA 2QW8A 2YDXA 2J5QA 4HKTA 2GNAA 4UEOA 1Z7EA 3MEQA 5T57A 4GAEA 3IL2A 1P1JA 3FTPA 4CM1A 3HFSA 4FDAA 4WCFB 4BNMA 2FPGA 4J1NA 4DC1A 5K6AC 4BKRA 1HT0A 3GNTA 4ESOA 5FF9A 4XRRA 1T2AA 2H63A 4HNGA 4DIOA 3RC9A 3DMYA 1DFHA 1PGNA 1F0YA 5ADHA 4BNJA 3ITKA 4MIEA 2HMTA 2FPIA 3BZUA 4PLGA 2VRCD 3KEQA 1LDNA 4IMRA 3K2BA 3FHLA 4M87A 2O2SA 4BNGA 3TRIA 2YV1A 2VHXA 1T24A 3IC5A 3JQCA 2OMEA 5HRUA 3W4JA 4OYRA 1QSGA 4Q3DA 1UH5A 2ZB8A 1KY4A 2GD1O 5JDIA 4J1SA 1DSSG 4LMPA 4R1SA 3KLPX 4WCFA 3RAJA 2I6TA 4DLLA 3LSYA 3PWZA 5KVSA 1DIRA 4OAQA 1E92A 2PLAA 1BMDA 1KVUA 1XQ6A 4JX8A 3OQ1A 2DKNA 4J43A 1WNTA 4RVUA 1UDBA 3ADPA 2XPCA 5L4NA 1H94A 3OHSX 1A72A 1NNUA 3PJEA 4CLEA 4ALIA 2VUTA 5C7IO 3I5MA 5C7LO 4BUCA 3MJ4A 4M8SA 1IE3A 1SEVA 4XGKA 1PR3A 5GZ1A 4WE3A 1NWHA 1UP4A 4PG7A 4ALNA 5IG2A 2FOIA 4K6FA 1E5QA 3ZW9A 4ZN6A 2OP1A 2BKAA 4BMNA 1KIFA 4R1NA 4AJ4A 4QTZA 2WTBA 3DDNA 5U9CA 1Y1PA 1UXGA 3N58A 4HADA 4OSOA 4XRGA 3W8DA 5JXWA 5TT1A 1LDYA 4IDAA 1F8FA 5TJ9A 1A4IA 3TZQA 4BO7A 4HBGA 1DO8A 1P1KA 3KUXA 1LDEA 4IJKA 4QXMA 4WECA 4BNKA 4HY3A 4JGBA 1SMKA 1ZMOA 3KM0A 2VYVA 2JFFA 3NT2A 3TWOA 3FNEA 3OA0A 5JC1A 5KJFA 4II2A 3DBHA 3CMCO 2BMAA 5JS6A 2DU8A 3G79A 1YB1A 2Z95A 4NBTA 4PLHA 2C07A 4CV1A 1PZGA 4BB5A 4CQMB 4A2CA 2GUGA 4MJLA 3WMXA 3ZWYA 2VHYA 5GZ6A 2A4KA 3RUFA 3HZZA 4Z3KA 1J6UA 3IP1A 1HEUA 4CMAA 1I3KA 1P44A 1DJQA 4Y98A 3VVCA 3JQBA 3GMSA 3EZLA 1XGKA 1Y81A 3DQPA 5TNXA 4GWKA 4EUFA 1P9LA 1PL7A 1BDBA 5CEFA 3NX4A 1N1GA 3CUKA 2X58A 3R3JA 4XYMA 5EQFA 3CE6A 1ZBQA 3KB6A 4GLOA 4TZTA 4E5KA 2GN9A 1PIWA 1FK8A 3PIDA 3WNQA 3K2EA 5KVCA 4J1QA 1DLJA 2FHSA 1E7MA 1JKJA 4IIVA 3VH1A 3OQ6A 5IJZA 5JYDA 2OZPA 2X9VA 3QA9A 4LN1A 4YBZA 4IGFA 5K0ZA 4J4HA 3ASVA 5ENVA 1R0LA 2BH9A 1Z74A 3UICA 4P4GA 4CLHA 3CKYA 4NPCA 3JQFA 3QQPA 3AM4A 2IXBA 4FFNA 3GGGA 3RQSA 3PHHA 3GVIA 3HB5X 4ND3A 3WGHA 4CMCA 2WD8A 4LRTB 3AI2A 4J0FA 3ITDA 2NV6A 2IEBA 1MG0A 2PTGA 3O26A 1YONA 2AMFA 2C82A 3DZFA 4CUZA 4FPXA 2CF5A 3WJAA 3U4HA 2OHXA 1ZH8A 1CYDA 3UUWA 4WGGA 2EW8A 4X54A 3WWZA 4QO8A 4YQZA 4YYZA 3KSUA 1E5LA 1SZJG 4W6ZA 2OUIA 1ISFA 1DRWA 2GSDA 4L4SA 1GPJA 2DFDA 3PQDA 3PHGA 4Y8VA 2UVDA 4PIVA 3WJ7A 4TROA 1FDSA 3FNHA 4PG4A 5L7WA 1DRUA 4BKQA 1ONNA 5G0WA 1A9ZA 2WYUA 4B4WA 4M49A 1GY8A 1HZJA 4PFJA 3Q2KA 4UVGA 1C14A 4Q3NA 3NAQA 3ZCXA 1F12A 4MVJP 5L4SA 4IS3A 2IEDA 5IZ4A 2VOEA 4MVJF 1F8GA 2EJWA 1E7RA 4M1QA 4ROSA 3AY6A 1BW9B 4YPOA 3A06A 1CEQA 1HDZA 3P2YA 3W4IA 5KJ1A 3GY0A 5KWEA 4RORA 2EHDA 1LJ8A 2Q1WA 1ADGA 1IOLA 3DL2A 4F6LA 4OQYA 1ONOA 3PRJA 5BSGA 1KC1A 1W8DA 5B4VA 3D3EA 3M1LA 4JBGA 3OJOA 3GEGA 4ND4A 3E1KA 1PR9A 2UUPA 4RGBA 2I3GA 9LDTA 5T64A 4L73A 2P5YA 2Q1UA 4W99A 3FWNA 4DUPA 3HNPA 2BGLA 3BMOB 2Q4BA 1ISJA 2VT3A 1EUCA 3RUEA 4E33A 1PEDA 3QIVA 4P38A 3U4CA 4C4OA 1LEHA 2IODA 2ZTUA 2NADA 3RKRA 1E3IA 3RFVA 4IQ8A 1VJ1A 2GCGA 3BXXA 1BW9A 3VPXA 1ORRA 3K8ZA 1F14A 4UEJA 1PWZA 3RVDA 5L9AA 5HWSA 1NR1A 5BNTA 2AA3A 1DJNA 2I66A 2CUKA 3NDRA 1B15A 3WIEA 3VZPA 3JQEA 1A4UA 1PJ2A 1QYVA 1EQ2A 2C5AA 2PK3A 4ZRNA 1DC3A 4D3FA 4EGFA 2OOSA 1FMCA 4E0BA 1RKXA 3T7CA 3PGXA 2WD7A 1HTBA 5CDTA 4PZEA 4FJ0A 3BMOA 3I4CA 5BNFA 1KOLA 1VC2A 3U49A 3VPGA 5L95A 5G0UA 1YGYA 4A0SA 1F06A 1E7SA 1ZKMA 4CMHA 5I7FA 4LVCA 4K26A 3MZ0A 4URFA 4N5LA 1NAIA 2Y93A 1T1SA 2HDHA 4L8VA 1I33A 1NQAO 3NT5A 1P33A 1YJQA 3G1UA 4GMFA 1UP7A 2CVZA 1U3UA 2Q3EA 4BQRA 5B4UA 5JO0A 1HDYA 3AFMA 4QFCA 2H6EA 3GPIA 2GR9A 4RLSA 3QHAA 1TT7A 4CMIB 5C37A 4D3DA 3NDIA 4O0LA 3QVWA 1YQXA 2YYYA 1FDVA 1EDZA 1MXHA 1LTHR 2CMDA 3EAGA 1FDTA 3WGZA 3GZNA 2X23A 4YJGA 1HYHA 3ZHXA 1DC5A 2C20A 3UW3A 2X1HA 4PLCA 2OORA 3AW9A 1YL7A 3MWEB 1GYPA 1KVSA 3DTTA 3K92A 3VH4A 5HS4A 3QVXA 3VPHA 1OC2A 3LT1A 2P2SA 2OBYA 4ZQEA 4IJUA 1PS8A 1N5DA 2BI8A 1CERA 3E5RA 3IUPA 2OGUA 4BNIA 1GUFA 4BV8A 4D44A 4CMIA 1YOVA 5IDYA 4DVJA 3FI9A 5GZ3A 1MC4A 4YQYA 4R3WA 2GDZA 1GYRA 1OZAA 3GDGA 4L0QA 1LC3A 1LSUA 3E9NA 4KUGA 4YJGB 1Y8RA 2PZKA 2Y05A 3SVTA 3ZWNA 4DPKA 4DWVA 5BT9A 3OF2A 3W1VA 3DZGA 4I1IA 3LLVA 4Z9YA 1I3LA 3FN4A 3K9QO 3U9LA 1X7DA 3LVFO 3ZU2A 1WDLA 2R6JA 4UVHA 4MO2A 4W7HA 4R9SA 1FJHA 1PZFA 3PIIA 4CM4B 5CDYA 2E4AA 2BFPA 1FXSA 4IDDA 1OOEA 3NUGA 1NYTA 3WS7A 1YOVB 1XG5A 1D7OA 2I67A 5CAEA 1NVMB 1PJTA 3DZJA 3ROMA 3EC7A 2Y1CA 1DIGA 3AUSA 2X0RA 3IIEA 1K2WA 3H2ZA 1XEAA 1HZZA 1P1HA 1Y8RB 4WLEA 2HK7A 4YAGA 3ZV5A 2ZTLA 2ZCVA 5IZCC 3P7MA 1U8XX 3EDMA 3H9GA 5EINA 5A1TA 3OA2A 4YRAA 1GV1A 1U9JA 4I5EA 2FR0A 5JCJA 4FB5A 3JQAB 3WQQA 4ZD6A 3AI3A 3C1OA 3HB4X 3BTVA 2ZATA 2ZIZA 4JNKA 1WPQA 2AQ8A 1HETA 3LF1A 3PWKA 3AUAA 4DIBA 1CJCA 2O23A 2VHWA 3IOYA 4R3NA 3DMTC 3VKUA 1YKFA 3GDFA 5BR7A 3EMKA 1VRWA 2AHRA 3FR8A 3DZKA 4WJZA 3L6DA 5FI3A 3EVNA 4YAIA 4UAGA 2IE0A 1E3WB 3GN1A 1B16A 1FDWA 3OFSA 5FWNA 2GZ3A 5FYDA 5KKAA 3INGA 4MIOA 2YV3A 3QVOA 1KEUA 1QYWA 2B69A 4O5OA 4PLWA 3SXPA 1HSOA 2XXBA 4EYEA 4J3FA 4UULA 3N7UA 1I24A 2D4AA 1PGJA 4XQEA 1ISMA 3QWFA 1E3LA 3RASA 4I9UA 4ZU3A 5ILGA 3WGIA 3ULKA 1E6EA 4OM8A 1PSDA 4UVDA 3VOSA 4DMMA 4MP3A 1KY5A 1KBZA 5JSFA 1GZ3A 2NU6A 3GFGA 5F1PA 1E1KA 4AICA 3NGLA 3I9KA 4BIIA 3ZWCA 2PNFA 3QWBA 4GLLA 5KTKA 4O6VA 1I2CA 2QZ9A 1WP4A 2HLPA 1DAPA 1GCOA 1DB3A 2ZK7A 3B1JA 5JLAA 3TJRA 1JU9A 2NSDA 4FN4A 3CTMA 1X7GA 5DBFA 3HDHA 5FEUA 4JN6B 1GPDG 4J90A 1TB4A 3NT4A 3H5NA 1BWSA 2BFOA 2C54A 3DHYA 4YJFA 2O3RA 1PQWA 3V5NA 1TA4A 4BKOA 1NQTA 2EKQA 3HHPA 1VL6A 4PVCA 1QYCA 3VC7A 3HDYA 4UUNA 1NHWA 3IJRA 2WJPA 4EDFA 2UV8A 1V0JA 3BHJA 3ST7A 5BNIA 1Q0LA 2W2LA 1YO6A 2D8AA 3JSAA 1VSUA 4E5MA 1EE9A 2RH8A 2NWQA 4XB2A 4EJ0A 1XU7A 2P4HX 2O3QA 3JYLA 1S7CA 1BTOA 1HDRA 1U3TA 5TQVA 1WDKA 3A9WA 3P2OA 4MINA 4W9NC 4HX5A 4BS9A 4D79A 3EGOA 3O8QA 4BV9A 4P4LA 1WLYA 1MC5A 1BXGB 3JQ9A 2ILTA 4R1UA 3GQVA 1YQDA 1R4MA 4B4VA 1H9BA 4U8GA 1T2FA 1ZZEA 3U5TA 2EJVA 1B3BA 3L07A 4IM7A 1YXMA 5HA5A 1XSEA 2JFGA 3CPSA 3ANNA 4OMUA 4QSMA 5AYVA 5CEEA 2B0JA 3E9QA 3QVTA 4GX5A 4INAA 2VYND 1GEEA 2DBVO 5T8KA 4EEXA 1YWGO 3QP9A 4KTVE 4AJ2A 1VKOA 2D59A 4L9RA 1K6IA 3KEOA 3SC6A 1H6AA 1P1IA 4B3HA 4P8RA 3FNGA 2EP5A 1EK5A 4HFJA 5L7TA 4HXYA 2B83A 4KDEA 1WWKA 4CMEC 3BAZA 3FSRA 3LDHA 1KVRA 1EVZA 4JXKA 1BXGA 4W7IA 1U2GA 3QWIA 4YJHA 2HU2A 3F46A 3WYBA 4Z9FA 3HUDA 2YUTA 1TI7A 4PRLA 3PJGA 4YJDA 3RUHA 5AXAA 1TT5B 3E6AA 1LI4A 2HMVA 1O0SA 5T6BA 3PK0A 4WPGA 5DT9A 1SOVA 2FZEA 4XGNA 3W8EA 4AG3A 2PA3A 1R15A 1G1AA 1ONPA 3CIFA 3U4DA 1AXEA 2VWQA 1YBMA 4WLUA 2C29D 2IXAA 4E5NA 1ENPA 3BMCA 4DLBA 3MJCA 2VZ9A 4NZ9A 5I7VA 1AHHA 3OJLA 3OH8A 1MLDA 1T4DA 4BO5A 5C3MA 5CDSA 5IDXA 1RM3A 1EDOA 2EXXA 2W98A 1G6KA 3FNFA 1DLIA 1H2BA 2RHRA 4CMJA 2R2GA 2AEMA 1U4SA 3D7LA 4XQCA 5DZSA 4EUHA 4AJPA 1BRMA 1TVEA 2CSUA 3ORFA 4PZDA 5ICSA 2D0IA 1B26A 3PYMA 1QKIA 5KVVA 3BA1A 5L3ZA 5EJ2A 2CDBA 3DZIA 4OKNA 2D5AA 1NPTO 3BMCB 4UVEA 1JDJA 4CLRB 4F45A 2RAFA 3UFXA 2PGJA 1HRDA 2O3JA 2O4UX 4B8WA 1ZSVA 3GPDG 5HM8A 3QSGA 3RUDA 4H15A 2CY0A 1NXQA 2ZYGA 1C0IA 4CV0A 1JW9B 2Q46A 4QFDA 1UAYA 4CMBA 5IF3A 4A03A 4L74A 4MP6A 4RDIA 2GN6A 4A73A 1UZLA 5KCZA 4ND2A 4OKIA 4H3VA 3JD4A 4DQUA 2PFGA 1UXIA 1VL8A 1PWXA 4D0RA 4IDEA 1A71A 3PQFA 1EVYA 3MJEA 3I23A 1H93A 1ZIDA 2OXIA 1X14A 4NK4A 1RM5A 1CIVA 1WVGA 3GOHA 1UZMA 3NEPX 1ULUA 2ZYDA 4XQGA 2CF6A 4N5NA 3VZRA 3K6JA 1LDMA 2G82A 3QWAA 1QXSA 3LT0A 3L6OO 2PD3A 4CV3A 1W4ZA 4MKRA 4O63O 5TJHA 1GZ4A 4RPJA 5G4KA 2Y66A 4Z0PA 3HN7A 1ISHA 3JYQA 2GGSA 2Z5LA 4R54A 3VH3A 4J91A 4CM8B 3AM3A 3A14A 1XU9A 5ICMA 1T1RA 4TRNA 3KYCB 1CDOA 5TS3A 3DAPA 3VDQA 4XCVA 3C85A 1Q7CA 3O38A 1DPGA 2CDCA 5CEJA 4C7KA 4PLPA 3PLRA 4CLOB 3D5QA 3TPCA 1EEHA 1HDGO 2HKIA 5JMPA 3UGKA 3IKTA 3WQSB 1IHXA 2D1YA 4L4RA 1IL0A 1ZK2A 4OXNA 3AM5A 4MVJD 5G4KB 2NVWA 3HJAA 4UUMA 4WUVA 3NRCA 5CPBA 4GX2A 1ZUD1 3DAFA 3TFOA 1GADO 5ILOA 2O7QA 4CM8A 1E1LA 3UVEA 2AE1A 4YACA 5JY1A 2WM3A 5A9TA 3KYCA 3WGYA 9LDBA 1J49A 1S6YA 2QYTA 2VWGA 4JROA 3I6QA 1M75A 4NG5A 3TSCA 2NACA 1O5IA 4BNUA 1EVIA 1B8VA 4Y6SA 4CLOA 1NWCA 3Q3CA 3RUIA 4CV2A 3PDUA 2AE2A 1SC6A 3LC2O 4NNJA 4E3ZA 1EE2A 5BSHA 4BO1A 5CDUA 3GF4A 1M67A 5KOIA 5L4LA 1JLLA 1A5ZA 2X6TA 3JYPA 1ZXLA 4J1TA 2NM0A 3ENKA 2WDZA 3G0OA 4KUHA 1YVEI 3INRA 5JAZA 2A94A 5CPFA 3KBOA 1B2LA 4PG8A 4LCJA 1ULSA 3QWHA 1LSSA 1SOWA 3SX2A 4U0KA 2Q99A 3E9MA 4A10A 3LU1A 5THQA 4CPDA 2VWHA 4N54A 2YJZA 4IUYA 4FJ1A 1K5HA 2DTEA 5A02A 3JQGA 5TGDA 4PGFA 1M66A 1OI7A 5T8KC 4CLDA 1LQUA 5L51A 3DC2A 4XKJA 1PJ3A 4NU5A 1I10A 3VTFA 4XA8A 1SCUA 5F5NA 4TRJA 1I2ZA 1E1NA 4DGSA 2O7SA 4M86A 4K1LA 4OOFA 3GVCA 3MOIA 1R6DA 2XXJA 5ER6A 3GA0A 4D42A 3S2IA 6LDHA 4HP8A 4NHEA 3JD2A 3H9EO 3KSZO 5A04A 4FR5A 4Q3BA 5IFLA 3VPFA 1U3VA 3SC4A 2TMGA 3SJUA 4IDGA 4O59O 1TLTA 2NTNA 3JQGB 5KJ6A 1EUDA 3RIHA 3AU8A 3OEYA 3K73O 4G65A 1HLPA 2FR1A 2J5KA 4Z3DA 1C1DB 3ZNNA 1JVBA 1UDAA 2DVMA 2P9CA 2X5OA 4BNFA 2EF1A 4MOWA 3GGOA 1DIBA 2JD2A 3JTMA 3OMLA 3BTOA 4GVXA 4NI5A 4D45A 3GH3A 3AUUA 3N74A 1QLHA 2AEJA 3GVXA 4W9NA 3Q11A 2VWPA 1DC4A 4XDYA 1XDWA 1NASA 3SEFA 3GEMA 2V6FA 1QYXA 4QO7A 4WOJA 4RDHA 4XIJA 1U8FO 4S3MA 1B8UA 4G81A 4R01A 2V7PA 4AJOA 1M2WA 3MTGA 4XYEA 4YTEA 4BMVA 3GAFA 1H6BA 1YH3A 4AJHA 3FWZA 4FS3A 3C1TA 1DXYA 1N9GA 1YRLA 7ADHA 1DAOA 4CM5A 1E7WA 2ZB4A 2BI7A 2V65A 1ZSYA 2VHZA 2VZ8A 2P9EA 4WCFC 3DB2A 3H3FA 4BVAA 1AN9A 4W82A 5TIIA 4MPDA 3JQBC 5JAIA 5GY7A 4KUEA 3GDOA 1ZK4A 4CM9D 3PQEA 3DBRA 3PLNA 4EITA 3OJFA 3PVZA 1O8CA 4YAKA 2BFAA 2PKQO 4BQPA 1Q1NA 4IQ0A 4CUJA 2E48A 1Q7GA 2CDAA 3DOOA 3Q2IA 1M76A 4TZKA 1BDMA 1HDCA 2X0NA 1N9GB 2VN8A 2Y99A 1Z82A 4CQMA 3HQ4O 1A27A 4HNHA 4BGUA 2WE7A 4XYLA 5COAA 1Y5MA 2H5LA 3D3WA 4ID9A 2HJSA 3V8BA 2PGLA 2DUUA 3VDRA 1T4BA 3H6KA 3PZBA 2B4TO 3JCZA 5K6AA 3TNLA 3TZHA 2C5EA 1XYGA 2ZKLA 1I5RA 4CMGA 1QV6A 4TVOA 4BB6A 4F46A 1XCBA 1R0KA 1L1FA 3ICPA 2WEKA 2EWMA 4PLFA 5U1PA 4BO9A 2JHGA 4HV4A 3D4OA 4IINA 1J0XO 4GGPA 1BG6A 2WWRA 2E37A 3WR5A 4AFNA 1EMDA 5EMHA 2WE8A 1A9YA 2WMDA 3INTA 5THKA 1C0KA 2EKLA 1DBVO 3D3WB 1BVRA 2CVOA 2FSSA 3W6ZA 4OXYA 4NFYA
chains in the Genus database with same CATH superfamily
4MRSA 3FDZB 2J3LA 3O9ZA 1Q6ZA 1Z5OA 1R4NB 1KZ1A 2G5PA 2O48X 3BCHA 2EU8A 4YUZA 5ITVA 2BDTA 1TQ8A 2HREA 1ADCA 1QPBA 3L0CA 3EEYA 2C7GA 2QW1A 4ZIRB 4JV5B 2VNKA 3O91A 3PHCA 5BP7A 1KJZA 4ZCQA 5JY6A 2UAGA 1Z6TA 3NH6A 3DAGA 3LY7A 4C08A 1D5CA 4UTXA 4XB1A 4PYKA 1UFOA 3I2YX 3I5XA 3KQKA 1X1TA 1Q0UA 2AQIA 3BC1A 3DXYA 4MDEA 4K88A 4BHTA 2Q6IA 5PNTA 1E6CA 3VPSA 3WG9A 2BYTA 2IJGX 1AMOA 5I9LA 2I76A 4ZAWA 1Z8DA 4JIGA 5IEJA 3F47A 2IHKA 2RBEA 4E30A 3GR6A 1KQNA 4EHNA 3U7QB 1Z4IA 3WYNA 2H7XA 2P9GA 1AGNA 1FMTA 1MGPA 4BFWA 1I32A 3FLBA 4GBGA 4WN3A 1VMKA 2PUCA 1SPXA 1MU0A 5EJ4A 5EC8A 2V7TA 3LWZA 2B5WA 2W0MA 4JMLA 4KLRA 5DCYA 2WK1A 3H4VA 1V43A 3EBPA 3OCXA 3UB3A 3OM0A 4DLNA 2C9DA 5C9ZA 3ZZNA 2COEA 5JCOA 2ASEA 1GQRA 4GMXA 3T3EA 1XA0A 2B78A 5K0FA 3BSFA 2ZUBA 5JT1A 1DFIA 1BQEA 1IQPA 1I01A 1P7YA 4JT4A 1HXHA 2E89A 3NUQA 1XPUA 2ST1A 3KO8A 3IURA 1QVZA 2YN0A 5DRTA 1W34A 2OP0A 3AHGA 3PJFA 4O8CA 3TVDA 4FONA 1WXQA 4GNKA 5IBPA 4X8LA 4EB0A 3T6KA 3UXMA 1KI8A 1XQYA 2WICA 2VPIA 1QG0A 4FW8A 1AK9A 4Q82A 4XDHA 2FMXA 1ESCA 3C16C 3DLIA 4MI9A 2ANBA 1FDUA 3GG9A 2BFMA 3IHWA 5JO9A 3VNQA 1M6YA 4YT4A 2HQOA 3CLRC 1NBMA 3F9IA 5C8YB 1XKQA 3KHTA 3G8CA 4MUFA 1FFHA 4HB3A 4W5NA 4CTMA 4BCCA 3OIFA 2I6UA 1VIMA 4LQ4A 1BWRA 2ZGVA 5F4ZA 2OCBA 1V4NA 1YCFA 4GVLA 4HRVA 4I66A 4P08A 4R2XA 2XJ4A 1MAVA 2GXSA 1FTYA 4JQYA 4NDNE 2I3BA 2R8PA 5EMMA 1JJAA 2RHHA 1BRTA 4FS8A 1I4OA 3MAJA 3KTFA 3H2KA 3O0TA 2VSQA 3DZCA 1ZXBA 4ZYVA 1GAXA 3U1BA 1QNFA 1AHIA 2JLRA 1E8MA 1P0MA 3G49A 2CT8A 3RW9A 4D9MA 4Q3EA 4PG6A 2HL6A 4UOQA 3S2GA 3A37A 2WAXA 4NIMA 5TX7A 3SYLA 4MH0R 1XJ0A 2X86A 1L7EA 4N76A 4CKBB 4BV3A 1ZFNA 3O4JA 1RABA 3THRA 2GXQA 1NV9A 2ODBA 2E6UX 3E35A 3RYIA 5LJIA 3VA7A 1DX4A 2WLTA 5LFAA 3TLMA 3M3HA 2A0KA 4TRRA 3B7PA 4QXOA 2R3SA 1EJ6A 4DMLA 3QNUA 4EVSA 4EJMA 4LXGA 3FFBA 3S55A 2H2DA 4MRMB 3H9UA 1E79A 1QQ5A 4GSYA 1DV2A 1VPVA 2X2EA 2GEUA 5HMLA 3ZN2A 1BJKA 2REQA 3CKLA 3FD8A 3W5BA 4H60A 1BVUA 3BERA 3CCFA 1HFKA 4JYPA 4ABYA 1JBQA 1N1EA 2ORIA 4PC2A 5CA1F 4IO0A 1E66A 4OGLA 1L4YA 1X3LA 2G9NA 4EZEA 4GYYA 1V7CA 2I3AA 3KLNA 3OJWA 4HYTA 1KZGB 3DEHA 3V42A 4KCGA 4OFZA 2G06A 4L4ZA 4LFCB 3ROPA 1P0CA 1L3CA 1UBFA 1YS4A 3HCOA 2D13A 1SB8A 2WJ3A 3KOWA 4GSKA 1GAEO 4F2WA 2HUNA 2OM6A 3SU8A 5ESXA 5K0SA 4AN4A 4WGFA 5FUQA 3U3DA 2D4HA 3Q2OA 2W2LD 4AS3A 3TAHA 4R83A 5SY9A 4C0WA 1GA4A 4KYUA 5AVVA 1V3TA 4G5YA 5C7OO 1SBNE 2MR5A 2ZRGA 3HP7A 4JD5A 1XA4A 2VEDA 2E5WA 3A25A 3AKCA 1X80A 3U7FB 3RC2A 2V7XA 5DB4A 2GYVA 5CH3A 4AX8A 4YV2A 4HLDA 5IAOA 3O2JA 3K1AB 4QUHA 3GGJA 4OIFA 1TZ2A 4BNVA 3KUUA 3ZW8A 4B8YA 3PHIA 2ZREA 4WFJA 4C9BA 1YZGA 3SVLA 4P3XA 5LB4A 5T4EA 1G19A 1NYQA 2VRNA 3V2GA 1G41A 1LRJA 2VCHA 3JR7A 5LWHA 3I8OA 3QW2A 1JI3A 3T7KA 5IDQA 1B73A 1IG3A 1II8A 1Q1EA 4UASA 2YFHA 2PD4A 3K0HA 1N6OA 2VQSA 4H7JA 3WYCA 3EA0A 1F2UB 1JEYB 3IULA 2EOAA 3LCJA 2QRPA 1C3VA 3ZV4A 1HE4A 3KJNA 3KZKA 4A5OA 2QYHA 4PIPA 5D7NA 3E5MA 2NAFA 3HWX1 3RSQA 3GNSA 4U00A 3VTKA 1RXSA 4F5EA 5CFRA 4AT1A 4IV8A 4N3GA 4YCBA 3K1AA 3KOOA 1IY9A 3SLKA 3T06B 1JDNA 3GWGA 3FMOB 2IYUA 5ALKA 4W5JA 1M34A 1RLJA 2D5IA 3HKCB 2GJKA 1N2GA 3I1YA 3WQRA 1ZOSA 4RJJA 4C7VA 3I9V6 4POOA 1GNPA 1TIPA 4KQWA 4CU5A 1Y89A 2N1BA 3HJBA 1GN9A 3UV6A 1H5QA 5JAQA 3BXGA 3ZH2A 5GONA 1P6UA 3X3HA 3ZE8A 1ODKA 1U8YA 3BVPA 4OATA 1RQLA 4MW9A 3GVHA 1XZCA 4Q03A 4MDHA 2J31A 3QPWA 4G0ZA 2BMEA 2VIIA 5CH5A 3ZJ5A 4AN0A 4BQIA 4Z4GA 2AB0A 3HK2A 2W6OA 3KPJA 4I5GA 4JC8A 1RYDA 2IZOA 2GDJA 2YR0A 5DW3A 3SJCA 2PIAA 1KSGA 3L02A 4G0UA 3V4OA 2AT1A 3RWBA 2HRCA 5CCEA 2BHNA 4QECA 1W52X 1TIBA 3O83A 4UCFA 2IW3A 3AFHA 3F3SA 3LHFA 5D86A 3UCFA 4BYMA 5KSPA 2PAAA 4B46A 2HH9A 2HU5A 3AR8A 2VDUE 3GC6A 4RL6A 2Y0BA 4UBIA 3BRSA 1WXDA 4F6RB 3BF8A 1G6Q1 3FRJA 4EYSA 2B7CA 2EFCB 3N1UA 2BCJQ 5FTMA 1L7VC 1P3DA 3F49S 1B00A 3Q15C 1FL9A 1RE0A 3GJTA 3NOVA 3HADA 3SE0A 4OB7A 4QPJC 4J2HA 2D0PB 1R0SA 5DH9A 2IUFA 5JFOA 3PNVA 2XVZA 1C0PA 1E9EA 2AR9A 2P6PA 3ISTA 3TE6A 3D3QA 3WSVA 4DBVO 3DO8A 4BJ3A 5JASA 1KS9A 2WYIA 5A7FA 5FWYB 1MJFA 4WSOA 5JSQA 4JLAA 1C41A 1PJRA 4IXTA 1ST3A 4NKRA 4WEOA 4ZKDA 3HZHA 1A2QA 2D7JA 2X0IA 1IEQA 2R48A 3EY4A 3T7IA 4RF4A 3UWDA 1OXXK 3OECA 3KT6A 3NC0C 4P34A 1KDPA 3ETEA 3K94A 3BXZA 2B5OA 1RAHA 3IJPA 4RETA 3SYMA 3U80A 1KJIA 1W30A 2NG1A 4CVNA 2PMCA 2EL7A 2Y8EA 4ILKA 3ED5A 5L7YA 3PP8A 4FFPA 4ISBA 1F1JA 4GZ3A 1YRWA 4LV5B 4MMYB 2C59A 4BFCA 3KHKA 1CCWA 1ZNWA 1A1VA 4Q9KA 4E5SA 1WNFA 2IYSA 4MNTA 4C2TA 1B1CA 1YRQA 4KNWA 3ZXSA 1L7OA 5I9NA 1N1MA 1SNYA 3LXXA 5HQ3A 4UM9B 5BQ5A 3B51X 3ZWWA 2C9YA 3E82A 2Q5HA 4MS3A 1EFTA 2IPLA 5TF4A 3VOTA 3SAJA 1NDHA 3LUDA 1LK7A 3DV0A 4P22A 5FWYA 1MNQA 2O5EA 4YMIA 5DNEA 2AF3C 5SZKB 3VZSA 4Y2RA 2N3ZA 4JOSA 2CL7X 3U6BA 3EYWA 3EG9B 2QMEA 3RBXA 4D0LB 3KQLA 2ZIXB 2VL7A 3VJRA 2H1FA 3HKDB 5ALTA 2YL2A 1ES9A 3Q7TA 2PEZA 5JVDF 1VZ2A 3DZBA 1AZSC 5LP6C 3R7LA 3NP9A 3E2MA 4E2XA 1F8UA 3EX7C 4X1IB 5KIAA 2FRVA 4IJMA 4TWAA 4YO7A 5KZMB 1PTKA 5JNUA 1EP1B 5AW5A 4XXHA 2IDJA 3T9EA 2BGGA 4OP3A 3L4BC 3X1YA 4BKPA 1V6CA 3OE7A 3FUUA 5BNZA 3ZZ0A 4W63A 4E11A 3T1TA 1OBFO 3ET5A 1ZW6A 1FQOA 4MS3B 4QOHA 4JXZA 2V98A 3TH5A 4AZ3B 1M1NB 5DX1A 1A5BB 5ER9A 1KJYA 4HO1X 2Z1NA 2XW6A 1OGYA 3G5UA 1I94B 1JAYA 4R2JA 4C0BA 4X44A 1HE5A 3TG8A 4ZZIA 2C4MA 5FFFA 1FEZA 3ONEA 1HTTA 3EG9A 3IAUA 4FXPA 3AFNA 1G55A 3FAKA 4LMBA 5A5EA 3HKDA 1MB9A 3A6ZA 3FCXA 4YCAA 3JATA 4XWKA 2I55A 1JH9A 1QCZA 5AWFC 1Y1QA 3AB7A 1G7CA 3BN3A 2VCYA 4X0EA 5CG1A 4CR6A 2OCDA 1YV9A 1E62A 4LDZA 2CHGA 4UVIA 4KPYA 3DT9A 5G3YA 3V6MA 5AK6A 5DCUA 1D04A 1SWWA 5EESA 1DC6A 1RLOA 5FNVF 4E5YA 1MAUA 2ZIEA 1LX6A 4BOYA 1X42A 3ZY3A 1IPEA 3OZSA 2RI0A 1N34B 2QVBA 2VQ3A 3TRFA 1KVQA 1M1NA 4J76A 2P4EA 5CVCA 3HFGA 3S1AA 2AOTB 3ABSB 4DNOA 1E3EA 5CJPA 2PWZA 3CVXA 1BC5A 1ZD8A 3CRRA 2PGDA 2FW1A 1JAIA 1Z38A 3ICCA 1AIPA 3A3OA 2OHIA 4LNUA 3GO4A 4Q7EA 3X2SA 1PJ4A 1U2DC 4CN8A 2A30A 2PJRA 3KZOA 1ESZA 1C7IA 2JFZA 3EIOA 4DADA 1LLUA 1N33B 3JATB 1J5PA 2O6HA 3D0OA 3P0JA 3UMCA 4DEXA 4LJ8A 2H4HA 2V0CA 2DBRA 1YGPA 1TK9A 3FHTA 1JNXX 2HQRA 4NESA 3GJRA 1ZX1A 3AI7A 4PCAA 4PX9A 4MUGA 2DQKA 4FHEA 1WSAA 1JALA 2QR2A 3NJ4A 3P5SA 3N53A 4FGZA 2Q3DA 4FIZA 2X9NA 1RI1A 5FLEX 2H08A 1WXFA 3PSHA 4V0SA 2FETA 4ASUA 2JGRA 1IBLB 2GEDA 4XIYA 4UOZA 4K46A 3OKCA 2JFVA 2OVBA 5BV2P 1VJ5A 2AOTA 2FLVA 3TFQA 3ABOB 1YZLA 3QVKA 3R8FA 5K3OA 4S35A 5HIAA 2GEJA 2A4MA 1X1RA 2JAXA 1N5KA 2CFCA 2Q1TA 1TMYA 1YR6A 4LNUB 3QFSA 1CRWG 5IT0A 2ZRLA 3D81A 1ABEA 2JFUA 3OICA 1YS1X 3ED1A 1MD9A 2AUMA 5DSZA 2Q50A 1KMCA 2PXXA 2YWRA 1PFKA 2GJSA 2WTNA 3PEVA 4L75A 4X3OA 5IVIA 3S81A 4RPHA 4ZQFA 4B6RA 1AE1A 1GPNA 2GBFA 4FHFA 3D8RA 4A8PA 3PI7A 5IHXA 5TVGA 2R6ZA 3TI9A 2F17A 1PHRA 4AJEA 3W6UA 2V0GA 4CIWA 2VK1A 5K8TA 4C3ZA 1QUEA 1OXSC 4ZMSA 3O3OB 1WAMA 3HDJA 5DNAA 3CSDA 3RHTA 4QFBA 5E1DA 4R5HA 2XZTA 5BN3A 3HXQA 1NRIA 4EYKA 4NQZA 3VR2D 1JMVA 3NTUA 3TLBA 2B2CA 4PYQA 1XZBA 2TSYB 4C29A 1NVTA 4P1ZA 4YDQA 1PZEA 2VRCA 3NQ41 4QIHA 3W2IA 4D02A 3NDJA 1FSSA 1Y5IA 3QKRB 3CNOA 2QM0A 3D3KA 5HF5A 3RS4A 1Q1ZA 2IOYA 3AUYA 3FKQA 3HSKA 3IUEA 3PRYA 4WOBA 3SG0A 4DSZA 4TKUA 4UFPA 3ONNA 1R5BA 5BSKA 3WGVA 1KEPA 1KQOA 1ZEJA 1K6EA 3FB1A 4DZTA 2ZJAA 4A15A 1XPOA 5JPIA 2VYCA 5KNDA 4HBZA 3L6RA 3QGMA 4OF4A 1XRJA 1YRHA 4FX5A 5K6RA 2LZ0A 3DFUA 2YRXA 3T7AA 3QUAA 1MEJA 5C4IA 3G2LA 1A9TA 1ZO8A 2ZJFA 2J33A 3TTUA 2QRKA 4WFQA 1EWRA 1A8QA 3F7OA 2ET6A 3F2IA 3N8IA 1E4OA 1AT1A 1WRBA 5ARDA 3GCZA 5AVUA 1XZAA 3PKIA 1XD9A 3IMKA 4W9RA 2CCJA 2E4UA 3KB2A 1RYEA 3GG2A 1EHIA 5BVGB 3CJTA 4U2GA 3GFBA 3LBYA 1IIBA 3QKRA 4I6GA 4P4SB 2O2GA 3QIAA 2A1TR 4M8KA 4CIXA 4YUAA 1H6DA 1IJEA 3I76A 4IIJA 4DR5B 3U3JA 4MHTA 2R9VA 4EI2A 2ZIVB 4JASB 3EZ6A 3HRKA 3KTOA 1CJKC 2GVNA 1QQAA 2DTDA 4IGEA 1XOIA 1G60A 4DNXA 5TLSA 4Q4DA 4E13A 3UF0A 3DV9A 4YDRA 4IDCA 4AULA 2GCIA 3FDFA 4G1BA 3A4MA 1C29B 2AG8A 4Q3AA 3V7WA 1HLGA 5E3IA 4X84A 3GPLA 4HLUC 4B43A 5AM2A 5K3FA 4EMSA 1YZYA 3LF2A 3ADKA 4C4RA 2ONZA 3BEDA 3I1IA 4UNIA 4RJTA 4ZJYA 3RRBA 1U1IA 1RTKA 4MQEB 3UJBA 3ZWVA 1RVV1 4FFDA 1JIVA 2BUBA 4A7PA 2OTCA 3ROFA 1T36A 1Y4ZA 3AUKA 3DL7A 3RAGA 1LBQA 3TOSA 5C35A 3HEMA 4P92A 1Z6XA 3KYDB 5LDGA 4YMHA 1IZ7A 4WLVA 4ZVVA 1Q14A 1C7EA 1OSNA 2F4VB 3NTXA 4AY6A 1UBRS 1OWLA 1Y6JA 4YRRA 4B34A 2B1GA 1KTVA 3T5GA 3HL4A 1G20E 4MKXA 4WZ6A 5B3LA 4IQGA 5AM1A 1AQIA 3AZPA 1P8AA 1PLLA 5CVVA 3LC7O 4MQ4A 2VG8A 1WQ1R 2F1KA 1XALA 3HWRA 2HD4A 3OZCA 4FFOA 1I5OA 4XD2A 2FOXA 1VPLA 1W76A 2DFVA 3FZGA 4S1NA 3FVTA 3VHRA 1JUDA 4C6HA 4QGSA 4KX3A 4GXRA 3H5AA 1Y9DA 1BXRB 2MINB 5U4QA 1NVBA 4AZWA 4BWYA 1U1CA 2WYWA 1CZNA 1HNWB 1XZGA 3E61A 4JDUA 5F98A 2JLVA 2W6JD 4LWQA 3PE4A 2QVLA 4CTJA 1GEGA 1KYYA 3S5UA 1VG0B 3IXLA 5D1NA 2C4HA 1ENOA 2YIDA 2KLBA 3KYDA 1J99A 1D4FA 4QHYA 3X1KA 1DOAA 1BHQ1 1JF8A 2ZT6A 1MJ5A 2R00A 1ZXXA 3MN1A 3AYXB 1QM5A 4YR7A 1VHDA 5JC8A 4MVJE 3REFA 2G0NA 4EG5A 2C5BA 4JA2A 1ZCBA 4S2UA 3LCCA 2CKDA 1U0TA 4TXHA 4BQQA 4BBJA 2JHAA 1U2ZA 2CFTA 2PRZA 1EUZA 4LIPD 1GZ6A 3P20A 4YRDA 5I7EA 2H2WA 1K4KA 2IEAA 3O3MB 4RADA 4J7CA 3IHTA 4V2IA 3GYBA 2JH9A 3K5PA 4RVGA 3TZ6A 1MUUA 1N3LA 2VT7A 2FCRA 3AEUB 3TW8A 3N6XA 1RI5A 4R4JA 3CR8A 1N7HA 1ARZA 3HM9A 2IYPA 5JHHB 1P2FA 1Z2CA 3LX6A 3DPUA 5F9HA 4X91A 3DHNA 1N2CA 4EKDA 1C30B 1L7DA 1PDWA 3OUUA 2NUTA 3GGPA 4AY2A 1MFPA 5BXYA 3TXAA 4WDQA 3C3PA 3RROA 4W8HA 1MRSA 1VFNA 4NYJR 3VC3A 1I36A 1ZW1A 4BBZA 1Y82A 2ZCJA 2O2ZA 1PWYE 3LC1O 1G9TA 4IUDS 1IDN1 4G23A 1E2DA 3DP9A 3NO4A 3RC1A 1JLHA 1YQTA 1M2VB 3F5QA 3GLGB 1VGRA 2AQKA 4NU8X 4AMBA 3NASA 3I9JA 2DKOA 2HJHA 5E1BA 5K0EA 2V6IA 1E89A 1Q19A 1JR3A 3JYNA 4FI3F 3HCDA 1S8OA 3TW8B 5J4VA 2DSNA 2F1OA 3H7IA 3BTUA 3KZVA 3UKJA 1A97A 4OHPA 4MWCA 1BS1A 1DHRA 4LCBA 2Z2IA 2DR2A 3JD0A 4UM5A 1N2CB 1SK8A 2Q2QA 1YDHA 1Z36A 2YRFA 4Z0HO 1CQJA 1J9EA 1XCOA 2HF2A 5BXQC 2IHNA 3OO1A 3BTSA 5LBUA 4DHEA 4XZ3A 1LW6E 5AKZA 5KYTA 1YMVA 3NWJA 3R5KA 3HBLA 4OIMA 2CB9A 1HV8A 3VYTB 1D07A 4MS1B 4B3JA 5A3JA 1EWTA 2B61A 1ZUHA 2V5VA 3BKWA 4DBLC 4YMUA 5TQ2B 3OTQA 3OZIA 4X7BA 5FJJA 4R16A 3DA8A 4IUBS 4I6JA 3BOSA 2PUAA 5CLGA 1DXHA 1AQLA 3DR3A 1GV0A 2H31A 1YJAA 1KI9A 2YWHA 1ATZA 5FA6A 1WU7A 3GA7A 2J3KA 1WTAA 1TF2A 2EKPA 3BK7A 3MJRA 3NHMA 4LGMA 2IH2A 5DF1A 4GYKA 2UKDA 4CODB 3DTYA 4FGUA 3O90A 4F4CA 5EXDA 1U7PA 2ZB7A 4KWHA 1J8QA 4DIFA 1CPYA 2IF2A 3H8WA 3HL0A 4QU8A 3QTLA 3PV0A 4KO4S 2A0UA 1ANKA 1CQJB 1D9ZA 5TQ0A 4X7MA 4GGMX 3O1HB 1RC1A 5DGTA 3RTDA 2HIHA 3CC8A 3QY9A 1P2BA 4WESB 4Q9NA 4EHJA 5AI8A 2I7TA 3U3RA 4L76A 4MS1A 3CXUA 1R9GA 1E7YA 1G5IA 1G291 4K86A 2VUIB 3EHDA 3HWSA 4B0OA 2PA0A 2ZZKA 2IOFA 3ZPXA 4LF4B 1XCMA 1ULHA 4IHQA 2MYTA 1DBPA 1PRYA 1PX0A 1A9QA 4M9QA 5LPNA 3KTDA 4C7MA 2DCUA 4DA9A 3EEBA 1CB0A 1NKTA 2Y68A 2NYAA 2ZYTX 1MB0A 3N2NA 3WLEA 2Y1FA 4ZI5A 2BJVA 3NGXA 4UXJA 3IAFA 5I01A 1MF7A 3Q6MA 5SZJA 2YJNA 4DC0A 2BOVA 4XVQA 1Z75A 3BE5A 1XDUA 3LV8A 2IL1A 4KWTA 2EG9A 3DPIA 3PXDA 1E3DA 2JFQA 3VUEA 1NR7A 3A1DA 3R0XA 4N7JA 4Q4HB 1H3NA 5TQ0B 1B3RA 1S2IA 2FEOA 4QQFA 3HA7A 4WESA 1JTVA 2GPTA 4JBNA 1NU6A 4LF8B 2OBNA 1S9HA 3D3JA 1RXUA 2ZRKA 5BQFA 2NZWA 4HAZA 4NAVA 3GFVA 4QA9A 5I9BA 1VHQA 4RO0A 3VR4H 4AUEA 1QFYA 3IVMA 4X00A 1RYHA 1U8TA 7ABPA 5LDDC 2H17A 1ML3A 1BEZA 1NUAA 1UR5A 4L22A 3RD5A 2FRDA 1F5SA 1ZOLA 2KHZA 1JFTA 2WSMA 4EUKA 3H1AA 4F9EA 3O4HA 3AGQA 4NATA 5EAIA 3A6GA 3ASUA 4IIHA 1D03A 1VHLA 1VLMA 4P81A 1UDRA 1SIOA 3CZRA 2PBZA 4FHDA 2IK8A 1W4BA 3B8HA 3QXXA 4GKBA 3RU7A 1SBYA 2NO4A 4V0KA 1UKZA 4OLAA 2PS1A 5LR6A 2ZRBA 3MGCA 3RIGA 1YB6A 1KARA 1T3LA 4DRXA 4JFRA 1SBIA 1YC5A 4GKKB 4GSLA 3VR6H 1JR2A 4IXMA 4HLNA 2G6BA 4ETNA 1AUPA 4KQCA 3LYLA 4ISCA 5LZ7A 1R6VA 3MGAA 3OCVA 3G23A 5IAAA 4C78A 5DNVA 4V3BA 3R5XA 2D54A 1V3VA 5HCNA 1P2DA 1WD5A 4RKWA 5IASA 3EUFA 4UBJA 4M9CA 1DCMA 2G36A 1KO4A 1K7YA 3GLRA 1QGAA 3LDFA 3Q40A 3RADC 1TO6A 2A5LA 3BF7A 2FWNA 1M1YE 1JKFA 2JGNA 1F2TB 2QMOA 3GV0A 3OHPA 4I5FA 5JDCC 5M7EA 3Q72A 4ECAA 2ZWMA 2FZWA 4XI9A 4GI7A 1FSFA 4XWWA 1EINA 1W5BA 2JD1A 1GQOA 4BGIA 4G41A 1KAOA 1S2DA 1YS9A 5ETJA 5EI5A 3TXYA 2AFHE 2GFQA 2BF7A 1EHCA 2J8ZA 2VTEA 1O77A 1H0RA 4BBPA 2JI7A 1BCRB 4IF4A 4PX2A 5GQSA 1U5BA 4A0GA 4B3RB 2IXFA 4PLYA 1GGMA 4OFXA 3K9FC 1M33A 4G97A 4BFVA 4BGDA 4NBLA 2Y76A 4NQRA 3T7SA 1U63A 2F1RA 4UUOA 1NPDA 3ZTYA 2QAGC 1OBHA 1QORA 2D2VA 1X1CA 1Z39A 4JUDX 5MDHA 5LQRA 2XF8A 3PL1A 4HB4A 3TE7A 1A9XB 1IPFA 1T5BA 2G7MC 2ISCA 3K15A 5FJIA 4REOA 1FBNA 1T25A 2Z9DA 1RM4A 3L79A 4K9PA 1GFZA 1TCCA 3FF1A 3PNSA 4Q6WA 4WIAA 1U04A 3AINA 5LLDA 2KBFA 3ZZUA 1PL6A 5EEHA 3SLGA 3ORQA 3HNOA 4IPTA 4GZ5A 3QENA 1VI2A 4YRBA 3TDMA 3PITA 5EJ5A 4WA7A 4A36A 3AT1A 2V96A 1PLKA 1CKEA 1FUUA 3CLVA 1LK5A 1SULA 1POXA 1BCRA 2AN1A 3F67A 1TJ5A 3KOXA 5BSMA 3TZCA 5LSAA 4KLNA 3IP8A 3F5MA 5HKAA 1XELA 1H6CA 3UY4A 3FPFA 4WAUA 5E4TA 4G01B 4M1YA 2GRUA 2H1IA 4YRSA 2I71A 4XR9A 1Z6ZA 1E7QA 1QQ6A 2O06A 2P9BA 3R7DA 2UYHA 2WHXA 4PCVA 4YS6A 1G21B 3DD1A 2Y1XA 3B7GA 3B6ZA 1LA2A 3GFQA 3U40A 1NJ6A 3V8EA 3OQBA 3RARA 1RQGA 2ZUEA 3G1WA 1EKXA 3AJ8A 1NFQA 3DWGA 5EE1A 4D9NA 1T9ZA 1SQ5A 3V3TA 3KKOA 2IYYA 4ON9A 1FIUA 4HS9A 1WBJB 3L1UA 4R0VA 1J2UA 3A1UA 3QITA 2OQVA 3ZNOA 1LXCA 1DXOA 3K70C 5TC4A 2HF8A 4CF6A 1IWPB 1QCCA 1UJMA 1SZPA 1UADA 1FFYA 1T9AA 1RYZA 4FMCB 2Q1SA 1T9KA 1U8CB 3KWMA 3ZE7A 5FQOA 2YHIA 4GUDA 2EDCA 3I9NA 2E87A 1GNTA 5EHGA 1JTFA 4RTOA 4RABA 1Q7BA 3DGEC 4MIYA 1GD1O 3UGTA 3IALA 1LI5A 4R2KA 3JTEA 1TD1A 1EFKA 5EIHA 2A1UB 1YUNA 1SXJD 2FN7A 2E9SA 4LPSA 5EHNA 4PTLA 3UKOA 4RD0A 2Z1MA 3AB3A 3K30A 2FZLA 4IEFB 1VBKA 2RCNA 2ZRJA 1DBWA 1MB3A 1TPYA 2OZLB 3V8PA 5KWVA 4KFCA 5HFJA 4ZVRA 1YE8A 1PF7E 1QVRA 1P17A 1JWBB 1RLTA 2BSXA 2BPOA 4LRSB 4S1VA 4XASA 4B6SA 4ZGGA 1C1YA 1IHYA 3BSYA 5LOVB 4QUKA 3T5TA 4ZRMA 1X74A 3OPMA 4N1AA 1FQWA 2V7BA 1USWA 2HTEA 3RS3A 1Y4UA 3KX2A 1ZN2A 1ZC3A 4EZBA 5A7HA 1KO1A 4I9HA 3JALA 2YBEA 2CMHA 2WJVA 4CETA 1T2DA 3JQ7A 3CNQS 3EK2A 1LSOA 4LYAA 1MC1A 2DPGA 1AV6A 1DEOA 1L0BA 3B3JA 1UKYA 3NTLA 2C84A 2BTQB 1LCIA 2IE8A 2VHQA 2YHIB 3HEAA 3RB8A 2A5FA 3DZDA 3S5JA 4LSMA 1ZN9A 1UEXC 4FDTA 4KK4A 5T5QA 2GPYA 1G5QA 4OXKA 2QSJA 4CUKA 4KWEA 4ZODA 2WMOB 1JZTA 2A1UA 3GCGA 1QP7A 1HQYE 1YZFA 1GZ5A 3Q1LA 3ZQ4A 3O2NA 2I29A 3H8VA 5FYQA 5BMVF 2CVQA 3ZHBA 1X1EA 3LZ6A 3E5HA 4FNOA 4NJMB 4UUPA 1NI5A 1ZITA 1R16A 4YJ3B 3DE5X 4MPRA 5LOVA 3AU9A 2KSQA 2CZCA 4N5IX 1CTQA 2QX7A 3HPQA 3DBIA 2AN3A 2OV6A 1U2RA 3R3WA 4BB9A 5JMWA 3EJWA 1QIEA 1TE2A 1D2RA 1MP0A 1S2GA 2QN7A 1F4LA 3HCEA 2UDPA 2H18A 4JBXA 3CUSA 4XUCA 5EZ6B 2NZJA 5CU7A 1KAQA 1ZN8A 2HRQA 3OLVA 3P27A 1EH5A 2XE6A 4L9SA 3V1YA 1U0GA 1YVRA 1T9GS 3MWJA 3CNLA 3PPYA 3A9SA 4GPEA 4IV5A 2Q9UA 2FMHA 3F5SA 4RS4A 5KTNA 5IYZF 5KX5F 1PJSA 1SU4A 2GF9A 2OZKA 1EFUA 4L0MA 4X8MA 4DMGA 3BSSA 2YDYA 1W9MA 2GZMA 3NHBA 2HCJB 5DTJA 3X1JA 3CH7A 1YVUA 2IV3A 4PQEA 1U2TA 1UQRA 5TPWA 2I6QA 2ISSD 1BNCA 1IYZA 1Z17A 2QD4A 2QTVB 3O4GA 4BNXA 4X65B 5CG2A 5IBQA 3W78A 4E4TA 5MGNA 3PDCA 2PAFA 4WERA 5CTJA 4DG8A 5REQB 3S1LA 3S27A 3DEJA 2OQIA 1V11B 3KQOA 5JANA 3ZH9B 1K1EA 2F3SA 3D64A 3HUEA 4YAEA 4Z1MA 2DQ4A 1DKLA 3LUAA 3QFRA 2P3QA 2X7XA 2I91A 2O3SA 1FVFA 4BU0A 3GUZA 2CV2A 2ZSUA 4Z9BA 3WA6A 2GNOA 2FPMA 1DXQA 1MGOA 3DF7A 1E5TA 1IY8A 2I8LA 3RVRA 1XZNA 2OXFA 4Z0TA 2ID7A 4BGVA 2CNWD 3HYTA 5CMLA 3V4FA 1VPDA 3AL2A 4OV6B 4BRWA 4G1EB 1XUOA 2NQTA 3OOSA 4ZMRA 2ZTMA 2GPWA 4MCIA 1D6MA 4QZVA 2I65A 4IIBA 2QTVA 2Y1WA 1F6BA 4J0HA 2P41A 3LQRA 4QQKA 1V39A 2QGNA 1Q83A 4NU0A 3EGEA 3TBFA 1DJOA 3L4SO 4YH1A 3T4PA 1KDTA 4XARA 1RBMA 1KETA 1RJWA 1KMQA 3RFFA 1WCWA 4B79A 1B8PA 5G4LA 3LS2A 3JZAA 2Q21A 4URYR 2WF7A 1R50A 4ZJZA 2OXTA 5L40A 4OJMX 4MW7A 4PC3A 1C80A 1NV8A 1EE1A 4MR7B 2IEGA 2D1FA 3HJUA 3RR2A 1XAJA 1AQYA 1O58A 3KWFA 4DTCA 3JAWA 6YASA 1S4MA 3RH0A 3CUEF 5KHAA 4MYTA 4HMPA 2J9XB 1XF9A 5ALXA 5K0BA 4QU5A 3PUYA 3PX3A 4BNMA 3UG7A 1OFIA 3KXLA 3UMFA 2GHQA 2DSTA 4RDXA 1FP4A 1QHGA 2GKOA 2XKAA 3HVJA 1C2YA 1T6ZA 1ZUNA 3RC9A 4P86A 4G07A 4EF4A 1MAWA 1PGNA 1F0YA 4KBFA 3TW0A 4HF7A 2W00A 4MEBA 2BI4A 2BL4A 4MIEA 3U7IA 2XMSA 4GM0A 1WY5A 4MK4A 5E0KB 1Z29A 3IE0A 2HGSA 3KEQA 4EG8A 2O1SA 3LDUA 1RRMA 5TMDA 5K20A 2HFKA 1HI9A 3K2BA 2AN9A 4YMWA 1BROA 1NMXA 2CHFA 4DUZB 2ZJ6A 3IP7A 4G0PA 4M0PA 5I7UA 4Q3DA 4LF7B 3B1XA 2XGSA 2GD2A 3D7RA 1E3QA 2BWJA 1YTLA 3SSOA 4J1SA 1DSSG 4JL6A 4BTLA 4LMPA 4MWTA 4ND8B 5CXSA 2A3NA 3LSYA 2IOFK 2ZT7A 1DIRA 1E1CA 1ESEA 2LGJA 1Q44A 2PLAA 3FMFA 2QL5A 4LBWA 3K8QA 4BDSA 1DADA 4PTZA 1WNTA 4RVUA 5A71A 1Q2UA 1UDBA 4QNMA 3ZHOA 3OHSX 1E0JA 1NNUA 1ZUNB 3MGGA 3MJHA 3OCYA 4CLEA 2C7QA 3I5MA 3ND7A 3IDQA 5EPEA 1BN7A 5CA0F 1UOOA 1SEVA 1WCXA 4NZOA 2Q2NA 4HNTA 4WE3A 3P0FA 1UP4A 1UT5A 4R2WA 4FWBA 2VHTA 4DC9A 1QFJA 1E9AA 3MCWA 1ODJA 4PR3A 3P9PA 4ALNA 4BP1A 1R00A 1J2RA 4UDOA 2C8KA 1WDTA 1YI0A 4R8VA 1E5QA 3ZW9A 2GHIA 3LGSA 1UM8A 5JG7A 4P83A 3GB9A 1N8SA 3DDNA 2XT6A 3NXKA 4MV5A 1FYDA 1UXGA 4FUTA 1DKQA 4YROA 5JXWA 5FI1B 3HP4A 2XHEA 5TT1A 2GTIA 4NLLA 4ND8A 5TJ9A 3TZQA 2NMVA 2O2IA 2XR1A 3BS4A 4HBGA 4KGZA 4BO7A 2HM7A 5J4YA 2VF5X 4WECA 1JDTA 1ZMOA 1AH2A 3T1NA 4O3FA 1G8SA 2VYVA 1W4CA 3KM0A 3TWOA 2HQBA 3FNEA 2CFOA 1JEOA 1BYUA 2NYRA 1CZKA 5GTDA 1CZLA 1YHYA 3OQMA 2ABWA 3CMCO 1B6TA 1FRNA 4NS4A 4NBTA 3KL2A 1XZFA 5U4XA 3FOZA 2CNLA 4LXXA 4EY7A 2WTMA 4OTZA 4TWIA 1OPRA 5FTKA 2PS9A 4CQMB 2W6ID 2VHYA 1NMEA 2H48A 2XNJA 1YUBA 4S1WA 3IP1A 3ZBPA 2XWBF 2EFEB 3NIBA 1P44A 4NYIR 3GEEA 3QLVC 5H68A 4CF5A 3LY8A 1WXHA 4JB0A 3OKPA 1FW8A 5ALIA 1XGKA 2P6NA 3L0OA 5FR2A 4DR3B 3EIHA 1SA0B 3RG8A 4L85A 3KQTA 3M9LA 3K0FA 2G9VA 5DXFA 3J81A 2J32A 3JWIA 2QMQA 4FBLA 5CEFA 4O4IA 1N1GA 3EEFA 2ZI5A 4NF2A 2YJ4A 5EQFA 1YR3A 2HJVA 3ZVKA 1T5SA 3K0SA 1GJRA 2ZUDA 3QTTA 4FCVA 4BNDB 4NEGA 4NDAA 5F9FA 4E5KA 3UZUA 3WB0A 3C8ZA 2GN9A 1R74A 3K9LA 5IC6A 4UBOA 1PI3A 3L1KA 2XUDA 2X76A 1L8LA 3FPGA 3WNQA 5KVCA 4M9UA 4D3XA 1JFFB 2G6TA 4M37A 3VH1A 4FDUA 1W36D 2OZPA 4U7JA 4ACBA 1KI3A 3GBVA 4L8LA 3AF6A 3UG6A 4QU9A 4QODA 4B3GA 4QREA 1Y33E 2WV9A 2WIFA 2XTJA 4V02A 4WY5A 4ZVUA 3ASVA 3HB7A 3RJTA 3OY7A 1P29A 2H2HA 5FHRA 2PMEA 2PE5A 4JLBA 4RY2A 2R1ZA 3KJXA 4RY0A 4CLHA 2ZI7A 3K0AB 4KREA 1PEYA 1ZR2A 3HO6A 1AK2A 3WLPA 1QFMA 3EWSA 3AM4A 3QQPA 3DAYA 4XW2A 2IXBA 3IPAA 2CDRA 1U9IA 1CR1A 3DMHA 4JP1A 1MO5A 3LJKA 3SDZA 2P27A 2ZETA 3KZMA 1MG0A 3GLHA 1ZVVA 2P77A 3I2GA 1GCAA 5DNDA 1I4LD 3H13A 5BQOA 3FWYA 4AU1A 1OU0A 1GCIA 2PSEA 3R7WB 2OHXA 1ZH8A 4ZCRA 1CYDA 3C3DA 5ALUA 3KKQA 3GRYA 2XUZA 4MQ6A 4F21A 2QRHA 1EHYA 2GKGA 3KSUA 3GAAA 4X1KB 3CBGA 1S3FA 4MRVA 5KI6A 4DLRA 1E5LA 5JI2E 1LTKA 4NAUA 4TOIA 5FTJA 3LTNC 4UEWA 3ZQUA 1CUYA 2BKUA 1XD2B 4F96A 1ISFA 1C0EA 4CDGA 3K0AA 4ZYXA 2DFDA 2Z09A 3SCZA 3M4YA 5AW2A 3LVBA 4Y8VA 2ZE6A 3U7QA 4B40A 1Z6GA 5H3HA 3M4XA 3OPNA 5BMVA 4PG4A 3TTXA 1DRUA 5CURA 3GLHB 1D1PA 4K9MA 2WYUA 1SKYB 2QR3A 4WZZA 2OLEA 3LQQA 4K6OA 3NS7A 3NC4A 4F8JA 3Q2KA 3CJRA 3R7WA 1C14A 3E70C 5AR1A 4ZC1A 3C8DA 2AZMA 4B4DA 2P7HA 1F12A 3DQQA 1VMIA 4IMJB 4G9GA 4KXMA 4LJ4A 4YC7A 2ZPAA 2IEDA 5EJMA 2UVQA 2VOEA 3GCDA 1Z4PX 4EELA 9ABPA 3SYTA 4HDKB 4Q4CA 4Z7NB 2EWWA 4QXAA 4RTNA 2JW5A 4YPOA 1V37A 3CA8A 5KWEA 3RRJA 1AQNA 1XFAA 1ZGZA 5EP4A 3UK1A 1R9MA 2J7KA 1L4EA 1L8AA 1CZOA 3N76A 1ADGA 3F6RA 3O31A 4TT3D 5HIIA 2G67A 4LYYA 3PRJA 4RTPA 1K9VF 4B73A 1RKBA 3D3EA 2W8BA 1ODIA 1G18A 3PKZA 1UBMS 1GL9B 3D59A 3OJOA 4JBGA 4OB6A 4PINA 3H1PA 5C8YA 3DT6A 4RGBA 1EWQA 1U7WA 2XWSA 4OLFA 2HSWA 2WW8A 4ZHQF 3AUJB 5DI9A 4DUPA 2CYCA 2XQIA 1R9NA 5AI5A 4HHEA 1ISJA 2OGSA 2P75A 3E23A 1DX6A 3RUEA 3PQ8A 3SJBA 2EZUA 4U7DA 1FNSA 3U4CA 4BUZA 1UWKA 1KI1A 1ADYA 1R5OA 2C9ZA 3GUHA 2IIQA 2JCGA 4X85A 4HDKA 3RKRA 1VJ1A 3LOUA 4MW4A 4E03A 4ZOQI 4MULA 2O20A 2GB4A 3NDPA 1BGWA 5HZGA 3RVDA 5L9AA 5T41A 4KIGA 2AA3A 5I47A 1DJNA 4B3CA 4JVNA 3A6PC 3VR3A 3A2KA