3B1QA

Structure of burkholderia thailandensis nucleoside kinase (bthnk) in complex with inosine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
310
structure length
303
Chain Sequence
ATLICGSIAYDNIMTFEGRFREHLINLSFLVPTMRREFGGCAGNIAYALNLLGGDARMMGTLGAVDAQPYLDRMDALGLSREYVRVLPDTYSAQAMITTDLDNNQITAFHPGAMMQSHVNHAGEAKDIKLAIVGPDGFQGMVQHTEELAQAGVPFIFDPGQGLPLFDGATLRRSIELATYIAVNDYEAKLVCDKTGWSEDEIASRVQALIITRGEHGATIRHRDGTEQIPAVRAERVIDPTGCGDAFRGGLLYGIEHGFDWATAGRLASLMGALKIAHQGPQTYAPTRAEIDARFETAFGYRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Burkholderia thailandensis nucleoside kinase: implications for the catalytic mechanism and nucleoside selectivity
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
molecule keywords Ribokinase, putative
total genus 107
structure length 303
sequence length 310
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.143: Diphosphate-purine nucleoside kinase.
pdb deposition date 2011-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3b1qA00
3DRWA 4LBXA 2ABSA 5F11A 1RFUA 1V1BA 1C3QA 1RK2A 1L2LA 2YXTA 3B1RA 1V1AA 2JGVA 1YHJA 3LHXA 4S1MA 3RREA 5CGAA 2ABQA 1GC5A 5F0ZA 3HPDA 1TYYA 4UBEA 4O1GA 3UBOA 4KBEA 1ESQA 3LOOA 3I3YA 4WJMA 4LC4A 1VI9A 2C4EA 2V78A 4YL5A 3NC9A 5BYEA 3RY7A 4K9CA 3UMPA 3DZVA 2DCNA 3BGKA 4U7XA 1TZ3A 2F02A 2HW1A 4N08A 3H74A 4JKUA 1WYEA 3RO4A 3RTDA 2A9YA 2I6AA 1LIKA 3H49A 5CGEA 4N09A 4E84A 2HQQA 1LIIA 3KEUA 4GM6A 3RTBA 4DU5A 3KTNA 4EBUA 3PZSA 3NL6A 3LJSA 4K8KA 4K9IA 3RQHA 5BYDA 3KZHA 5COJA 3GBUA 4KAHA 5BYCA 2AB8A 4DC3A 1UB0A 3RQQA 4XF6A 1V1SA 2HLZA 3BF5A 1YGKA 3VASA 3RT9A 3N1CA 4YWRA 3RTEA 4C5MA 4B8SA 1JXHA 3RQXA 2NWHA 1TD2A 4E8ZA 4XDAA 3PL2A 2AFBA 4E3AA 2PKKA 4S1HA 5EY7A 5C41A 3RSSA 4E8WA 3NC2A 2DDWA 3B1NA 2A9ZA 3IH0A 3GO6A 4XF7A 3NL3A 2DDMA 4C5LA 4E69A 1JXIA 3RS8A 2PKNA 4KANA 1RFTA 2JG5A 4X8FA 1ESJA 3B1PA 1LIOA 2AJPA 3Q92A 3ZS7A 2R3EA 4K93A 4C5NA 5C3ZA 1GQTA 1LHPA 3FHXA 4KALA 3UQDA 3RU3A 3NBWA 3FHYA 4KADA 3RQ5A 2QCVA 2JG1A 3IBQA 3IN1A 3LKIA 3NL2A 3QAIA 3RTGA 3UMOA 4JKSA 4XCKA 3RSFA 2Q5RA 1UA4A 2AX3A 4C5KA 3Q1YA 3K9EA 3IKHA 4JJPA 3B1OA 3RQ6A 3UQEA 3RSGA 3RQ8A 3RTAA 2YXUA 3IQ0A 2AWDA 5BYFA 1V19A 1KYHA 3OTXA 1TZ6A 1DGMA 3JULA 2C49A 3KD6A 4S1IA 2I6BA 3NCAA 5TRWA 3RRJA 1LIJA 1RKSA 3CQDA 4LBGA 4O1LA 4B8RA 1VK4A 5B6AA 3RSQA 3B1QA 4C5JA 2RBCA 3MBJA 4E8YA 5C3YA 3W4SA 1EKQA 2AJRA 3RPHA 1RKDA 4K8CA 2VARA 3HICA 4EN4A 4K8PA 2F7KA 3EWMA 3GO7A 3UQ9A 3VAQA 1VM7A 1BX4A 2I5BA 3RQ2A 2QHPA 3RM5A 1LHRA 3QA2A 3RPZA 3RRFA 3RS9A 4EOHA 2AA0A 3K5WA 2FV7A 3NM1A 1RFVA 2DDOA 1YGJA 2R3BA 3B3LA 5C40A 4S1IB 3HYOA 4LCAA 3RRBA 4PVVA 2PKMA 3RU2A 3MBHA 5EYNA 1U2XA 2XTBA 3NM3A 5CM5A 4EUMA 4K8TA 2PKFA 3NBVA 1EKKA 5TQIA 3UQ6A 3NL5A 3IE7A 3RT7A 1RKAA 3RTCA
chains in the Genus database with same CATH superfamily
3DRWA 4LBXA 2ABSA 5F11A 1RFUA 1V1BA 1C3QA 1RK2A 1L2LA 2YXTA 3B1RA 1V1AA 2JGVA 1YHJA 3LHXA 4S1MA 3RREA 5CGAA 2ABQA 1GC5A 5F0ZA 3HPDA 1TYYA 4UBEA 4O1GA 3UBOA 2Y67A 4KBEA 1ESQA 2JFGA 3LOOA 3I3YA 2VORA 1W78A 4WJMA 4LC4A 1VI9A 2C4EA 2V78A 4YL5A 1P3DA 2VTEA 4CVMA 3NC9A 5BYEA 2JFHA 3RY7A 4K9CA 3UMPA 3DZVA 1JBVA 2DCNA 3BGKA 3UAGA 4EBUA 4HV4A 1GQYA 4U7XA 2GCBA 1TZ3A 2F02A 2HW1A 4N08A 3H74A 3N2AA 1WYEA 3PYZA 4JKUA 3RO4A 2A9YA 2I6AA 1LIKA 3H49A 5CGEA 2JFFA 4N09A 4E84A 2HQQA 1LIIA 3KEUA 4GM6A 2WJPA 3RTBA 3KTNA 4DU5A 3NL5A 3NL6A 3LJSA 3PZSA 4K8KA 4K9IA 3RQHA 3KZHA 5COJA 3GBUA 4KAHA 1GG4A 2F00A 2AB8A 4DC3A 1UB0A 5BYCA 3RQQA 4XF6A 1V1SA 2HLZA 3BF5A 1YGKA 3VASA 4BUCA 3RT9A 1P31A 3N1CA 4YWRA 3RTEA 4QDIA 1E8CA 4B8SA 1JXHA 3RQXA 2NWHA 4C5MA 1TD2A 4E8ZA 4XDAA 5A5EA 3PL2A 1UAGA 2AFBA 2AM2A 4E3AA 2PKKA 2GC5A 4S1HA 5EY7A 3RSSA 5C41A 4E8WA 3NC2A 2DDWA 3B1NA 2A9ZA 3IH0A 3GO6A 3HJ6A 4BUBA 4XF7A 3NL3A 2DDMA 4C5LA 3ZM6A 3LK7A 4E69A 1JXIA 2UUOA 3RS8A 2PKNA 4KANA 1RFTA 2JG5A 4X8FA 3ZL8A 1ESJA 4QF5A 3B1PA 1LIOA 2AJPA 3EAGA 3Q92A 3ZS7A 2R3EA 4K93A 4C5NA 5C3ZA 1GQTA 1LHPA 3FHXA 2Y68A 4KALA 2UAGA 5BYDA 3RU3A 3NBWA 3UQDA 3FHYA 4KADA 3RQ5A 1FGSA 2QCVA 2JG1A 3IBQA 3IN1A 3LKIA 3NL2A 3QAIA 3RTGA 3UMOA 4JKSA 4XCKA 3RSFA 2Q5RA 5A5FA 2GC6A 1J6UA 1UA4A 2AX3A 4C5KA 3Q1YA 3K9EA 3IKHA 4JJPA 3B1OA 3RQ6A 3UQEA 4UAGA 3RSGA 3RQ8A 1GQQA 3RTAA 2YXUA 3IQ0A 2AWDA 4CVLA 5BYFA 1V19A 1KYHA 3OTXA 1TZ6A 1O5ZA 1DGMA 3HN7A 1W7KA 2C49A 3JULA 3KD6A 3QCZA 4S1IA 2I6BA 3NCAA 5TRWA 2Y1OA 3RRJA 3NRSA 1LIJA 1RKSA 4C12A 3CQDA 4LBGA 4O1LA 4B8RA 1VK4A 4C13A 5B6AA 3RSQA 3B1QA 4C5JA 2RBCA 3MBJA 2VOSA 2UUPA 4E8YA 3RTDA 5C3YA 2XJAA 2VTDA 3W4SA 1EKQA 2AJRA 3RPHA 3ZM5A 1RKDA 2AM1A 4K8CA 2VARA 2X5OA 2GCAA 3HICA 4EN4A 4K8PA 2F7KA 3EWMA 3GO7A 3UQ9A 2Y66A 2WTZA 1VM7A 3VAQA 1BX4A 2I5BA 3RQ2A 2QHPA 3RM5A 1LHRA 3QA2A 4ZIYA 3RPZA 3RRFA 3RS9A 4EOHA 2AA0A 3K5WA 2FV7A 3NM1A 1RFVA 2DDOA 2XPCA 1YGJA 2R3BA 3B3LA 5C40A 4S1IB 3HYOA 4LCAA 3RRBA 4PVVA 2PKMA 1EEHA 3RU2A 3MBHA 5EYNA 1U2XA 2XTBA 3NM3A 5CM5A 4EUMA 4K8TA 1JBWA 2PKFA 3NBVA 1EKKA 5TQIA 3UQ6A 1E0DA 3IE7A 3RT7A 1RKAA 4CVKA 3RTCA
chains in the Genus database with same CATH topology
3DRWA 4LBXA 2ABSA 5F11A 1RFUA 1V1BA 1C3QA 1RK2A 1L2LA 2YXTA 3B1RA 1V1AA 2JGVA 1YHJA 3LHXA 4S1MA 3RREA 5CGAA 2ABQA 1GC5A 5F0ZA 3HPDA 1TYYA 4UBEA 4O1GA 3UBOA 4KBEA 1ESQA 3LOOA 3I3YA 4WJMA 4LC4A 1VI9A 2C4EA 2V78A 4YL5A 3NC9A 5BYEA 3RY7A 4K9CA 3UMPA 3DZVA 2DCNA 3BGKA 4U7XA 1TZ3A 2F02A 2HW1A 4N08A 3H74A 4JKUA 1WYEA 3RO4A 3RTDA 2A9YA 2I6AA 1LIKA 3H49A 5CGEA 4N09A 4E84A 2HQQA 1LIIA 3KEUA 4GM6A 3RTBA 4DU5A 3KTNA 4EBUA 3PZSA 3NL6A 3LJSA 4K8KA 4K9IA 3RQHA 5BYDA 3KZHA 5COJA 3GBUA 4KAHA 5BYCA 2AB8A 4DC3A 1UB0A 3RQQA 4XF6A 1V1SA 2HLZA 3BF5A 1YGKA 3VASA 3RT9A 3N1CA 4YWRA 3RTEA 4C5MA 4B8SA 1JXHA 3RQXA 2NWHA 1TD2A 4E8ZA 4XDAA 3PL2A 2AFBA 4E3AA 2PKKA 4S1HA 5EY7A 5C41A 3RSSA 4E8WA 3NC2A 2DDWA 3B1NA 2A9ZA 3IH0A 3GO6A 3HJ6A 4XF7A 3NL3A 2DDMA 4C5LA 4E69A 1JXIA 3RS8A 2PKNA 4KANA 1RFTA 2JG5A 4X8FA 1ESJA 3B1PA 1LIOA 2AJPA 3Q92A 3ZS7A 2R3EA 4K93A 4C5NA 5C3ZA 1GQTA 1LHPA 3FHXA 4KALA 3UQDA 3RU3A 3NBWA 3FHYA 4KADA 3RQ5A 2QCVA 2JG1A 3IBQA 3IN1A 3LKIA 3NL2A 3QAIA 3RTGA 3UMOA 4JKSA 4XCKA 3RSFA 2Q5RA 1UA4A 2AX3A 4C5KA 3Q1YA 3K9EA 3IKHA 4JJPA 3B1OA 3RQ6A 3UQEA 3RSGA 3RQ8A 3RTAA 2YXUA 3IQ0A 2AWDA 5BYFA 1V19A 1KYHA 3OTXA 1TZ6A 1DGMA 3JULA 2C49A 3KD6A 4S1IA 2I6BA 3NCAA 5TRWA 3RRJA 1LIJA 1RKSA 3CQDA 4LBGA 4O1LA 4B8RA 1VK4A 5B6AA 3RSQA 3B1QA 4C5JA 2RBCA 3MBJA 4E8YA 5C3YA 3W4SA 1EKQA 2AJRA 3RPHA 1RKDA 4K8CA 2VARA 3HICA 4EN4A 4K8PA 2F7KA 3EWMA 3GO7A 3UQ9A 3VAQA 1VM7A 1BX4A 2I5BA 3RQ2A 2QHPA 3RM5A 1LHRA 3QA2A 3RPZA 3RRFA 3RS9A 4EOHA 2AA0A 3K5WA 2FV7A 3NM1A 1RFVA 2DDOA 1YGJA 2R3BA 3B3LA 5C40A 4S1IB 3HYOA 4LCAA 3RRBA 4PVVA 2PKMA 3RU2A 3MBHA 5EYNA 1U2XA 2XTBA 3NM3A 5CM5A 4EUMA 4K8TA 2PKFA 3NBVA 1EKKA 5TQIA 3UQ6A 3NL5A 3IE7A 3RT7A 1RKAA 3RTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DRW A;  4LBX A;  2ABS A;  5F11 A;  1RFU A;  1V1B A;  1C3Q A;  1RK2 A;  1L2L A;  2YXT A;  3B1R A;  1V1A A;  2JGV A;  1YHJ A;  3LHX A;  4S1M A;  3RRE A;  5CGA A;  2ABQ A;  1GC5 A;  5F0Z A;  3HPD A;  1TYY A;  4UBE A;  4O1G A;  3UBO A;  4KBE A;  1ESQ A;  3LOO A;  3I3Y A;  4WJM A;  4LC4 A;  1VI9 A;  2C4E A;  2V78 A;  4YL5 A;  3NC9 A;  5BYE A;  3RY7 A;  4K9C A;  3UMP A;  3DZV A;  2DCN A;  3BGK A;  4U7X A;  1TZ3 A;  2F02 A;  2HW1 A;  4N08 A;  3H74 A;  4JKU A;  1WYE A;  3RO4 A;  3RTD A;  2A9Y A;  2I6A A;  1LIK A;  3H49 A;  5CGE A;  4N09 A;  4E84 A;  2HQQ A;  1LII A;  3KEU A;  4GM6 A;  3RTB A;  4DU5 A;  3KTN A;  4EBU A;  3PZS A;  3NL6 A;  3LJS A;  4K8K A;  4K9I A;  3RQH A;  5BYD A;  3KZH A;  5COJ A;  3GBU A;  4KAH A;  5BYC A;  2AB8 A;  4DC3 A;  1UB0 A;  3RQQ A;  4XF6 A;  1V1S A;  2HLZ A;  3BF5 A;  1YGK A;  3VAS A;  3RT9 A;  3N1C A;  4YWR A;  3RTE A;  4C5M A;  4B8S A;  1JXH A;  3RQX A;  2NWH A;  1TD2 A;  4E8Z A;  4XDA A;  3PL2 A;  2AFB A;  4E3A A;  2PKK A;  4S1H A;  5EY7 A;  5C41 A;  3RSS A;  4E8W A;  3NC2 A;  2DDW A;  3B1N A;  2A9Z A;  3IH0 A;  3GO6 A;  4XF7 A;  3NL3 A;  2DDM A;  4C5L A;  4E69 A;  1JXI A;  3RS8 A;  2PKN A;  4KAN A;  1RFT A;  2JG5 A;  4X8F A;  1ESJ A;  3B1P A;  1LIO A;  2AJP A;  3Q92 A;  3ZS7 A;  2R3E A;  4K93 A;  4C5N A;  5C3Z A;  1GQT A;  1LHP A;  3FHX A;  4KAL A;  3UQD A;  3RU3 A;  3NBW A;  3FHY A;  4KAD A;  3RQ5 A;  2QCV A;  2JG1 A;  3IBQ A;  3IN1 A;  3LKI A;  3NL2 A;  3QAI A;  3RTG A;  3UMO A;  4JKS A;  4XCK A;  3RSF A;  2Q5R A;  1UA4 A;  2AX3 A;  4C5K A;  3Q1Y A;  3K9E A;  3IKH A;  4JJP A;  3B1O A;  3RQ6 A;  3UQE A;  3RSG A;  3RQ8 A;  3RTA A;  2YXU A;  3IQ0 A;  2AWD A;  5BYF A;  1V19 A;  1KYH A;  3OTX A;  1TZ6 A;  1DGM A;  3JUL A;  2C49 A;  3KD6 A;  4S1I A;  2I6B A;  3NCA A;  5TRW A;  3RRJ A;  1LIJ A;  1RKS A;  3CQD A;  4LBG A;  4O1L A;  4B8R A;  1VK4 A;  5B6A A;  3RSQ A;  3B1Q A;  4C5J A;  2RBC A;  3MBJ A;  4E8Y A;  5C3Y A;  3W4S A;  1EKQ A;  2AJR A;  3RPH A;  1RKD A;  4K8C A;  2VAR A;  3HIC A;  4EN4 A;  4K8P A;  2F7K A;  3EWM A;  3GO7 A;  3UQ9 A;  3VAQ A;  1VM7 A;  1BX4 A;  2I5B A;  3RQ2 A;  2QHP A;  3RM5 A;  1LHR A;  3QA2 A;  3RPZ A;  3RRF A;  3RS9 A;  4EOH A;  2AA0 A;  3K5W A;  2FV7 A;  3NM1 A;  1RFV A;  2DDO A;  1YGJ A;  2R3B A;  3B3L A;  5C40 A;  4S1I B;  3HYO A;  4LCA A;  3RRB A;  4PVV A;  2PKM A;  3RU2 A;  3MBH A;  5EYN A;  1U2X A;  2XTB A;  3NM3 A;  5CM5 A;  4EUM A;  4K8T A;  2PKF A;  3NBV A;  1EKK A;  5TQI A;  3UQ6 A;  3NL5 A;  3IE7 A;  3RT7 A;  1RKA A;  3RTC A; 
#chains in the Genus database with same CATH topology
 3DRW A;  4LBX A;  2ABS A;  5F11 A;  1RFU A;  1V1B A;  1C3Q A;  1RK2 A;  1L2L A;  2YXT A;  3B1R A;  1V1A A;  2JGV A;  1YHJ A;  3LHX A;  4S1M A;  3RRE A;  5CGA A;  2ABQ A;  1GC5 A;  5F0Z A;  3HPD A;  1TYY A;  4UBE A;  4O1G A;  3UBO A;  2Y67 A;  4KBE A;  1ESQ A;  2JFG A;  3LOO A;  3I3Y A;  2VOR A;  1W78 A;  4WJM A;  4LC4 A;  1VI9 A;  2C4E A;  2V78 A;  4YL5 A;  1P3D A;  2VTE A;  4CVM A;  3NC9 A;  5BYE A;  2JFH A;  3RY7 A;  4K9C A;  3UMP A;  3DZV A;  1JBV A;  2DCN A;  3BGK A;  3UAG A;  4EBU A;  4HV4 A;  1GQY A;  4U7X A;  2GCB A;  1TZ3 A;  2F02 A;  2HW1 A;  4N08 A;  3H74 A;  3N2A A;  1WYE A;  3PYZ A;  4JKU A;  3RO4 A;  2A9Y A;  2I6A A;  1LIK A;  3H49 A;  5CGE A;  2JFF A;  4N09 A;  4E84 A;  2HQQ A;  1LII A;  3KEU A;  4GM6 A;  2WJP A;  3RTB A;  3KTN A;  4DU5 A;  3NL5 A;  3NL6 A;  3LJS A;  3PZS A;  4K8K A;  4K9I A;  3RQH A;  3KZH A;  5COJ A;  3GBU A;  4KAH A;  1GG4 A;  2F00 A;  2AB8 A;  4DC3 A;  1UB0 A;  5BYC A;  3RQQ A;  4XF6 A;  1V1S A;  2HLZ A;  3BF5 A;  1YGK A;  3VAS A;  4BUC A;  3RT9 A;  1P31 A;  3N1C A;  4YWR A;  3RTE A;  4QDI A;  1E8C A;  4B8S A;  1JXH A;  3RQX A;  2NWH A;  4C5M A;  1TD2 A;  4E8Z A;  4XDA A;  5A5E A;  3PL2 A;  1UAG A;  2AFB A;  2AM2 A;  4E3A A;  2PKK A;  2GC5 A;  4S1H A;  5EY7 A;  3RSS A;  5C41 A;  4E8W A;  3NC2 A;  2DDW A;  3B1N A;  2A9Z A;  3IH0 A;  3GO6 A;  3HJ6 A;  4BUB A;  4XF7 A;  3NL3 A;  2DDM A;  4C5L A;  3ZM6 A;  3LK7 A;  4E69 A;  1JXI A;  2UUO A;  3RS8 A;  2PKN A;  4KAN A;  1RFT A;  2JG5 A;  4X8F A;  3ZL8 A;  1ESJ A;  4QF5 A;  3B1P A;  1LIO A;  2AJP A;  3EAG A;  3Q92 A;  3ZS7 A;  2R3E A;  4K93 A;  4C5N A;  5C3Z A;  1GQT A;  1LHP A;  3FHX A;  2Y68 A;  4KAL A;  2UAG A;  5BYD A;  3RU3 A;  3NBW A;  3UQD A;  3FHY A;  4KAD A;  3RQ5 A;  1FGS A;  2QCV A;  2JG1 A;  3IBQ A;  3IN1 A;  3LKI A;  3NL2 A;  3QAI A;  3RTG A;  3UMO A;  4JKS A;  4XCK A;  3RSF A;  2Q5R A;  5A5F A;  2GC6 A;  1J6U A;  1UA4 A;  2AX3 A;  4C5K A;  3Q1Y A;  3K9E A;  3IKH A;  4JJP A;  3B1O A;  3RQ6 A;  3UQE A;  4UAG A;  3RSG A;  3RQ8 A;  1GQQ A;  3RTA A;  2YXU A;  3IQ0 A;  2AWD A;  4CVL A;  5BYF A;  1V19 A;  1KYH A;  3OTX A;  1TZ6 A;  1O5Z A;  1DGM A;  3HN7 A;  1W7K A;  2C49 A;  3JUL A;  3KD6 A;  3QCZ A;  4S1I A;  2I6B A;  3NCA A;  5TRW A;  2Y1O A;  3RRJ A;  3NRS A;  1LIJ A;  1RKS A;  4C12 A;  3CQD A;  4LBG A;  4O1L A;  4B8R A;  1VK4 A;  4C13 A;  5B6A A;  3RSQ A;  3B1Q A;  4C5J A;  2RBC A;  3MBJ A;  2VOS A;  2UUP A;  4E8Y A;  3RTD A;  5C3Y A;  2XJA A;  2VTD A;  3W4S A;  1EKQ A;  2AJR A;  3RPH A;  3ZM5 A;  1RKD A;  2AM1 A;  4K8C A;  2VAR A;  2X5O A;  2GCA A;  3HIC A;  4EN4 A;  4K8P A;  2F7K A;  3EWM A;  3GO7 A;  3UQ9 A;  2Y66 A;  2WTZ A;  1VM7 A;  3VAQ A;  1BX4 A;  2I5B A;  3RQ2 A;  2QHP A;  3RM5 A;  1LHR A;  3QA2 A;  4ZIY A;  3RPZ A;  3RRF A;  3RS9 A;  4EOH A;  2AA0 A;  3K5W A;  2FV7 A;  3NM1 A;  1RFV A;  2DDO A;  2XPC A;  1YGJ A;  2R3B A;  3B3L A;  5C40 A;  4S1I B;  3HYO A;  4LCA A;  3RRB A;  4PVV A;  2PKM A;  1EEH A;  3RU2 A;  3MBH A;  5EYN A;  1U2X A;  2XTB A;  3NM3 A;  5CM5 A;  4EUM A;  4K8T A;  1JBW A;  2PKF A;  3NBV A;  1EKK A;  5TQI A;  3UQ6 A;  1E0D A;  3IE7 A;  3RT7 A;  1RKA A;  4CVK A;  3RTC A; 
#chains in the Genus database with same CATH homology
 3DRW A;  4LBX A;  2ABS A;  5F11 A;  1RFU A;  1V1B A;  1C3Q A;  1RK2 A;  1L2L A;  2YXT A;  3B1R A;  1V1A A;  2JGV A;  1YHJ A;  3LHX A;  4S1M A;  3RRE A;  5CGA A;  2ABQ A;  1GC5 A;  5F0Z A;  3HPD A;  1TYY A;  4UBE A;  4O1G A;  3UBO A;  4KBE A;  1ESQ A;  3LOO A;  3I3Y A;  4WJM A;  4LC4 A;  1VI9 A;  2C4E A;  2V78 A;  4YL5 A;  3NC9 A;  5BYE A;  3RY7 A;  4K9C A;  3UMP A;  3DZV A;  2DCN A;  3BGK A;  4U7X A;  1TZ3 A;  2F02 A;  2HW1 A;  4N08 A;  3H74 A;  4JKU A;  1WYE A;  3RO4 A;  3RTD A;  2A9Y A;  2I6A A;  1LIK A;  3H49 A;  5CGE A;  4N09 A;  4E84 A;  2HQQ A;  1LII A;  3KEU A;  4GM6 A;  3RTB A;  4DU5 A;  3KTN A;  4EBU A;  3PZS A;  3NL6 A;  3LJS A;  4K8K A;  4K9I A;  3RQH A;  5BYD A;  3KZH A;  5COJ A;  3GBU A;  4KAH A;  5BYC A;  2AB8 A;  4DC3 A;  1UB0 A;  3RQQ A;  4XF6 A;  1V1S A;  2HLZ A;  3BF5 A;  1YGK A;  3VAS A;  3RT9 A;  3N1C A;  4YWR A;  3RTE A;  4C5M A;  4B8S A;  1JXH A;  3RQX A;  2NWH A;  1TD2 A;  4E8Z A;  4XDA A;  3PL2 A;  2AFB A;  4E3A A;  2PKK A;  4S1H A;  5EY7 A;  5C41 A;  3RSS A;  4E8W A;  3NC2 A;  2DDW A;  3B1N A;  2A9Z A;  3IH0 A;  3GO6 A;  3HJ6 A;  4XF7 A;  3NL3 A;  2DDM A;  4C5L A;  4E69 A;  1JXI A;  3RS8 A;  2PKN A;  4KAN A;  1RFT A;  2JG5 A;  4X8F A;  1ESJ A;  3B1P A;  1LIO A;  2AJP A;  3Q92 A;  3ZS7 A;  2R3E A;  4K93 A;  4C5N A;  5C3Z A;  1GQT A;  1LHP A;  3FHX A;  4KAL A;  3UQD A;  3RU3 A;  3NBW A;  3FHY A;  4KAD A;  3RQ5 A;  2QCV A;  2JG1 A;  3IBQ A;  3IN1 A;  3LKI A;  3NL2 A;  3QAI A;  3RTG A;  3UMO A;  4JKS A;  4XCK A;  3RSF A;  2Q5R A;  1UA4 A;  2AX3 A;  4C5K A;  3Q1Y A;  3K9E A;  3IKH A;  4JJP A;  3B1O A;  3RQ6 A;  3UQE A;  3RSG A;  3RQ8 A;  3RTA A;  2YXU A;  3IQ0 A;  2AWD A;  5BYF A;  1V19 A;  1KYH A;  3OTX A;  1TZ6 A;  1DGM A;  3JUL A;  2C49 A;  3KD6 A;  4S1I A;  2I6B A;  3NCA A;  5TRW A;  3RRJ A;  1LIJ A;  1RKS A;  3CQD A;  4LBG A;  4O1L A;  4B8R A;  1VK4 A;  5B6A A;  3RSQ A;  3B1Q A;  4C5J A;  2RBC A;  3MBJ A;  4E8Y A;  5C3Y A;  3W4S A;  1EKQ A;  2AJR A;  3RPH A;  1RKD A;  4K8C A;  2VAR A;  3HIC A;  4EN4 A;  4K8P A;  2F7K A;  3EWM A;  3GO7 A;  3UQ9 A;  3VAQ A;  1VM7 A;  1BX4 A;  2I5B A;  3RQ2 A;  2QHP A;  3RM5 A;  1LHR A;  3QA2 A;  3RPZ A;  3RRF A;  3RS9 A;  4EOH A;  2AA0 A;  3K5W A;  2FV7 A;  3NM1 A;  1RFV A;  2DDO A;  1YGJ A;  2R3B A;  3B3L A;  5C40 A;  4S1I B;  3HYO A;  4LCA A;  3RRB A;  4PVV A;  2PKM A;  3RU2 A;  3MBH A;  5EYN A;  1U2X A;  2XTB A;  3NM3 A;  5CM5 A;  4EUM A;  4K8T A;  2PKF A;  3NBV A;  1EKK A;  5TQI A;  3UQ6 A;  3NL5 A;  3IE7 A;  3RT7 A;  1RKA A;  3RTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...