3B30A

Crystal structure of f. graminearum tri101 complexed with ethyl coenzyme a
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
451
structure length
446
Chain Sequence
b'MAFKIQLDTLGQLPGLLSIYTQISLLYPVSDSSQYPTIVSTFEQGLKRFSEAVPWVAGQVKAEGISEGNTGTSFIVPFEDVPRVVVKDLRDDPSAPTIEGMRKAGYPMAMFDENIIAPRKTLPIGPGTGPDDPKPVILLQLNFIKGGLILTVNGQHGAMDMVGQDAVIRLLSKACRNDPFTEEEMTAMNLDRKTIVPYLENYTIGPEVDHQIVKADVAGGDVSASWAFFTFSPKAMSELKDAATKTLDASTKFVSTDDALSAFIWKSASRVRLERIDGSAPTEFCRAVDARPAMGVSNNYPGLLQNMTYHNSTIGEIANESLGATASRLRSELDPASMRQRTRGLATYLHNNPDKSNVSLTADADPSTSVMLSSWAKVGLWDYDFGLGLGKPETVRRPIFEPVESLMYFMPKKPDGEFCAALSLRDEDMDRLKADKEWTKYAQYVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trichothecene 3-O-acetyltransferase
publication title Structural and Functional Characterization of the TRI101 Trichothecene 3-O-Acetyltransferase from Fusarium sporotrichioides and Fusarium graminearum: KINETIC INSIGHTS TO COMBATING FUSARIUM HEAD BLIGHT
pubmed doi rcsb
source organism Gibberella zeae
molecule tags Transferase
total genus 160
structure length 446
sequence length 451
ec nomenclature
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02458 Transferase Transferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 3b30A01
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 3b30A02
1DPBA 1EADA 1EABA 2CLAA 2II4A 1DPDA 1XL8A 3B2SA 3B30A 4G22A 2II5A 5FANA 2I9DA 2II3A 5KJWA 4HVMA 2E1VA 3L60A 2IHWA 1SCZA 2RKTA 3U9FA 4KECA 1XMCA 1Q9JA 1Q23A 2BGHA 2E1UA 5T3EA 3FP0A 5DU9A 2XR7A 5KJTA 1XMDA 1EAAA 4CLAA 1EAFA 2XHGA 1QCAA 3FOTA 4G2MA 1CIAA 1XL7A 5FALA 2RKVA 2JGPA 2VSQA 4G0BA 5DUAA 3U9BA 5KJSA 2ZBAA 4JN3A 1L5AA 3CLAA 1DPCA 2E1TA 5KJVA 1NOCB 3MAEA 1EACA 1EAEA 4KE4A 1C4TA 1CLAA 5KJUA 4N72A 4JN5A 1PD5A 1E2OA
chains in the Genus database with same CATH superfamily
1DPBA 3B30A 4HVMA 4EPHA 2RKTA 2H3UA 4EP9A 2RCUA 1S5OA 1EAFA 2FY2A 4G2MA 2RKVA 2JGPA 2VSQA 5DUAA 3U9BA 5KJSA 1L5AA 1DPCA 2E1TA 1T7QA 1CLAA 1NDFA 2FY5A 1E2OA 1NM8A 2CLAA 2II5A 2II3A 5KJWA 2E1VA 4KECA 2H3PA 2BGHA 2E1UA 1XMDA 1EAAA 1NDBA 2DEBA 1XL7A 5FALA 4G0BA 2H4TA 5KJUA 4N72A 3U9FA 2II4A 3B2SA 1DPDA 4G22A 1Q6XA 2IHWA 1XMCA 2FW3A 1Q9JA 1Q23A 1T1UA 5T3EA 2XR7A 5KJTA 2FYOA 2XHGA 4JN3A 1T7OA 5KJVA 3MAEA 2FY4A 1EACA 2FY3A 1C4TA 4EYWA 2H3WA 4JN5A 1EADA 1EABA 1XL8A 5FANA 2I9DA 3L60A 1SCZA 1NDIA 1T7NA 3FP0A 5DU9A 4CLAA 1QCAA 3FOTA 1CIAA 2ZBAA 3CLAA 1NOCB 1EAEA 4KE4A 1PD5A
chains in the Genus database with same CATH topology
1DPBA 1EADA 1EABA 2CLAA 2II4A 1DPDA 1XL8A 3B2SA 3B30A 4G22A 2II5A 5FANA 2I9DA 2II3A 5KJWA 4HVMA 2E1VA 3L60A 2IHWA 1SCZA 2RKTA 3U9FA 4KECA 1XMCA 1Q9JA 1Q23A 2BGHA 2E1UA 5T3EA 3FP0A 5DU9A 2XR7A 5KJTA 1XMDA 1EAAA 4CLAA 1EAFA 2XHGA 1QCAA 3FOTA 4G2MA 1CIAA 1XL7A 5FALA 2RKVA 2JGPA 2VSQA 4G0BA 5DUAA 3U9BA 5KJSA 2ZBAA 4JN3A 1L5AA 3CLAA 1DPCA 2E1TA 5KJVA 1NOCB 3MAEA 1EACA 1EAEA 4KE4A 1C4TA 1CLAA 5KJUA 4N72A 4JN5A 1PD5A 1E2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DPB A;  1EAD A;  1EAB A;  2CLA A;  2II4 A;  1DPD A;  1XL8 A;  3B2S A;  3B30 A;  4G22 A;  2II5 A;  5FAN A;  2I9D A;  2II3 A;  5KJW A;  4HVM A;  2E1V A;  3L60 A;  2IHW A;  1SCZ A;  2RKT A;  3U9F A;  4KEC A;  1XMC A;  1Q9J A;  1Q23 A;  2BGH A;  2E1U A;  5T3E A;  3FP0 A;  5DU9 A;  2XR7 A;  5KJT A;  1XMD A;  1EAA A;  4CLA A;  1EAF A;  2XHG A;  1QCA A;  3FOT A;  4G2M A;  1CIA A;  1XL7 A;  5FAL A;  2RKV A;  2JGP A;  2VSQ A;  4G0B A;  5DUA A;  3U9B A;  5KJS A;  2ZBA A;  4JN3 A;  1L5A A;  3CLA A;  1DPC A;  2E1T A;  5KJV A;  1NOC B;  3MAE A;  1EAC A;  1EAE A;  4KE4 A;  1C4T A;  1CLA A;  5KJU A;  4N72 A;  4JN5 A;  1PD5 A;  1E2O A; 
#chains in the Genus database with same CATH topology
 1DPB A;  3B30 A;  4HVM A;  4EPH A;  2RKT A;  2H3U A;  4EP9 A;  2RCU A;  1S5O A;  1EAF A;  2FY2 A;  4G2M A;  2RKV A;  2JGP A;  2VSQ A;  5DUA A;  3U9B A;  5KJS A;  1L5A A;  1DPC A;  2E1T A;  1T7Q A;  1CLA A;  1NDF A;  2FY5 A;  1E2O A;  1NM8 A;  2CLA A;  2II5 A;  2II3 A;  5KJW A;  2E1V A;  4KEC A;  2H3P A;  2BGH A;  2E1U A;  1XMD A;  1EAA A;  1NDB A;  2DEB A;  1XL7 A;  5FAL A;  4G0B A;  2H4T A;  5KJU A;  4N72 A;  3U9F A;  2II4 A;  3B2S A;  1DPD A;  4G22 A;  1Q6X A;  2IHW A;  1XMC A;  2FW3 A;  1Q9J A;  1Q23 A;  1T1U A;  5T3E A;  2XR7 A;  5KJT A;  2FYO A;  2XHG A;  4JN3 A;  1T7O A;  5KJV A;  3MAE A;  2FY4 A;  1EAC A;  2FY3 A;  1C4T A;  4EYW A;  2H3W A;  4JN5 A;  1EAD A;  1EAB A;  1XL8 A;  5FAN A;  2I9D A;  3L60 A;  1SCZ A;  1NDI A;  1T7N A;  3FP0 A;  5DU9 A;  4CLA A;  1QCA A;  3FOT A;  1CIA A;  2ZBA A;  3CLA A;  1NOC B;  1EAE A;  4KE4 A;  1PD5 A; 
#chains in the Genus database with same CATH homology
 1DPB A;  1EAD A;  1EAB A;  2CLA A;  2II4 A;  1DPD A;  1XL8 A;  3B2S A;  3B30 A;  4G22 A;  2II5 A;  5FAN A;  2I9D A;  2II3 A;  5KJW A;  4HVM A;  2E1V A;  3L60 A;  2IHW A;  1SCZ A;  2RKT A;  3U9F A;  4KEC A;  1XMC A;  1Q9J A;  1Q23 A;  2BGH A;  2E1U A;  5T3E A;  3FP0 A;  5DU9 A;  2XR7 A;  5KJT A;  1XMD A;  1EAA A;  4CLA A;  1EAF A;  2XHG A;  1QCA A;  3FOT A;  4G2M A;  1CIA A;  1XL7 A;  5FAL A;  2RKV A;  2JGP A;  2VSQ A;  4G0B A;  5DUA A;  3U9B A;  5KJS A;  2ZBA A;  4JN3 A;  1L5A A;  3CLA A;  1DPC A;  2E1T A;  5KJV A;  1NOC B;  3MAE A;  1EAC A;  1EAE A;  4KE4 A;  1C4T A;  1CLA A;  5KJU A;  4N72 A;  4JN5 A;  1PD5 A;  1E2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...