3B1QA

Structure of burkholderia thailandensis nucleoside kinase (bthnk) in complex with inosine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
310
structure length
303
Chain Sequence
ATLICGSIAYDNIMTFEGRFREHLINLSFLVPTMRREFGGCAGNIAYALNLLGGDARMMGTLGAVDAQPYLDRMDALGLSREYVRVLPDTYSAQAMITTDLDNNQITAFHPGAMMQSHVNHAGEAKDIKLAIVGPDGFQGMVQHTEELAQAGVPFIFDPGQGLPLFDGATLRRSIELATYIAVNDYEAKLVCDKTGWSEDEIASRVQALIITRGEHGATIRHRDGTEQIPAVRAERVIDPTGCGDAFRGGLLYGIEHGFDWATAGRLASLMGALKIAHQGPQTYAPTRAEIDARFETAFGYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Burkholderia thailandensis nucleoside kinase: implications for the catalytic mechanism and nucleoside selectivity
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
molecule keywords Ribokinase, putative
total genus 107
structure length 303
sequence length 310
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.143: Diphosphate-purine nucleoside kinase.
pdb deposition date 2011-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3b1qA00
3RS9A 3RO4A 2AA0A 3OTXA 3NM3A 2DDWA 3NBVA 1V1BA 3RSGA 3RTAA 4E8WA 3IE7A 4LC4A 1JXHA 3HYOA 5BYFA 1UB0A 1EKKA 2HQQA 2AFBA 2A9ZA 1EKQA 3BGKA 3EWMA 2AJPA 2I6AA 3BF5A 4LBXA 5B6AA 2NWHA 2VARA 5F0ZA 3MBJA 2PKMA 2C49A 3B1PA 3JULA 3RQQA 3RU2A 3RQ8A 3W4SA 4B8RA 4S1IB 1BX4A 4XF6A 2YXTA 1RFUA 4KBEA 1ESJA 2C4EA 3I3YA 3MBHA 3LJSA 3NCAA 3RQ2A 3RQHA 4K8CA 3RY7A 3LKIA 4DC3A 2RBCA 4E8YA 4XCKA 4YWRA 4UBEA 5C3ZA 1LHPA 3KTNA 3DRWA 5COJA 1LHRA 1UA4A 2V78A 5C40A 4K8KA 3RT7A 1RFTA 3HPDA 3UQ9A 3UQEA 4PVVA 5C3YA 5BYCA 1RK2A 1JXIA 3KZHA 4O1LA 4X8FA 3IN1A 2QCVA 4O1GA 3UMOA 5BYDA 2PKKA 1LIOA 3PL2A 4C5KA 4XF7A 4LBGA 2HLZA 1RKDA 3GBUA 4E8ZA 1LIIA 3RSQA 3B1RA 3NL3A 3UBOA 4N08A 4KANA 3VASA 4E69A 1YGJA 2JG5A 4JKUA 3RQXA 2ABQA 1WYEA 3RTCA 3KD6A 3RQ5A 1L2LA 3RTBA 3Q92A 3IH0A 3N1CA 5BYEA 1VK4A 3RSSA 3RSFA 2DDMA 3RPHA 3RM5A 4E84A 3KEUA 3NM1A 2PKFA 3DZVA 4K8PA 4WJMA 3H74A 4EBUA 2DDOA 3NBWA 3B1QA 4K93A 1V19A 2F7KA 2AWDA 3HICA 4KADA 1RKAA 4S1IA 5EY7A 4C5JA 1GQTA 3IKHA 2AB8A 2F02A 3B3LA 2I6BA 4JKSA 4S1HA 3RQ6A 3RREA 4EN4A 3NC9A 5CGEA 3B1OA 4EOHA 5CM5A 4KALA 3RRBA 4C5LA 3NL6A 1TZ3A 3GO6A 4K8TA 4KAHA 4DU5A 4XDAA 2AJRA 3GO7A 4EUMA 1V1AA 5F11A 2FV7A 3K5WA 3UMPA 3PZSA 4B8SA 1TYYA 3LOOA 4GM6A 4E3AA 4N09A 1VM7A 1KYHA 1LIJA 3RRJA 2JG1A 3RU3A 4JJPA 5TQIA 5C41A 5CGAA 2JGVA 3RTEA 2R3BA 3K9EA 1ESQA 4LCAA 3RPZA 3RTGA 3RTDA 2HW1A 4U7XA 2YXUA 3FHXA 3QAIA 4S1MA 1VI9A 3NC2A 4K9IA 1RFVA 4YL5A 3RS8A 1YHJA 3RT9A 1LIKA 3UQ6A 3CQDA 1C3QA 1DGMA 2QHPA 3FHYA 3VAQA 3NL2A 2A9YA 2AX3A 2XTBA 5EYNA 2I5BA 3LHXA 3Q1YA 3ZS7A 1RKSA 1U2XA 5TRWA 3QA2A 3H49A 1TD2A 2ABSA 2Q5RA 3NL5A 3UQDA 3B1NA 3IQ0A 1YGKA 1V1SA 2R3EA 2PKNA 3RRFA 4C5MA 3IBQA 1TZ6A 2DCNA 1GC5A 4C5NA 4K9CA
chains in the Genus database with same CATH superfamily
2VORA 2X5OA 3QCZA 3RO4A 2AA0A 2VOSA 3OTXA 3NM3A 3RS9A 2DDWA 3N2AA 3NBVA 1V1BA 3HJ6A 3RSGA 3RTAA 4E8WA 2Y68A 3IE7A 4LC4A 5A5EA 1JXHA 3HYOA 5BYFA 1UB0A 1EKKA 2HQQA 2AFBA 2A9ZA 1EKQA 3BGKA 3EWMA 2AJPA 2I6AA 3BF5A 4LBXA 5B6AA 2NWHA 2VARA 5F0ZA 3MBJA 2PKMA 2C49A 3B1PA 3JULA 3RQQA 3RU2A 3RQ8A 3W4SA 4B8RA 4S1IB 1BX4A 4XF6A 2YXTA 1RFUA 4KBEA 1ESJA 2C4EA 3I3YA 4CVKA 3MBHA 1EEHA 3LJSA 3NCAA 3RQ2A 4K8CA 3RQHA 3LKIA 3RY7A 2RBCA 4DC3A 4XCKA 4YWRA 1P31A 4UBEA 5C3ZA 1LHPA 2VTDA 3DRWA 3KTNA 2XPCA 5COJA 2WJPA 4QDIA 1LHRA 1UA4A 2V78A 2UUPA 5C40A 4K8KA 3RT7A 1RFTA 3HPDA 3UQ9A 3UQEA 1FGSA 4PVVA 2JFFA 4BUBA 5C3YA 5BYCA 4CVMA 1RK2A 1JXIA 2XJAA 3KZHA 4O1LA 4ZIYA 4X8FA 3IN1A 2QCVA 4O1GA 3UMOA 1GQYA 2PKKA 4C13A 5BYDA 1LIOA 3PL2A 4C5KA 4XF7A 4LBGA 2HLZA 1RKDA 1UAGA 3GBUA 4E8ZA 1LIIA 3RSQA 3B1RA 3NL3A 1W78A 3UBOA 1P3DA 4N08A 4KANA 3VASA 3ZM6A 1YGJA 2JG5A 4JKUA 3RQXA 3UAGA 4E69A 2ABQA 1WYEA 3RTCA 3KD6A 3RQ5A 1L2LA 2Y67A 3RTBA 3Q92A 3IH0A 3N1CA 5BYEA 4CVLA 1VK4A 3RSSA 3RSFA 2DDMA 3RPHA 3RM5A 4E84A 5A5FA 3KEUA 3NM1A 2PKFA 3DZVA 4K8PA 4WJMA 3EAGA 3H74A 4EBUA 2DDOA 3NBWA 3B1QA 4K93A 4QF5A 1V19A 3HN7A 2F7KA 2AWDA 3HICA 4KADA 1RKAA 4S1IA 4UAGA 5EY7A 4C5JA 1W7KA 2F00A 1GQTA 2GCAA 1GQQA 3IKHA 3ZL8A 3ZM5A 2AB8A 2F02A 3B3LA 2I6BA 4JKSA 4S1HA 2GCBA 3RQ6A 3RREA 3NC9A 4EN4A 5CGEA 3B1OA 4EOHA 5CM5A 4KALA 2AM2A 3RRBA 4C5LA 3NL6A 1TZ3A 3GO6A 4K8TA 4KAHA 4DU5A 4XDAA 2AJRA 3GO7A 4EUMA 1JBVA 1V1AA 4HV4A 5F11A 2FV7A 2GC6A 3K5WA 1GG4A 3PZSA 3UMPA 4B8SA 1TYYA 3LOOA 4GM6A 4E3AA 1JBWA 4N09A 1VM7A 1KYHA 1LIJA 2JFGA 2JG1A 2Y1OA 3RRJA 3RU3A 4JJPA 5TQIA 4E8YA 5C41A 5CGAA 2JGVA 4BUCA 3RTEA 2R3BA 3K9EA 2Y66A 2JFHA 2UUOA 1ESQA 4LCAA 3RPZA 1E0DA 3RTGA 2HW1A 3RTDA 4U7XA 1J6UA 2GC5A 2YXUA 3FHXA 3QAIA 4S1MA 1VI9A 3NC2A 4K9IA 1RFVA 4YL5A 2WTZA 1YHJA 3RS8A 3RT9A 1LIKA 4C12A 3UQ6A 3CQDA 1C3QA 1DGMA 2QHPA 3FHYA 3VAQA 3NL2A 2A9YA 2AX3A 2XTBA 3PYZA 5EYNA 2I5BA 3LHXA 3LK7A 3Q1YA 2UAGA 1E8CA 1RKSA 1U2XA 3ZS7A 2AM1A 5TRWA 3QA2A 1O5ZA 3H49A 1TD2A 2ABSA 2Q5RA 3NL5A 3UQDA 3B1NA 2VTEA 1YGKA 3IQ0A 1V1SA 2R3EA 2PKNA 3RRFA 4C5MA 3IBQA 1TZ6A 2DCNA 1GC5A 3NRSA 4C5NA 4K9CA
chains in the Genus database with same CATH topology
3RS9A 3RO4A 2AA0A 3OTXA 3NM3A 2DDWA 3NBVA 1V1BA 3HJ6A 3RSGA 3RTAA 4E8WA 3IE7A 4LC4A 1JXHA 3HYOA 5BYFA 1UB0A 1EKKA 2HQQA 2AFBA 2A9ZA 1EKQA 3BGKA 3EWMA 2AJPA 2I6AA 3BF5A 4LBXA 5B6AA 2NWHA 2VARA 5F0ZA 3MBJA 2PKMA 2C49A 3B1PA 3JULA 3RQQA 3RU2A 3RQ8A 3W4SA 4B8RA 4S1IB 1BX4A 4XF6A 2YXTA 1RFUA 4KBEA 1ESJA 2C4EA 3I3YA 3MBHA 3LJSA 3NCAA 3RQ2A 3RQHA 4K8CA 3RY7A 3LKIA 4DC3A 2RBCA 4E8YA 4XCKA 4YWRA 4UBEA 5C3ZA 1LHPA 3KTNA 3DRWA 5COJA 1LHRA 1UA4A 2V78A 5C40A 4K8KA 3RT7A 1RFTA 3HPDA 3UQ9A 3UQEA 4PVVA 5C3YA 5BYCA 1RK2A 1JXIA 3KZHA 4O1LA 4X8FA 3IN1A 2QCVA 4O1GA 3UMOA 5BYDA 2PKKA 1LIOA 3PL2A 4C5KA 4XF7A 4LBGA 2HLZA 1RKDA 3GBUA 4E8ZA 1LIIA 3RSQA 3B1RA 3NL3A 3UBOA 4N08A 4KANA 3VASA 4E69A 1YGJA 2JG5A 4JKUA 3RQXA 2ABQA 1WYEA 3RTCA 3KD6A 3RQ5A 1L2LA 3RTBA 3Q92A 3IH0A 3N1CA 5BYEA 1VK4A 3RSSA 3RSFA 2DDMA 3RPHA 3RM5A 4E84A 3KEUA 3NM1A 2PKFA 3DZVA 4K8PA 4WJMA 3H74A 4EBUA 2DDOA 3NBWA 3B1QA 4K93A 1V19A 2F7KA 2AWDA 3HICA 4KADA 1RKAA 4S1IA 5EY7A 4C5JA 1GQTA 3IKHA 2AB8A 2F02A 3B3LA 2I6BA 4JKSA 4S1HA 3RQ6A 3RREA 4EN4A 3NC9A 5CGEA 3B1OA 4EOHA 5CM5A 4KALA 3RRBA 4C5LA 3NL6A 1TZ3A 3GO6A 4K8TA 4KAHA 4DU5A 4XDAA 2AJRA 3GO7A 4EUMA 1V1AA 5F11A 2FV7A 3K5WA 3UMPA 3PZSA 4B8SA 1TYYA 3LOOA 4GM6A 4E3AA 4N09A 1VM7A 1KYHA 1LIJA 3RRJA 2JG1A 3RU3A 4JJPA 5TQIA 5C41A 5CGAA 2JGVA 3RTEA 2R3BA 3K9EA 1ESQA 4LCAA 3RPZA 3RTGA 3RTDA 2HW1A 4U7XA 2YXUA 3FHXA 3QAIA 4S1MA 1VI9A 3NC2A 4K9IA 1RFVA 4YL5A 3RS8A 1YHJA 3RT9A 1LIKA 3UQ6A 3CQDA 1C3QA 1DGMA 2QHPA 3FHYA 3VAQA 3NL2A 2A9YA 2AX3A 2XTBA 5EYNA 2I5BA 3LHXA 3Q1YA 3ZS7A 1RKSA 1U2XA 5TRWA 3QA2A 3H49A 1TD2A 2ABSA 2Q5RA 3NL5A 3UQDA 3B1NA 3IQ0A 1YGKA 1V1SA 2R3EA 2PKNA 3RRFA 4C5MA 3IBQA 1TZ6A 2DCNA 1GC5A 4C5NA 4K9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RS9 A;  3RO4 A;  2AA0 A;  3OTX A;  3NM3 A;  2DDW A;  3NBV A;  1V1B A;  3RSG A;  3RTA A;  4E8W A;  3IE7 A;  4LC4 A;  1JXH A;  3HYO A;  5BYF A;  1UB0 A;  1EKK A;  2HQQ A;  2AFB A;  2A9Z A;  1EKQ A;  3BGK A;  3EWM A;  2AJP A;  2I6A A;  3BF5 A;  4LBX A;  5B6A A;  2NWH A;  2VAR A;  5F0Z A;  3MBJ A;  2PKM A;  2C49 A;  3B1P A;  3JUL A;  3RQQ A;  3RU2 A;  3RQ8 A;  3W4S A;  4B8R A;  4S1I B;  1BX4 A;  4XF6 A;  2YXT A;  1RFU A;  4KBE A;  1ESJ A;  2C4E A;  3I3Y A;  3MBH A;  3LJS A;  3NCA A;  3RQ2 A;  3RQH A;  4K8C A;  3RY7 A;  3LKI A;  4DC3 A;  2RBC A;  4E8Y A;  4XCK A;  4YWR A;  4UBE A;  5C3Z A;  1LHP A;  3KTN A;  3DRW A;  5COJ A;  1LHR A;  1UA4 A;  2V78 A;  5C40 A;  4K8K A;  3RT7 A;  1RFT A;  3HPD A;  3UQ9 A;  3UQE A;  4PVV A;  5C3Y A;  5BYC A;  1RK2 A;  1JXI A;  3KZH A;  4O1L A;  4X8F A;  3IN1 A;  2QCV A;  4O1G A;  3UMO A;  5BYD A;  2PKK A;  1LIO A;  3PL2 A;  4C5K A;  4XF7 A;  4LBG A;  2HLZ A;  1RKD A;  3GBU A;  4E8Z A;  1LII A;  3RSQ A;  3B1R A;  3NL3 A;  3UBO A;  4N08 A;  4KAN A;  3VAS A;  4E69 A;  1YGJ A;  2JG5 A;  4JKU A;  3RQX A;  2ABQ A;  1WYE A;  3RTC A;  3KD6 A;  3RQ5 A;  1L2L A;  3RTB A;  3Q92 A;  3IH0 A;  3N1C A;  5BYE A;  1VK4 A;  3RSS A;  3RSF A;  2DDM A;  3RPH A;  3RM5 A;  4E84 A;  3KEU A;  3NM1 A;  2PKF A;  3DZV A;  4K8P A;  4WJM A;  3H74 A;  4EBU A;  2DDO A;  3NBW A;  3B1Q A;  4K93 A;  1V19 A;  2F7K A;  2AWD A;  3HIC A;  4KAD A;  1RKA A;  4S1I A;  5EY7 A;  4C5J A;  1GQT A;  3IKH A;  2AB8 A;  2F02 A;  3B3L A;  2I6B A;  4JKS A;  4S1H A;  3RQ6 A;  3RRE A;  4EN4 A;  3NC9 A;  5CGE A;  3B1O A;  4EOH A;  5CM5 A;  4KAL A;  3RRB A;  4C5L A;  3NL6 A;  1TZ3 A;  3GO6 A;  4K8T A;  4KAH A;  4DU5 A;  4XDA A;  2AJR A;  3GO7 A;  4EUM A;  1V1A A;  5F11 A;  2FV7 A;  3K5W A;  3UMP A;  3PZS A;  4B8S A;  1TYY A;  3LOO A;  4GM6 A;  4E3A A;  4N09 A;  1VM7 A;  1KYH A;  1LIJ A;  3RRJ A;  2JG1 A;  3RU3 A;  4JJP A;  5TQI A;  5C41 A;  5CGA A;  2JGV A;  3RTE A;  2R3B A;  3K9E A;  1ESQ A;  4LCA A;  3RPZ A;  3RTG A;  3RTD A;  2HW1 A;  4U7X A;  2YXU A;  3FHX A;  3QAI A;  4S1M A;  1VI9 A;  3NC2 A;  4K9I A;  1RFV A;  4YL5 A;  3RS8 A;  1YHJ A;  3RT9 A;  1LIK A;  3UQ6 A;  3CQD A;  1C3Q A;  1DGM A;  2QHP A;  3FHY A;  3VAQ A;  3NL2 A;  2A9Y A;  2AX3 A;  2XTB A;  5EYN A;  2I5B A;  3LHX A;  3Q1Y A;  3ZS7 A;  1RKS A;  1U2X A;  5TRW A;  3QA2 A;  3H49 A;  1TD2 A;  2ABS A;  2Q5R A;  3NL5 A;  3UQD A;  3B1N A;  3IQ0 A;  1YGK A;  1V1S A;  2R3E A;  2PKN A;  3RRF A;  4C5M A;  3IBQ A;  1TZ6 A;  2DCN A;  1GC5 A;  4C5N A;  4K9C A; 
#chains in the Genus database with same CATH topology
 2VOR A;  2X5O A;  3QCZ A;  3RO4 A;  2AA0 A;  2VOS A;  3OTX A;  3NM3 A;  3RS9 A;  2DDW A;  3N2A A;  3NBV A;  1V1B A;  3HJ6 A;  3RSG A;  3RTA A;  4E8W A;  2Y68 A;  3IE7 A;  4LC4 A;  5A5E A;  1JXH A;  3HYO A;  5BYF A;  1UB0 A;  1EKK A;  2HQQ A;  2AFB A;  2A9Z A;  1EKQ A;  3BGK A;  3EWM A;  2AJP A;  2I6A A;  3BF5 A;  4LBX A;  5B6A A;  2NWH A;  2VAR A;  5F0Z A;  3MBJ A;  2PKM A;  2C49 A;  3B1P A;  3JUL A;  3RQQ A;  3RU2 A;  3RQ8 A;  3W4S A;  4B8R A;  4S1I B;  1BX4 A;  4XF6 A;  2YXT A;  1RFU A;  4KBE A;  1ESJ A;  2C4E A;  3I3Y A;  4CVK A;  3MBH A;  1EEH A;  3LJS A;  3NCA A;  3RQ2 A;  4K8C A;  3RQH A;  3LKI A;  3RY7 A;  2RBC A;  4DC3 A;  4XCK A;  4YWR A;  1P31 A;  4UBE A;  5C3Z A;  1LHP A;  2VTD A;  3DRW A;  3KTN A;  2XPC A;  5COJ A;  2WJP A;  4QDI A;  1LHR A;  1UA4 A;  2V78 A;  2UUP A;  5C40 A;  4K8K A;  3RT7 A;  1RFT A;  3HPD A;  3UQ9 A;  3UQE A;  1FGS A;  4PVV A;  2JFF A;  4BUB A;  5C3Y A;  5BYC A;  4CVM A;  1RK2 A;  1JXI A;  2XJA A;  3KZH A;  4O1L A;  4ZIY A;  4X8F A;  3IN1 A;  2QCV A;  4O1G A;  3UMO A;  1GQY A;  2PKK A;  4C13 A;  5BYD A;  1LIO A;  3PL2 A;  4C5K A;  4XF7 A;  4LBG A;  2HLZ A;  1RKD A;  1UAG A;  3GBU A;  4E8Z A;  1LII A;  3RSQ A;  3B1R A;  3NL3 A;  1W78 A;  3UBO A;  1P3D A;  4N08 A;  4KAN A;  3VAS A;  3ZM6 A;  1YGJ A;  2JG5 A;  4JKU A;  3RQX A;  3UAG A;  4E69 A;  2ABQ A;  1WYE A;  3RTC A;  3KD6 A;  3RQ5 A;  1L2L A;  2Y67 A;  3RTB A;  3Q92 A;  3IH0 A;  3N1C A;  5BYE A;  4CVL A;  1VK4 A;  3RSS A;  3RSF A;  2DDM A;  3RPH A;  3RM5 A;  4E84 A;  5A5F A;  3KEU A;  3NM1 A;  2PKF A;  3DZV A;  4K8P A;  4WJM A;  3EAG A;  3H74 A;  4EBU A;  2DDO A;  3NBW A;  3B1Q A;  4K93 A;  4QF5 A;  1V19 A;  3HN7 A;  2F7K A;  2AWD A;  3HIC A;  4KAD A;  1RKA A;  4S1I A;  4UAG A;  5EY7 A;  4C5J A;  1W7K A;  2F00 A;  1GQT A;  2GCA A;  1GQQ A;  3IKH A;  3ZL8 A;  3ZM5 A;  2AB8 A;  2F02 A;  3B3L A;  2I6B A;  4JKS A;  4S1H A;  2GCB A;  3RQ6 A;  3RRE A;  3NC9 A;  4EN4 A;  5CGE A;  3B1O A;  4EOH A;  5CM5 A;  4KAL A;  2AM2 A;  3RRB A;  4C5L A;  3NL6 A;  1TZ3 A;  3GO6 A;  4K8T A;  4KAH A;  4DU5 A;  4XDA A;  2AJR A;  3GO7 A;  4EUM A;  1JBV A;  1V1A A;  4HV4 A;  5F11 A;  2FV7 A;  2GC6 A;  3K5W A;  1GG4 A;  3PZS A;  3UMP A;  4B8S A;  1TYY A;  3LOO A;  4GM6 A;  4E3A A;  1JBW A;  4N09 A;  1VM7 A;  1KYH A;  1LIJ A;  2JFG A;  2JG1 A;  2Y1O A;  3RRJ A;  3RU3 A;  4JJP A;  5TQI A;  4E8Y A;  5C41 A;  5CGA A;  2JGV A;  4BUC A;  3RTE A;  2R3B A;  3K9E A;  2Y66 A;  2JFH A;  2UUO A;  1ESQ A;  4LCA A;  3RPZ A;  1E0D A;  3RTG A;  2HW1 A;  3RTD A;  4U7X A;  1J6U A;  2GC5 A;  2YXU A;  3FHX A;  3QAI A;  4S1M A;  1VI9 A;  3NC2 A;  4K9I A;  1RFV A;  4YL5 A;  2WTZ A;  1YHJ A;  3RS8 A;  3RT9 A;  1LIK A;  4C12 A;  3UQ6 A;  3CQD A;  1C3Q A;  1DGM A;  2QHP A;  3FHY A;  3VAQ A;  3NL2 A;  2A9Y A;  2AX3 A;  2XTB A;  3PYZ A;  5EYN A;  2I5B A;  3LHX A;  3LK7 A;  3Q1Y A;  2UAG A;  1E8C A;  1RKS A;  1U2X A;  3ZS7 A;  2AM1 A;  5TRW A;  3QA2 A;  1O5Z A;  3H49 A;  1TD2 A;  2ABS A;  2Q5R A;  3NL5 A;  3UQD A;  3B1N A;  2VTE A;  1YGK A;  3IQ0 A;  1V1S A;  2R3E A;  2PKN A;  3RRF A;  4C5M A;  3IBQ A;  1TZ6 A;  2DCN A;  1GC5 A;  3NRS A;  4C5N A;  4K9C A; 
#chains in the Genus database with same CATH homology
 3RS9 A;  3RO4 A;  2AA0 A;  3OTX A;  3NM3 A;  2DDW A;  3NBV A;  1V1B A;  3HJ6 A;  3RSG A;  3RTA A;  4E8W A;  3IE7 A;  4LC4 A;  1JXH A;  3HYO A;  5BYF A;  1UB0 A;  1EKK A;  2HQQ A;  2AFB A;  2A9Z A;  1EKQ A;  3BGK A;  3EWM A;  2AJP A;  2I6A A;  3BF5 A;  4LBX A;  5B6A A;  2NWH A;  2VAR A;  5F0Z A;  3MBJ A;  2PKM A;  2C49 A;  3B1P A;  3JUL A;  3RQQ A;  3RU2 A;  3RQ8 A;  3W4S A;  4B8R A;  4S1I B;  1BX4 A;  4XF6 A;  2YXT A;  1RFU A;  4KBE A;  1ESJ A;  2C4E A;  3I3Y A;  3MBH A;  3LJS A;  3NCA A;  3RQ2 A;  3RQH A;  4K8C A;  3RY7 A;  3LKI A;  4DC3 A;  2RBC A;  4E8Y A;  4XCK A;  4YWR A;  4UBE A;  5C3Z A;  1LHP A;  3KTN A;  3DRW A;  5COJ A;  1LHR A;  1UA4 A;  2V78 A;  5C40 A;  4K8K A;  3RT7 A;  1RFT A;  3HPD A;  3UQ9 A;  3UQE A;  4PVV A;  5C3Y A;  5BYC A;  1RK2 A;  1JXI A;  3KZH A;  4O1L A;  4X8F A;  3IN1 A;  2QCV A;  4O1G A;  3UMO A;  5BYD A;  2PKK A;  1LIO A;  3PL2 A;  4C5K A;  4XF7 A;  4LBG A;  2HLZ A;  1RKD A;  3GBU A;  4E8Z A;  1LII A;  3RSQ A;  3B1R A;  3NL3 A;  3UBO A;  4N08 A;  4KAN A;  3VAS A;  4E69 A;  1YGJ A;  2JG5 A;  4JKU A;  3RQX A;  2ABQ A;  1WYE A;  3RTC A;  3KD6 A;  3RQ5 A;  1L2L A;  3RTB A;  3Q92 A;  3IH0 A;  3N1C A;  5BYE A;  1VK4 A;  3RSS A;  3RSF A;  2DDM A;  3RPH A;  3RM5 A;  4E84 A;  3KEU A;  3NM1 A;  2PKF A;  3DZV A;  4K8P A;  4WJM A;  3H74 A;  4EBU A;  2DDO A;  3NBW A;  3B1Q A;  4K93 A;  1V19 A;  2F7K A;  2AWD A;  3HIC A;  4KAD A;  1RKA A;  4S1I A;  5EY7 A;  4C5J A;  1GQT A;  3IKH A;  2AB8 A;  2F02 A;  3B3L A;  2I6B A;  4JKS A;  4S1H A;  3RQ6 A;  3RRE A;  4EN4 A;  3NC9 A;  5CGE A;  3B1O A;  4EOH A;  5CM5 A;  4KAL A;  3RRB A;  4C5L A;  3NL6 A;  1TZ3 A;  3GO6 A;  4K8T A;  4KAH A;  4DU5 A;  4XDA A;  2AJR A;  3GO7 A;  4EUM A;  1V1A A;  5F11 A;  2FV7 A;  3K5W A;  3UMP A;  3PZS A;  4B8S A;  1TYY A;  3LOO A;  4GM6 A;  4E3A A;  4N09 A;  1VM7 A;  1KYH A;  1LIJ A;  3RRJ A;  2JG1 A;  3RU3 A;  4JJP A;  5TQI A;  5C41 A;  5CGA A;  2JGV A;  3RTE A;  2R3B A;  3K9E A;  1ESQ A;  4LCA A;  3RPZ A;  3RTG A;  3RTD A;  2HW1 A;  4U7X A;  2YXU A;  3FHX A;  3QAI A;  4S1M A;  1VI9 A;  3NC2 A;  4K9I A;  1RFV A;  4YL5 A;  3RS8 A;  1YHJ A;  3RT9 A;  1LIK A;  3UQ6 A;  3CQD A;  1C3Q A;  1DGM A;  2QHP A;  3FHY A;  3VAQ A;  3NL2 A;  2A9Y A;  2AX3 A;  2XTB A;  5EYN A;  2I5B A;  3LHX A;  3Q1Y A;  3ZS7 A;  1RKS A;  1U2X A;  5TRW A;  3QA2 A;  3H49 A;  1TD2 A;  2ABS A;  2Q5R A;  3NL5 A;  3UQD A;  3B1N A;  3IQ0 A;  1YGK A;  1V1S A;  2R3E A;  2PKN A;  3RRF A;  4C5M A;  3IBQ A;  1TZ6 A;  2DCN A;  1GC5 A;  4C5N A;  4K9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...