3B30A

Crystal structure of f. graminearum tri101 complexed with ethyl coenzyme a
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
451
structure length
446
Chain Sequence
MAFKIQLDTLGQLPGLLSIYTQISLLYPVSDSSQYPTIVSTFEQGLKRFSEAVPWVAGQVKAEGISEGNTGTSFIVPFEDVPRVVVKDLRDDPSAPTIEGMRKAGYPMAMFDENIIAPRKTLPIGPGTGPDDPKPVILLQLNFIKGGLILTVNGQHGAMDMVGQDAVIRLLSKACRNDPFTEEEMTAMNLDRKTIVPYLENYTIGPEVDHQIVKADVAGGDVSASWAFFTFSPKAMSELKDAATKTLDASTKFVSTDDALSAFIWKSASRVRLERIDGSAPTEFCRAVDARPAMGVSNNYPGLLQNMTYHNSTIGEIANESLGATASRLRSELDPASMRQRTRGLATYLHNNPDKSNVSLTADADPSTSVMLSSWAKVGLWDYDFGLGLGKPETVRRPIFEPVESLMYFMPKKPDGEFCAALSLRDEDMDRLKADKEWTKYAQYVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trichothecene 3-O-acetyltransferase
publication title Structural and Functional Characterization of the TRI101 Trichothecene 3-O-Acetyltransferase from Fusarium sporotrichioides and Fusarium graminearum: KINETIC INSIGHTS TO COMBATING FUSARIUM HEAD BLIGHT
pubmed doi rcsb
source organism Gibberella zeae
molecule tags Transferase
total genus 160
structure length 446
sequence length 451
ec nomenclature
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 3b30A01
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 3b30A02
2XHGA 2XR7A 4G2MA 4JN3A 1L5AA 5T3EA 4CLAA 1XMDA 2IHWA 1SCZA 3FP0A 2E1VA 2II5A 1PD5A 2CLAA 4G0BA 4KECA 4N72A 1DPCA 4JN5A 3B30A 1DPDA 1EADA 3U9FA 1XL7A 2RKTA 2E1TA 2JGPA 3B2SA 2RKVA 2II4A 4KE4A 1EAAA 1DPBA 2E1UA 1Q9JA 4HVMA 2I9DA 5FANA 1CIAA 1EABA 1Q23A 2BGHA 2ZBAA 5KJTA 5DUAA 5KJVA 2VSQA 3MAEA 1EACA 5KJSA 1XMCA 1CLAA 3CLAA 1XL8A 5DU9A 4G22A 1EAFA 1C4TA 3U9BA 3FOTA 2II3A 1EAEA 5FALA 5KJWA 1E2OA 5KJUA 1NOCB 1QCAA 3L60A
chains in the Genus database with same CATH superfamily
1SCZA 2E1VA 2FW3A 2CLAA 4JN5A 2E1TA 2JGPA 3B2SA 4KE4A 1EAAA 1DPBA 5KJTA 5KJVA 1EACA 1CLAA 3CLAA 1XL8A 4G22A 1C4TA 5FALA 1E2OA 2FY2A 1QCAA 4G2MA 4CLAA 5T3EA 1XMDA 2IHWA 2RCUA 1NM8A 3FP0A 1EADA 2H3PA 1T1UA 1XL7A 2RKTA 1Q6XA 1EABA 1NDBA 5KJSA 3MAEA 1NDIA 2H4TA 3FOTA 5KJUA 3L60A 2XHGA 4JN3A 4EPHA 1PD5A 4G0BA 1DPCA 3U9FA 2RKVA 2H3UA 2E1UA 1Q9JA 4HVMA 2I9DA 2FY5A 5FANA 1CIAA 1Q23A 2BGHA 2ZBAA 1NDFA 5DUAA 2VSQA 1XMCA 1S5OA 2FYOA 1EAFA 2II3A 5KJWA 1NOCB 2XR7A 1L5AA 2II5A 4KECA 4N72A 4EP9A 4EYWA 3B30A 1DPDA 1T7OA 2II4A 2FY4A 2H3WA 2FY3A 5DU9A 2DEBA 3U9BA 1EAEA 1T7QA 1T7NA
chains in the Genus database with same CATH topology
2XHGA 2XR7A 4G2MA 4JN3A 1L5AA 5T3EA 4CLAA 1XMDA 2IHWA 1SCZA 3FP0A 2E1VA 2II5A 1PD5A 2CLAA 4G0BA 4KECA 4N72A 1DPCA 4JN5A 3B30A 1DPDA 1EADA 3U9FA 1XL7A 2RKTA 2E1TA 2JGPA 3B2SA 2RKVA 2II4A 4KE4A 1EAAA 1DPBA 2E1UA 1Q9JA 4HVMA 2I9DA 5FANA 1CIAA 1EABA 1Q23A 2BGHA 2ZBAA 5KJTA 5DUAA 5KJVA 2VSQA 3MAEA 1EACA 5KJSA 1XMCA 1CLAA 3CLAA 1XL8A 5DU9A 4G22A 1EAFA 1C4TA 3U9BA 3FOTA 2II3A 1EAEA 5FALA 5KJWA 1E2OA 5KJUA 1NOCB 1QCAA 3L60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XHG A;  2XR7 A;  4G2M A;  4JN3 A;  1L5A A;  5T3E A;  4CLA A;  1XMD A;  2IHW A;  1SCZ A;  3FP0 A;  2E1V A;  2II5 A;  1PD5 A;  2CLA A;  4G0B A;  4KEC A;  4N72 A;  1DPC A;  4JN5 A;  3B30 A;  1DPD A;  1EAD A;  3U9F A;  1XL7 A;  2RKT A;  2E1T A;  2JGP A;  3B2S A;  2RKV A;  2II4 A;  4KE4 A;  1EAA A;  1DPB A;  2E1U A;  1Q9J A;  4HVM A;  2I9D A;  5FAN A;  1CIA A;  1EAB A;  1Q23 A;  2BGH A;  2ZBA A;  5KJT A;  5DUA A;  5KJV A;  2VSQ A;  3MAE A;  1EAC A;  5KJS A;  1XMC A;  1CLA A;  3CLA A;  1XL8 A;  5DU9 A;  4G22 A;  1EAF A;  1C4T A;  3U9B A;  3FOT A;  2II3 A;  1EAE A;  5FAL A;  5KJW A;  1E2O A;  5KJU A;  1NOC B;  1QCA A;  3L60 A; 
#chains in the Genus database with same CATH topology
 1SCZ A;  2E1V A;  2FW3 A;  2CLA A;  4JN5 A;  2E1T A;  2JGP A;  3B2S A;  4KE4 A;  1EAA A;  1DPB A;  5KJT A;  5KJV A;  1EAC A;  1CLA A;  3CLA A;  1XL8 A;  4G22 A;  1C4T A;  5FAL A;  1E2O A;  2FY2 A;  1QCA A;  4G2M A;  4CLA A;  5T3E A;  1XMD A;  2IHW A;  2RCU A;  1NM8 A;  3FP0 A;  1EAD A;  2H3P A;  1T1U A;  1XL7 A;  2RKT A;  1Q6X A;  1EAB A;  1NDB A;  5KJS A;  3MAE A;  1NDI A;  2H4T A;  3FOT A;  5KJU A;  3L60 A;  2XHG A;  4JN3 A;  4EPH A;  1PD5 A;  4G0B A;  1DPC A;  3U9F A;  2RKV A;  2H3U A;  2E1U A;  1Q9J A;  4HVM A;  2I9D A;  2FY5 A;  5FAN A;  1CIA A;  1Q23 A;  2BGH A;  2ZBA A;  1NDF A;  5DUA A;  2VSQ A;  1XMC A;  1S5O A;  2FYO A;  1EAF A;  2II3 A;  5KJW A;  1NOC B;  2XR7 A;  1L5A A;  2II5 A;  4KEC A;  4N72 A;  4EP9 A;  4EYW A;  3B30 A;  1DPD A;  1T7O A;  2II4 A;  2FY4 A;  2H3W A;  2FY3 A;  5DU9 A;  2DEB A;  3U9B A;  1EAE A;  1T7Q A;  1T7N A; 
#chains in the Genus database with same CATH homology
 2XHG A;  2XR7 A;  4G2M A;  4JN3 A;  1L5A A;  5T3E A;  4CLA A;  1XMD A;  2IHW A;  1SCZ A;  3FP0 A;  2E1V A;  2II5 A;  1PD5 A;  2CLA A;  4G0B A;  4KEC A;  4N72 A;  1DPC A;  4JN5 A;  3B30 A;  1DPD A;  1EAD A;  3U9F A;  1XL7 A;  2RKT A;  2E1T A;  2JGP A;  3B2S A;  2RKV A;  2II4 A;  4KE4 A;  1EAA A;  1DPB A;  2E1U A;  1Q9J A;  4HVM A;  2I9D A;  5FAN A;  1CIA A;  1EAB A;  1Q23 A;  2BGH A;  2ZBA A;  5KJT A;  5DUA A;  5KJV A;  2VSQ A;  3MAE A;  1EAC A;  5KJS A;  1XMC A;  1CLA A;  3CLA A;  1XL8 A;  5DU9 A;  4G22 A;  1EAF A;  1C4T A;  3U9B A;  3FOT A;  2II3 A;  1EAE A;  5FAL A;  5KJW A;  1E2O A;  5KJU A;  1NOC B;  1QCA A;  3L60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...