3B33A

Crystal structure of the pas domain of nitrogen regulation protein nr(ii) from vibrio parahaemolyticus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
TSLPSAILNNMVTATLILDDGLAIRYANPAAELLFSQSAKRIVEQSLSQLIQHASLDLALLTQPLQSGQSITDSDVTFVVDGRPLMLEVTVSPITWQRQLMLLVEMRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of PAS domain of nitrogen regulation protein NR(II) from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Transferase
molecule keywords Sensor protein
total genus 24
structure length 109
sequence length 109
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3b33A00
1P0ZA 2KDKA 4KUKA 2V1BA 3VOLA 2YKFA 3LUQA 4GCZA 1T1AA 4HH2A 2B02A 2HV1A 3E4OA 3UB6A 4KQDA 2YKHA 5IU1A 3D72A 4R70A 1EW0A 2Z6CA 3H82B 3MXQA 4GS9B 3MR0A 5HD3A 4DJ2A 1T18A 3H82A 3BY9A 2H28A 3BWLA 3K3CA 4MN6A 2PYPA 4BBTA 3FC7A 4XT2B 4EXOA 2GJ3A 1TS8A 3NOPC 1JNUA 1BYWA 1OTBA 1S1ZA 2D02A 4M4XA 4WL9A 4EEPA 5J4EA 3G6OA 1UWNX 3F1NB 3ULFA 2OWHA 2V0WA 4H6JA 1V9YA 3F1OA 2QKPA 4I39A 3F1NA 1OJ5A 1VB6A 2M1CA 2R78A 4NXGA 2INWA 4GHIB 2W27A 5AVFA 5KIZA 1TS0A 1MZUA 1OTIA 2VV8A 2ZOIA 3CLOA 3MJQA 4I3JA 3K3DA 4L9GA 4WLAA 4I38A 3UB8A 2OOLA 2VV6A 3C2WA 1LT0A 1LSXA 4LRZE 4EERA 1Y28A 1GSWA 5F5YA 1LL8A 2K7SA 1S67L 2WKPA 3UB7A 1S4SA 4K08A 4NXBA 2V9AA 1T1CA 2ZOHA 1LSWA 3EWKA 5DJUA 1XFQA 1TS6A 4L9EA 5HWWA 3HJIA 5DKLA 5HWTA 1OTDA 4HNBA 4EQ1A 3LIBA 3IS2A 4MN5A 5DKKA 4EW7A 2VV7A 1OT6A 2KX6A 4EESA 4PKYG 1DRMA 1XJ6A 3KX0X 1P97A 4BBVA 2PD8A 2W0NA 5J3WA 1OTAA 1XJ4A 3UB9A 3LIFA 2P7JA 2QWSA 2PD7A 4HP4A 3A0RA 3T50A 1NWZA 3CAXA 4YWZA 5F68A 4R3AA 3UE6A 3FG8A 1D06A 1G28A 2QJ5A 2I9VA 2PDRA 3LICA 4E04A 3GECA 1KOUA 2ZBBA 3H7WB 4HOIA 3P7NA 2PYRA 4I5SA 4R38A 5AVEA 2CMNA 4JGPA 3NJAA 4XT2A 5HDDA 3E4PA 1UWPX 4HY8A 3H9WA 3OLOA 1OT9A 4LPZA 2WKRA 3F1PA 4HP9A 4BBUA 4EETB 3IS2B 1XFNA 1V9ZA 4L9FA 4KUOA 1F98A 4HQAA 3NHQA 4LLOB 4LRXC 4R6LA 1D7EA 4JGOA 5EFWA 3MQQA 3SW1A 4GHIA 1DP9A 3PYPA 1N9NA 3E4QA 3VE3A 5F69A 4GS9A 1OJGA 4HJ3A 1WA9A 4DJ3A 4JGQA 3MQOA 5G4ZA 2EA9A 2J80A 3A0VA 4B9OA 4HIAA 5HWVA 3EEHA 1GSVA 4HJ4A 5I5LA 2A24B 3H7WA 3LIDA 5J7EA 2A24A 5A8BA 1S4RA 3LI8A 1N9LA 2QJ7A 4RQ9A 2L0WA 3HJKA 3IBRA 2OWJA 1S1YA 3A0SA 4F3LA 2L4RA 4HH3A 5IS1A 3LIEA 1N9OA 2QHKA 2WKQA 3MFXA 4LRYC 4H6JB 4NXFA 2PR5A 4WN5A 4HI4A 5DJTA 2VLGA 4EEUA 1TS7A 3NOTC 4I3IA 2BASA 3BY8A 4JGRA 1LSVA 2PR6A 1XJ2A 1XJ3A 5F6AA 3UMDA 3ZQ5A 3ICYA 3LYXA 5HDCA 3VE4A 1S66L 1DP8A 2JN7A 2Z6DA 3LIAA 5TBMB 3LI9A 1X0OA 5TBMA 4I3AA 4GW9A 4WF0A 4WUJA 5HD5A 1ODVA 5HSQA 5HZHA 4HHDA 1UGUA 2V1AA 3CWFA 1T19A 1DP6A 1GSXA 4NXEA 1OTEA 2PHYA 3B33A 3NOUC 2V0UA 3F1PB 4HJ6A 4PKYA 3RTYA 5HDSA 4F3LB 2L1MA 1T1BA 2VEAA 2D01A 3F1OB 5G4YA 3PHYA 3GDIA 3RH8B 3UMEA 2JHEA 3C8CA 1F9IA
chains in the Genus database with same CATH superfamily
2PBDP 1FOFA 3UB6A 3HLEA 2YKHA 3RJUA 1T18A 5EPHA 3ISGA 5E2EA 4MCWA 2EXBA 2GJ3A 3S7NA 3C7VA 1BYWA 1S1ZA 3DWZA 2WZZA 5EUAA 4JF5A 1F5MA 3EGDC 4WZ5A 1JWZA 5J4EA 3BFFA 3SS3A 5FQJA 1I5QA 4OLDA 3W4OA 5F5YA 1BT5A 4MBKA 1XFQA 1H8MA 5IHVA 2KX6A 3UE0A 3LIFA 2Q0OA 4Y0TA 2DNSA 3MBZA 1D06A 2PDRA 1QMFA 2ZBBA 3H7WB 4I5SA 1NLYA 5AQBA 3N8RA 4JGPA 3UDFA 3QP8A 3IF6A 1V9ZA 2A49A 5FSRA 3CPTB 3IXGA 1NY0A 3PYPA 3JVUA 3MZDA 5F69A 5GLBA 2UWXA 2ZC4B 2WGWB 1N9LA 2XLNA 1NJ4A 4R0QA 3CUEC 1KVMA 3LIEA 4IVIA 3MFXA 4X56A 1QMEA 1W8YA 3LR5A 2XQZA 1K4EA 4CLCA 3TSGA 4RVAA 5HSQA 4HHDA 2H0TA 4JF4A 1DP6A 4NXEA 3O3VA 3ZFZA 2HDUA 1T1BA 3ZG8B 5CGSA 3FPVA 4FD8A 1MXOA 3HLCA 4JPMA 1RGZA 2B02A 3LR0A 2ACGA 2C5WB 2R9XA 3GSGA 3T4LA 3CHWP 4DJ2A 4Z9QA 3GQZA 2VZWA 3T1SA 2EX9A 1EWZA 4PM9A 1TS8A 3ZG5A 3F1NB 4B4ZA 2V0WA 3LFVA 4I39A 3G30A 5EVEA 2E8JA 5KIZA 3TE8A 2A3UA 2PU2A 2ZM8A 5EECA 3C2WA 1LSXA 1Y28A 4EBPA 3IBJA 3FYZA 1G6OA 3DTEA 4GKUA 2HP9A 3IS2A 1ACFA 5FQKA 1KDWA 1L2SA 2W0NA 4R4SA 3LO7A 1BUEA 4N9KA 4MEZA 1IOUA 4ZRRA 4IHQA 2HZ5A 3OLOA 1TD5A 3GMWA 3GTCA 4R6LA 3E4QA 4WELA 2J80A 2ZC7A 1CEGA 2A24B 4Q0JA 4ETXA 3LIDA 2WGWA 4YFMA 2OWJA 4LRYC 2QHKA 3WS0A 2VLGA 2XD1A 2ZC5B 5DFYA 3ZQ5A 1GHPA 3GVBA 2M7VA 5FAPA 1DP8A 1X0OA 1TDLA 4WYYA 3B47A 2JE5A 4GDBA 5MC7A 3PHYA 3GDIA 1P0ZA 2YKFA 3LUQA 4HH2A 3ITAA 5J8XA 3G2ZA 5FDSA 3WRTA 1EW0A 4KZ6A 3UO9A 2JCHA 1E25A 2X02A 3N8SA 1CK3A 3AGEA 3F1NA 5CEDA 1XGJA 4Q0IA 1IKGA 3K3DA 3O5YA 2ZMVA 1NRFA 2FFYA 3TRCA 1TS6A 5HWWA 5DKLA 5JYPA 2Y2IA 1Y54A 3V67A 1RP5A 3OZHA 4O01A 1DRMA 1XXMA 2HP6A 4E6WA 3UB9A 3HL9A 1CJFA 3ZDJA 2QWSA 2I9VA 4HOIA 4OLGA 3B42A 2XROA 4IEDA 2O0YA 4L9FA 2OLUA 4LRXC 4EUZA 4U0XA 4C75A 4MN7A 2ZQCA 2ZC3B 2EA9A 4B9OA 4HJ4A 4QB8A 3OBFA 5KMWA 2A24A 4P87A 5BOHA 1S1YA 2LB5A 1ES5A 3T4JA 2ZMAA 5FASA 4PM8A 2BASA 2XA7M 2J8YA 3Q07A 5L07A 3BQ8A 3IX3A 4WUJA 2EFXA 2Y2HA 1BLCA 5HX9A 1FSWA 4Q8IA 4BWIA 2ZQDA 3NOUC 4LV2A 1PWCA 5U47A 2J7VA 1GCEA 4GOGA 1XGIA 4JXWA 4GZBA 4E3LA 1VQQA 4S2IA 4NETA 4WMCA 2OV5A 3VP3A 3D72A 2Y2MA 2IWBA 4IUKA 3C4OA 3FC7A 2DCFA 2P74A 1M40A 3T4KA 4OVDA 3ULFA 5FI7A 1GA0A 2O99A 4IUHA 4OP5A 1NZUA 2PBYA 2B5RA 4GHIB 2W27A 3UE6A 1OTIA 5K5BA 5CECA 3ZCZA 3CUEA 4ARZA 4B93A 1K56A 1OTDA 4OOMA 3UY6A 1PI4A 2VV7A 4EESA 4XUXA 4PKYG 1MWUA 4X53A 2IWDA 4BBVA 3GR2A 4KZ3A 2P9VB 4HP4A 3ZG7B 5I94A 3T50A 1F2KA 3FG8A 4M3KA 4MLLA 3GECA 2V2FF 1NLZA 4KZ9A 3OCLA 4Y0UA 4KUOA 5F1GA 3C7UA 3EOIA 1D7EA 3LY3A 3VV4A 2FZ0A 5GLDA 1YKDA 4BL2A 3TW8A 3MQOA 4DXBA 1K56D 3PBSA 4OH0A 4UQIS 5J7EA 2WGIA 3QP1A 3T1QB 4RA7A 1EROA 4HESA 2WKQA 4GB7A 4S2KA 3W4PA 2PR5A 4Y15A 4II7A 1SDEA 5LBRA 3PR6A 4OONA 5TBMB 4CLCE 3TG9A 5FA7A 3UE3A 4BENA 2Y8HA 3T1XA 5EVIA 2BLSA 2XRNA 4QPRA 1NXYA 1YSPA 1VETA 2WUQA 1PWDA 3B33A 2V8FA 3N8LA 3PBRA 2WADA 2JKTI 3FWLA 4Q0HA 4E3NA 1F9IA 4MBFA 4AFIA 4K0XA 3HUMA 3E4OA 4KQDA 2ZQ9A 4GS9B 3MR0A 3K3CA 3QNBA 4EXOA 4DDSA 3KYEA 2W3FA 2QMIA 5CXWA 3IXHA 4H6JA 1Q2QA 1OJ5A 3VP2A 3C30A 3JPUA 1DJBA 3G4PA 2BG1A 1GSWA 3OC2A 4R3BA 5DJUA 2V9AA 1FCMA 4XXRA 3PBTA 4EQ1A 4EW7A 1HZOA 1CF0A 2V8CA 4MNRA 4JKTA 3E98A 3VOYA 3A0RA 3IF6C 2ZQ7A 1L0DA 4XT2A 5FI2A 3HVFA 1IFQA 4P6ZM 1XFNA 4GNUA 4OOLA 4WM9A 2H5SA 3HLGA 4ZTKA 1OJGA 4HJ3A 1WA9A 3V39A 5HWVA 2XGNA 3O86A 5JYOA 2Y2OA 3NI9A 4N1XA 5A8BA 4RQ9A 3UNWA 4HH3A 5IS1A 1P9RA 1KDSA 5A90A 1TS7A 4FH4A 3FV7A 3LYXA 2XFTA 4KZAA 5AQ7A 5TBMA 4WF0A 3R7WA 5EVIB 1BTLA 2PHYA 3RTYA 2V0UA 1LL9A 2VEAA 3Q7ZA 2VGKA 3IWOA 3VOLA 4GD8A 1K38A 3MQ0A 3RXXA 4BBTA 2V1ZA 5GLCA 4PM5A 3F1OA 3N6IA 5KSCA 3PAGA 4I3JA 5FATA 5G18A 4KZBA 3MZFA 2W1TB 4LFUA 1LSWA 1N9BA 3QNCA 4PM7A 2Y2KA 5EM1A 2QZ6A 4BMWA 4S2PA 2PAVP 3FZCA 2RCXA 4P0MA 3A3FA 4UEYA 3CAXA 3ZHHA 3FKVA 3IX8A 5D3OA 4R38A 5CTNA 3QP2A 3EQUA 1S0WA 4UA9A 4KZ5A 4JGOA 3SW1A 4JXSA 3SH8A 3NC8A 3S7OA 1JWVA 3FPWA 3RXWA 4S2MA 2HJ9C 3MFDA 1H8YA 4ZDXA 2ZMFA 1S4RA 2L0WA 5EOEA 4ZBEA 4WBGA 3V3RA 5DTSA 4NXFA 2X71A 3NECA 5F6AA 5E43A 3ZNYA 2HF6A 2Y59A 3DWKA 1YQSA 2JN7A 3IF5A 4LCMA 3LIAA 4QHCA 4ME4A 1BZAA 4P85A 4ARZB 3I7JA 4E3JA 3HBRA 5F83A 1FCNA 4G3WA 2L1MA 5G4YA 2W3GA 4UAAA 4ZJ2A 5AQAA 3MS6A 5IU1A 3ITBA 4KZ8A 2P04A 5FDHA 2ZM0A 5EVID 2J3TC 1ONGA 4C3QA 2D02A 4PHTA 1K6SA 3UPOA 1PW8A 2INWA 4EQIA 2OAQ1 1LT0A 5F82A 3T4QA 4C6YA 3UB7A 4K08A 4LGWA 5A92A 4OP8A 1W7FA 3HJIA 3ZVTA 4MN5A 2MJ6A 4BLMA 4LENA 3KX0X 3PTEA 1ZG4A 1ES3A 1HLUP 4DN0A 3U2AA 4BQMA 3O87A 4DE1A 3H9WA 3VSKA 1Q2PA 2GZAA 4S2NC 2WKRA 2Y2LA 1F98A 3LCEA 1GA9A 2ZC6B 1DJCA 4Y7PA 4GS9A 4QY5A 3C5AA 3S22A 4O7DA 4WZ4A 4XUZA 3T4SA 1PIOA 4F3LA 1E3UD 4H6JB 5DJTA 4I3IA 2XSSA 2EFUA 1MKMA 2XK1A 5HDCA 4HBTA 1WYBA 1T19A 3G32A 1H8ZA 3OPRA 3NBLA 4KG2A 5CGWA 4Y0OA 4R3JA 1T1AA 2GX5A 4KG5A 4R70A 2Z6CA 5HD3A 1KGEA 4XT2B 4EEPA 1W63Q 4CQHA 3G6OA 3MF0A 5F1FA 1K54A 1TDGA 1VHMA 1L0FA 5AVFA 1E4DA 3Q81A 4L9GA 1I2WA 3V5MA 5CERA 1SKOB 2WZXA 2PRFA 2QYBA 3IQAA 3HUNA 4PM6A 4X1LA 2LB9A 3ZYTA 2ZJ9A 5KZHA 2P7JA 3BJNA 4P6BA 3G34A 4CLCD 3DW0A 5GHXA 1PZPA 3IHAA 2XF3A 3BLMA 3W4QA 1VETB 2EWWA 4OPYA 2VGLS 4BBUA 3OPPA 1YT4A 3RFBA 4HQAA 4Y3IA 3IT9A 5EFWA 1C3BA 1DP9A 4X55A 3S4XA 4GN2A 5G4ZA 5I5LA 1ES4A 3H7WA 1MPLA 3IH8A 1TVFA 1SCWA 5DFXA 1K4FA 1W8QA 2XA7S 4X25A 1SHVA 1G68A 2DMWA 4FCFA 1XJ3A 2VA0A 3UN7A 1S6RA 4PPRA 1LHYA 2W1TA 5HD5A 3WS2A 3E2KA 4G3VA 4PKYA 1OTEA 3VP1A 4KENB 2JHEA 1DY6A 2HV1A 3KO6A 1TEMA 3P01A 4K0WA 3W2ZA 1NRJA 2PYPA 1M6KA 4GLQA 3NIAA 3VOZA 3IXDA 2OWHA 2WGVA 4FSFA 2R78A 3UPNA 1TS0A 4DE3A 4EERA 3BYDA 1CI8A 3G2YA 3SS4A 2WYXA 1W79A 4EBLA 5L2FA 3LR4A 1SDNA 2E8IA 4HNBA 4CLCC 2Y2GA 1FR1A 1XJ6A 4NKPA 5J3WA 1Z6FA 3TJZC 1XX2A 3LICA 2ZL1B 5AVEA 3R7WB 3NJAA 5HDDA 5HARA 1UWPX 4OQ0A 1IYQA 2P08A 1KE0A 3IS2B 2FH5A 4UA7A 1AXBA 3NHQA 5FEFA 4NEED 3U4LP 4DJ3A 4KQOA 5EE8A 3OPHA 1GHIA 4YNRA 2O9AA 4FTXA 2Y4AA 3G35A 2JKGA 2VGLM 1MC0A 2VK3A 2OSUA 4N1HA 4G3KA 1IYSA 5TFQA 1L0GA 1HD8A 3F1PB 4HJ6A 1WE4A 3BEBA 5HFOA 5HPIA 1YLTA 3KSHA 5EVLA 2Y91A 1FSYA 4JF6A 5AQ9A 5EV0A 3NOPC 3C38A 4R4RA 1K57A 5FQMA 1HVBA 2K31A 2G2WA 3PBQA 1BLHA 5GHYA 4WLAA 5M1AA 4DXCA 2VV6A 5GL9A 2WKPA 1T1CA 1YMSA 4UQIM 3UPPA 2J9PA 4L0LA 5DF7A 4JXGA 3ZG9B 3HLFA 2V20A 4EBNA 4A5RA 4E3KA 5DF9A 3OCNA 3SOIA 4QU3A 4U0TA 4E04A 4OQIA 4N92A 2KOIA 5CHJA 2ZL1A 3E4PA 4R1GA 3ZGAB 4HP9A 2EX2A 3KYQA 1XA7A 2VX8A 2WK0A 3JVVA 4GD6A 3K2NA 1KE4A 3CJMA 1K55C 2JKRM 1L3LA 1NYYA 3CI6A 4DRTA 2Y2NA 1MKIA 4OPRA 1SKOA 3HLDA 4ESPA 4I3AA 3TOIA 2NUPC 2B18A 2NUTC 4GDNA 4N9LA 4GJ4A 4X69A 2G7UA 1W63M 1TF1A 4O8GA 4DDYA 1ESIA 2V1BA 1K25A 3QP6A 3AGFA 1IYOA 2VGJA 1JNUA 2XH9A 5DF8A 3NY4A 1VB6A 2VV8A 1MZUA 3MJQA 3UB8A 2J3WA 3Q82A 1S67L 4YINA 5CEBA 1O07A 1XPBA 4Y5FA 1JVJA 1PRQA 4E3IA 1J9MA 1BULA 1DJAA 1FCOA 3LR3A 4KQRA 2Y2QA 1G28A 1XP4A 4S2NA 3P7NA 1YLWA 4WEJA 1FIKA 5CHMA 2HP5A 2PU4A 3CMZA 2OLVA 4HIAA 2JBFA 3CITA 5FI6A 3NULA 1KGGA 3IBRA 1XKZA 3VMAA 2L4RA 4D2OA 2JKTM 4WZ5C 4BJPA 3Q1FA 5FEGA 3NOTC 1BSGA 3VP0A 5M19A 5GHZA 3EGXC 1CQAA 2EWVA 5TGFA 3ZVWA 2ZQAA 2HDQA 3MMHA 3MZEA 3T12B 2ZD8A 3D9YA 5HPFA 4QD4A 2Y79A 2D01A 4S2JA 3RH8B 3UMEA 4JGRA 5C5KA 3EQVA 2ZQ8A 4S2LA 1ERMA 2H0YA 5A91A 3BY9A 4MN6A 4X1MA 1YMXA 1VEUB 4DKIA 4WL9A 2XDMA 1OTBA 5EOOA 4IVKA 3MXRA 2QKPA 5EM0A 4NXGA 4JXVA 1K54C 4I38A 4UHUA 2OOLA 3LEZA 1G6AA 3CZDA 1LL8A 2GDNA 2ZOHA 5E2FA 5HWTA 3LIBA 3NDEA 1MY8A 5DKKA 3BRMA 4Y2FA 3N4IA 3V50A 1YLYA 3PXPA 2PD7A 4YWZA 1PFLA 3OPLA 2KLIA 5HAPA 4WEKA 4E3MA 4ZJ1A 4YOFA 4KZ4A 4B4XA 4FH2A 3WS1A 3F1PA 2UV0E 1JTGA 1A0KA 1I2SA 1YLJA 4LLOB 3MQQA 3MKFA 4QJGA 4JGQA 4QY6A 3EEHA 1GSVA 4NG2A 3S7PA 3AGDA 1K57C 3A0SA 2H10A 3BFEA 3P98A 4F94A 1N9OA 4WN5A 3BLSA 2FFFB 2Q9NA 5FAQA 4EEUA 3UMDA 3BW6A 3BECA 3S1YA 1YPRA 3HREA 1MWSA 4GW9A 3SH7A 3IWQA 1JWPA 3GRJA 2W3HA 4IJGA 4H8RA 1ALQA 2J9OA 3G31A 4IBRA 4RX3A 4KUKA 2W3DA 1OPXA 4LV3A 3H82B 4MMNA 2H28A 4K91A 1IEMA 2JKRI 1K6RA 3BFGA 2I72A 3PBNA 1IYPA 1ES2A 2P9VA 2ZOIA 2JC7A 3MXSA 4EU0A 4Y17A 4ZJ3A 5CX7A 5KSHA 2K7SA 5CHUA 5TR7A 4S2OA 3UDXA 4EWFA 3M2JA 2PD8A 4ETZA 1XJ4A 1WYCA 2XEPA 3KSFA 4KZ7A 1K0KA 1NWZA 3KSIA 4OKPA 5EVIC 1KE3A 4EUVA 2M7UA 3QHYA 1MBLA 2VJWA 4NK3A 1J3WA 4HY8A 1OT9A 3L7HA 1H3QA 1ZKJA 1E3UA 5FQ9A 3DTKA 3KYZA 1N9NA 3O88A 4LCLA 5CGXA 4OOYA 3GV9A 2X01A 4WMCD 5HL6A 4HI4A 3PAEA 3WRZA 2HJEA 3BY8A 4PMAA 2WKIA 2WAEA 3M2KA 1O7EA 1EI5A 1YM1A 3LI9A 1IELA 5HZHA 4ID4A 1UGUA 3SS5A 5E2HA 3IF6B 1PZOA 4HEFA 3C8CA 1MWRA 2KDKA 2C6WB 1ESUA 2A2LA 4GCZA 3B3XA 2JKFA 3CPTA 4Z1WA 1RGYA 3H82A 4LV1A 3BWLA 3DBAA 4PAUA 1FQGA 3DTIA 3EEAA 4X6TA 4M4XA 3A3DA 5CTMA 3N7WA 2M1CA 2ZM2A 3BM6A 3D4FA 2Y55A 3PBOA 3LEQA 1FILA 1NYMA 1SKFA 2ZLYA 4LRZE 5HAQA 4NXBA 1L0EA 3WWXA 2XR0A 1H0MA 1ERQA 3MSHA 2RL3A 2HDRA 1CI9A 5M18A 5DTTA 1YSQA 2AVXA 2CC1A 2Y2JA 3UDIA 1KOUA 4DE0A 3IH9A 4KG6A 2WKHA 4EV4A 5DVAA 4OPZA 3A3IA 4LPZA 5IT5A 3FKWA 3NCKA 5TJJA 4HBUA 2B95A 3A0VA 4FUWA 4X68A 1LL5A 1P9WA 1VEUA 5L8MA 2QJ7A 3UE1A 4FOFA 3LY4A 1U60A 3T1RA 3V3SA 2Z2LB 1ZC2A 2QPNA 5FQIA 1PNEA 2W1RA 1PYYA 2V1AA 3CWFA 3IWIA 1GSXA 3BQAA 4OPQA 4DF6A 4F3LB 1NZOA 3S7QA 3F1OB 3VSLA 2EXAA 5A93A 4DMZA 3R4KA 3CG5A 3DAVA 4LV0A 5FQQA 2OAP1 1Z09A 4BD1A 3MXQA 4E6XA 1HTZA 3E0YA 1BLSA 3WS5A 5DTKA 4DE2A 2R9WA 3SH9A 2EX6A 1UWNX 4U3TA 1LLBA 4BD0A 4Y13A 5AJGA 3HCYA 4BL3A 2J3TD 1S4SA 1G5UA 3EWKA 3QP5A 3SZTA 1MWTA 2K2NA 3A3EA 1YLZA 1OMEA 5HW3A 4RX2A 1XA1A 1YAXA 1OTAA 3BFCA 4R3AA 5F68A 4OQHA 3IHBA 3M6BA 2PYRA 3IXBA 1H5XA 5L10A 2O9BA 4R23A 2IWCA 3NDGA 4EETB 3IX4A 3BFDA 3L9KA 3ZNTA 4E3OA 1W5DA 2HDSA 3VE3A 2HPBA 2HGVA 5HAIA 1KGFA 3LI8A 3HJKA 2IA2A 4B88A 3JYIA 3C4PA 1XJ2A 5FAOA 2PT7A 3MKEA 3Q7VB 3VFHA 3ICYA 1S66L 4D60A 4OQGA 2BTFP 2Y2PA 4CJNA 4KQQA 3A3JA 3HLWA 2W3EA 1ZTUA 5HDSA 1PWGA 4P6ZS 2Z2MB 2VKSA 3D3OA 5HL1A 1D1JA 3LGOA 3UB5P 1ZHHB 3HLBA 2EX8A 3E2LA 2XD5A 1JTDA 4ZAMA 1ZG6A 1V9YA 4RYEA 3CLOA 1LI9A 1RCJA 1LI0A 4UA6A 5CRFA 3M6HA 3WS4A 5L09A 4L9EA 5E2GA 3P09A 4MDZA 1OT6A 1P97A 3VP4A 1BLPA 1STZA 1AWIA 1FR6A 2XFSA 1Y4OA 2QJ5A 4QWOA 2DRWA 2O9CA 2CMNA 4MBHA 5FL3A 1ONHA 4JLFA 3W8KA 1KVLA 2WKEA 4CPKA 2G2UA 3HUOA 1VM1A 1K55A 4GHIA 3VFFA 4JBFA 3DTMA 2WAFA 4IBXA 3T4TA 2GNXA 3OOVA 3KSGA 5GLAA 1LSVA 2PR6A 1N4OA 3Q7VA 3VE4A 4CLCB 1PI5A 2Z6DA 1SZVA 1GHMA 1YLPA 1IKIA 1ODVA 4O0PA 3QP4A 1PW1A 3T4OA 1CEFA 2Q9MA 3ZG0A
chains in the Genus database with same CATH topology
4KUKA 2W3DA 4AFIA 2HV1A 3E4OA 3UB6A 4KQDA 1OPXA 2YKHA 3KO6A 3P01A 4GS9B 3H82B 3MR0A 4MMNA 1T18A 3W2ZA 3K3CA 2H28A 1NRJA 2PYPA 4EXOA 4MCWA 2GJ3A 3S7NA 4GLQA 1BYWA 1S1ZA 2JKRI 2W3FA 3PBNA 2OWHA 4H6JA 1F5MA 4FSFA 3EGDC 1OJ5A 2R78A 3C30A 1TS0A 5J4EA 2ZOIA 4EU0A 4EERA 1GSWA 3OC2A 5CX7A 5F5YA 5KSHA 2K7SA 5DJUA 2V9AA 1XFQA 3LR4A 3PBTA 4HNBA 4CLCC 4EQ1A 1H8MA 4EW7A 2KX6A 1XJ6A 2PD8A 4ETZA 4NKPA 5J3WA 1XJ4A 3LIFA 3E98A 3TJZC 3KSFA 3A0RA 1NWZA 3KSIA 4EUVA 1D06A 3LICA 2PDRA 5AVEA 2ZBBA 3H7WB 4I5SA 1NLYA 2M7UA 3R7WB 4JGPA 2VJWA 3NJAA 4XT2A 5HDDA 1IFQA 4HY8A 1UWPX 1OT9A 4P6ZM 2P08A 1H3QA 3IS2B 2FH5A 1XFNA 1V9ZA 4OOLA 3NHQA 3KYZA 4NEED 3PYPA 1N9NA 3JVUA 5F69A 4DJ3A 1OJGA 4HJ3A 1WA9A 4KQOA 5HWVA 4YNRA 5A8BA 4RQ9A 1N9LA 2O9AA 3CUEC 4HH3A 5IS1A 5HL6A 3LIEA 1P9RA 2VGLM 3MFXA 1MC0A 4HI4A 1TS7A 2HJEA 3BY8A 3LYXA 4G3KA 3LR5A 3LI9A 5TBMA 4CLCA 4WF0A 5HSQA 5HZHA 4HHDA 3R7WA 1UGUA 1DP6A 4NXEA 2PHYA 3RTYA 2V0UA 3F1PB 4HJ6A 1T1BA 2VEAA 3FPVA 5HPIA 3C8CA 3KSHA 2KDKA 3VOLA 2A2LA 4GCZA 2B02A 3LR0A 4Z1WA 3T4LA 4DJ2A 3MQ0A 2VZWA 3H82A 3BWLA 4BBTA 3DBAA 4PAUA 3EEAA 1TS8A 3NOPC 3C38A 4M4XA 3F1NB 2V0WA 3LFVA 3F1OA 4I39A 2M1CA 2K31A 5KIZA 3PBOA 3PBQA 3TE8A 4I3JA 4WLAA 2VV6A 3C2WA 4LRZE 1LSXA 1Y28A 3IBJA 1G6OA 2WKPA 2W1TB 4NXBA 1T1CA 1LSWA 4UQIM 4L0LA 3IS2A 2W0NA 4BMWA 5DF9A 3OCNA 1YSQA 4UEYA 3CAXA 4E04A 1IOUA 1KOUA 4ZRRA 2KOIA 4IHQA 4R38A 3E4PA 3EQUA 3OLOA 4LPZA 5IT5A 1TD5A 4HP9A 5TJJA 3KYQA 4R6LA 4JGOA 3SW1A 2VX8A 3JVVA 3E4QA 4WELA 3S7OA 3K2NA 2J80A 3A0VA 3FPWA 2A24B 2HJ9C 4Q0JA 1P9WA 4ETXA 3LIDA 2ZMFA 2JKRM 5L8MA 1S4RA 2QJ7A 2L0WA 2OWJA 3CI6A 4FOFA 4LRYC 2QHKA 4NXFA 2VLGA 5F6AA 2HF6A 5DFYA 3ZQ5A 2M7VA 1DP8A 2JN7A 3LIAA 4ME4A 2W1RA 1X0OA 4I3AA 2NUPC 2B18A 2NUTC 4ARZB 2V1AA 3B47A 3CWFA 1GSXA 3BQAA 4G3WA 4GJ4A 5MC7A 4F3LB 2L1MA 3S7QA 2G7UA 1W63M 1TF1A 3F1OB 3GDIA 3PHYA 4O8GA 5G4YA 1P0ZA 2W3GA 2V1BA 4DMZA 3R4KA 2YKFA 3LUQA 4HH2A 2OAP1 5IU1A 1EW0A 3MXQA 2P04A 3E0YA 2J3TC 1JNUA 2D02A 1UWNX 4PHTA 3F1NA 1VB6A 2INWA 2VV8A 1MZUA 3MJQA 2OAQ1 4Q0IA 3K3DA 5AJGA 2J3WA 3O5YA 3UB8A 2ZMVA 1LT0A 3HCYA 3T4QA 2J3TD 1S67L 3UB7A 1S4SA 4K08A 3TRCA 3EWKA 1TS6A 5HWWA 2K2NA 3HJIA 5DKLA 4MN5A 3V67A 4Y5FA 4O01A 2MJ6A 1DRMA 3KX0X 1YAXA 1OTAA 3UB9A 2QWSA 3LR3A 4DN0A 5F68A 4R3AA 3U2AA 1G28A 2I9VA 4HOIA 3P7NA 2PYRA 3B42A 2O9BA 3H9WA 2XROA 2GZAA 2WKRA 4EETB 2O0YA 4WEJA 4L9FA 1F98A 4LRXC 4MN7A 3VE3A 4GS9A 2HGVA 2EA9A 4B9OA 4HIAA 4HJ4A 3CITA 3OBFA 2A24A 3LI8A 3T4SA 3HJKA 3IBRA 1S1YA 2LB5A 4F3LA 2IA2A 2L4RA 2JKTM 4BJPA 4H6JB 5DJTA 3T4JA 3NOTC 4I3IA 2BASA 1XJ2A 2XA7M 2PT7A 2XSSA 3ICYA 1MKMA 3EGXC 5HDCA 1S66L 2EWVA 3BQ8A 4WUJA 3MMHA 2W3EA 1T19A 1ZTUA 4BWIA 5HPFA 3NOUC 5HDSA 2Y79A 2D01A 4P6ZS 3RH8B 3UMEA 4JGRA 5C5KA 2VKSA 3EQVA 1T1AA 2GX5A 3D3OA 3D72A 4R70A 2Z6CA 5HD3A 1ZHHB 4IUKA 3BY9A 4MN6A 3FC7A 4XT2B 4WL9A 3T4KA 1OTBA 4EEPA 1W63Q 4CQHA 3G6OA 3MF0A 3ULFA 2O99A 1V9YA 4IUHA 2QKPA 1VHMA 4NXGA 4GHIB 2W27A 5AVFA 4L9GA 1OTIA 3UE6A 3CLOA 4I38A 2OOLA 1LL8A 2QYBA 2ZOHA 5K5BA 3CUEA 4ARZA 4L9EA 4B93A 2LB9A 5HWTA 1OTDA 4OOMA 3LIBA 5DKKA 4Y2FA 2VV7A 1OT6A 4MDZA 3ZYTA 4EESA 4PKYG 1P97A 4BBVA 3PXPA 1STZA 2P7JA 4HP4A 2PD7A 3BJNA 3T50A 4CLCD 4YWZA 3FG8A 2QJ5A 3GECA 2KLIA 2O9CA 4WEKA 2CMNA 5FL3A 4YOFA 2EWWA 1NLZA 2VGLS 3F1PA 3OCLA 4BBUA 3RFBA 4KUOA 4HQAA 4Y3IA 4LLOB 3EOIA 1D7EA 5EFWA 3MQQA 3VV4A 2FZ0A 1YKDA 4GHIA 1DP9A 4JGQA 3MQOA 5G4ZA 3TW8A 3EEHA 1GSVA 5I5LA 3PBSA 3S7PA 3H7WA 3T4TA 4UQIS 5J7EA 2GNXA 5DFXA 3A0SA 2XA7S 1N9OA 2WKQA 4WN5A 3OOVA 2PR5A 2DMWA 4EEUA 3KSGA 1LSVA 2PR6A 3UMDA 1XJ3A 2VA0A 3BW6A 4II7A 5LBRA 3PR6A 3VE4A 5TBMB 4CLCB 2Z6DA 4CLCE 3UE3A 2W1TA 4GW9A 2Y8HA 5HD5A 1ODVA 4O0PA 2XRNA 4QPRA 2W3HA 1YSPA 4IJGA 4G3VA 4PKYA 1OTEA 3B33A 3PBRA 2JKTI 3T4OA 4Q0HA 2JHEA 1F9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P0Z A;  2KDK A;  4KUK A;  2V1B A;  3VOL A;  2YKF A;  3LUQ A;  4GCZ A;  1T1A A;  4HH2 A;  2B02 A;  2HV1 A;  3E4O A;  3UB6 A;  4KQD A;  2YKH A;  5IU1 A;  3D72 A;  4R70 A;  1EW0 A;  2Z6C A;  3H82 B;  3MXQ A;  4GS9 B;  3MR0 A;  5HD3 A;  4DJ2 A;  1T18 A;  3H82 A;  3BY9 A;  2H28 A;  3BWL A;  3K3C A;  4MN6 A;  2PYP A;  4BBT A;  3FC7 A;  4XT2 B;  4EXO A;  2GJ3 A;  1TS8 A;  3NOP C;  1JNU A;  1BYW A;  1OTB A;  1S1Z A;  2D02 A;  4M4X A;  4WL9 A;  4EEP A;  5J4E A;  3G6O A;  1UWN X;  3F1N B;  3ULF A;  2OWH A;  2V0W A;  4H6J A;  1V9Y A;  3F1O A;  2QKP A;  4I39 A;  3F1N A;  1OJ5 A;  1VB6 A;  2M1C A;  2R78 A;  4NXG A;  2INW A;  4GHI B;  2W27 A;  5AVF A;  5KIZ A;  1TS0 A;  1MZU A;  1OTI A;  2VV8 A;  2ZOI A;  3CLO A;  3MJQ A;  4I3J A;  3K3D A;  4L9G A;  4WLA A;  4I38 A;  3UB8 A;  2OOL A;  2VV6 A;  3C2W A;  1LT0 A;  1LSX A;  4LRZ E;  4EER A;  1Y28 A;  1GSW A;  5F5Y A;  1LL8 A;  2K7S A;  1S67 L;  2WKP A;  3UB7 A;  1S4S A;  4K08 A;  4NXB A;  2V9A A;  1T1C A;  2ZOH A;  1LSW A;  3EWK A;  5DJU A;  1XFQ A;  1TS6 A;  4L9E A;  5HWW A;  3HJI A;  5DKL A;  5HWT A;  1OTD A;  4HNB A;  4EQ1 A;  3LIB A;  3IS2 A;  4MN5 A;  5DKK A;  4EW7 A;  2VV7 A;  1OT6 A;  2KX6 A;  4EES A;  4PKY G;  1DRM A;  1XJ6 A;  3KX0 X;  1P97 A;  4BBV A;  2PD8 A;  2W0N A;  5J3W A;  1OTA A;  1XJ4 A;  3UB9 A;  3LIF A;  2P7J A;  2QWS A;  2PD7 A;  4HP4 A;  3A0R A;  3T50 A;  1NWZ A;  3CAX A;  4YWZ A;  5F68 A;  4R3A A;  3UE6 A;  3FG8 A;  1D06 A;  1G28 A;  2QJ5 A;  2I9V A;  2PDR A;  3LIC A;  4E04 A;  3GEC A;  1KOU A;  2ZBB A;  3H7W B;  4HOI A;  3P7N A;  2PYR A;  4I5S A;  4R38 A;  5AVE A;  2CMN A;  4JGP A;  3NJA A;  4XT2 A;  5HDD A;  3E4P A;  1UWP X;  4HY8 A;  3H9W A;  3OLO A;  1OT9 A;  4LPZ A;  2WKR A;  3F1P A;  4HP9 A;  4BBU A;  4EET B;  3IS2 B;  1XFN A;  1V9Z A;  4L9F A;  4KUO A;  1F98 A;  4HQA A;  3NHQ A;  4LLO B;  4LRX C;  4R6L A;  1D7E A;  4JGO A;  5EFW A;  3MQQ A;  3SW1 A;  4GHI A;  1DP9 A;  3PYP A;  1N9N A;  3E4Q A;  3VE3 A;  5F69 A;  4GS9 A;  1OJG A;  4HJ3 A;  1WA9 A;  4DJ3 A;  4JGQ A;  3MQO A;  5G4Z A;  2EA9 A;  2J80 A;  3A0V A;  4B9O A;  4HIA A;  5HWV A;  3EEH A;  1GSV A;  4HJ4 A;  5I5L A;  2A24 B;  3H7W A;  3LID A;  5J7E A;  2A24 A;  5A8B A;  1S4R A;  3LI8 A;  1N9L A;  2QJ7 A;  4RQ9 A;  2L0W A;  3HJK A;  3IBR A;  2OWJ A;  1S1Y A;  3A0S A;  4F3L A;  2L4R A;  4HH3 A;  5IS1 A;  3LIE A;  1N9O A;  2QHK A;  2WKQ A;  3MFX A;  4LRY C;  4H6J B;  4NXF A;  2PR5 A;  4WN5 A;  4HI4 A;  5DJT A;  2VLG A;  4EEU A;  1TS7 A;  3NOT C;  4I3I A;  2BAS A;  3BY8 A;  4JGR A;  1LSV A;  2PR6 A;  1XJ2 A;  1XJ3 A;  5F6A A;  3UMD A;  3ZQ5 A;  3ICY A;  3LYX A;  5HDC A;  3VE4 A;  1S66 L;  1DP8 A;  2JN7 A;  2Z6D A;  3LIA A;  5TBM B;  3LI9 A;  1X0O A;  5TBM A;  4I3A A;  4GW9 A;  4WF0 A;  4WUJ A;  5HD5 A;  1ODV A;  5HSQ A;  5HZH A;  4HHD A;  1UGU A;  2V1A A;  3CWF A;  1T19 A;  1DP6 A;  1GSX A;  4NXE A;  1OTE A;  2PHY A;  3B33 A;  3NOU C;  2V0U A;  3F1P B;  4HJ6 A;  4PKY A;  3RTY A;  5HDS A;  4F3L B;  2L1M A;  1T1B A;  2VEA A;  2D01 A;  3F1O B;  5G4Y A;  3PHY A;  3GDI A;  3RH8 B;  3UME A;  2JHE A;  3C8C A;  1F9I A; 
#chains in the Genus database with same CATH topology
 2PBD P;  1FOF A;  3UB6 A;  3HLE A;  2YKH A;  3RJU A;  1T18 A;  5EPH A;  3ISG A;  5E2E A;  4MCW A;  2EXB A;  2GJ3 A;  3S7N A;  3C7V A;  1BYW A;  1S1Z A;  3DWZ A;  2WZZ A;  5EUA A;  4JF5 A;  1F5M A;  3EGD C;  4WZ5 A;  1JWZ A;  5J4E A;  3BFF A;  3SS3 A;  5FQJ A;  1I5Q A;  4OLD A;  3W4O A;  5F5Y A;  1BT5 A;  4MBK A;  1XFQ A;  1H8M A;  5IHV A;  2KX6 A;  3UE0 A;  3LIF A;  2Q0O A;  4Y0T A;  2DNS A;  3MBZ A;  1D06 A;  2PDR A;  1QMF A;  2ZBB A;  3H7W B;  4I5S A;  1NLY A;  5AQB A;  3N8R A;  4JGP A;  3UDF A;  3QP8 A;  3IF6 A;  1V9Z A;  2A49 A;  5FSR A;  3CPT B;  3IXG A;  1NY0 A;  3PYP A;  3JVU A;  3MZD A;  5F69 A;  5GLB A;  2UWX A;  2ZC4 B;  2WGW B;  1N9L A;  2XLN A;  1NJ4 A;  4R0Q A;  3CUE C;  1KVM A;  3LIE A;  4IVI A;  3MFX A;  4X56 A;  1QME A;  1W8Y A;  3LR5 A;  2XQZ A;  1K4E A;  4CLC A;  3TSG A;  4RVA A;  5HSQ A;  4HHD A;  2H0T A;  4JF4 A;  1DP6 A;  4NXE A;  3O3V A;  3ZFZ A;  2HDU A;  1T1B A;  3ZG8 B;  5CGS A;  3FPV A;  4FD8 A;  1MXO A;  3HLC A;  4JPM A;  1RGZ A;  2B02 A;  3LR0 A;  2ACG A;  2C5W B;  2R9X A;  3GSG A;  3T4L A;  3CHW P;  4DJ2 A;  4Z9Q A;  3GQZ A;  2VZW A;  3T1S A;  2EX9 A;  1EWZ A;  4PM9 A;  1TS8 A;  3ZG5 A;  3F1N B;  4B4Z A;  2V0W A;  3LFV A;  4I39 A;  3G30 A;  5EVE A;  2E8J A;  5KIZ A;  3TE8 A;  2A3U A;  2PU2 A;  2ZM8 A;  5EEC A;  3C2W A;  1LSX A;  1Y28 A;  4EBP A;  3IBJ A;  3FYZ A;  1G6O A;  3DTE A;  4GKU A;  2HP9 A;  3IS2 A;  1ACF A;  5FQK A;  1KDW A;  1L2S A;  2W0N A;  4R4S A;  3LO7 A;  1BUE A;  4N9K A;  4MEZ A;  1IOU A;  4ZRR A;  4IHQ A;  2HZ5 A;  3OLO A;  1TD5 A;  3GMW A;  3GTC A;  4R6L A;  3E4Q A;  4WEL A;  2J80 A;  2ZC7 A;  1CEG A;  2A24 B;  4Q0J A;  4ETX A;  3LID A;  2WGW A;  4YFM A;  2OWJ A;  4LRY C;  2QHK A;  3WS0 A;  2VLG A;  2XD1 A;  2ZC5 B;  5DFY A;  3ZQ5 A;  1GHP A;  3GVB A;  2M7V A;  5FAP A;  1DP8 A;  1X0O A;  1TDL A;  4WYY A;  3B47 A;  2JE5 A;  4GDB A;  5MC7 A;  3PHY A;  3GDI A;  1P0Z A;  2YKF A;  3LUQ A;  4HH2 A;  3ITA A;  5J8X A;  3G2Z A;  5FDS A;  3WRT A;  1EW0 A;  4KZ6 A;  3UO9 A;  2JCH A;  1E25 A;  2X02 A;  3N8S A;  1CK3 A;  3AGE A;  3F1N A;  5CED A;  1XGJ A;  4Q0I A;  1IKG A;  3K3D A;  3O5Y A;  2ZMV A;  1NRF A;  2FFY A;  3TRC A;  1TS6 A;  5HWW A;  5DKL A;  5JYP A;  2Y2I A;  1Y54 A;  3V67 A;  1RP5 A;  3OZH A;  4O01 A;  1DRM A;  1XXM A;  2HP6 A;  4E6W A;  3UB9 A;  3HL9 A;  1CJF A;  3ZDJ A;  2QWS A;  2I9V A;  4HOI A;  4OLG A;  3B42 A;  2XRO A;  4IED A;  2O0Y A;  4L9F A;  2OLU A;  4LRX C;  4EUZ A;  4U0X A;  4C75 A;  4MN7 A;  2ZQC A;  2ZC3 B;  2EA9 A;  4B9O A;  4HJ4 A;  4QB8 A;  3OBF A;  5KMW A;  2A24 A;  4P87 A;  5BOH A;  1S1Y A;  2LB5 A;  1ES5 A;  3T4J A;  2ZMA A;  5FAS A;  4PM8 A;  2BAS A;  2XA7 M;  2J8Y A;  3Q07 A;  5L07 A;  3BQ8 A;  3IX3 A;  4WUJ A;  2EFX A;  2Y2H A;  1BLC A;  5HX9 A;  1FSW A;  4Q8I A;  4BWI A;  2ZQD A;  3NOU C;  4LV2 A;  1PWC A;  5U47 A;  2J7V A;  1GCE A;  4GOG A;  1XGI A;  4JXW A;  4GZB A;  4E3L A;  1VQQ A;  4S2I A;  4NET A;  4WMC A;  2OV5 A;  3VP3 A;  3D72 A;  2Y2M A;  2IWB A;  4IUK A;  3C4O A;  3FC7 A;  2DCF A;  2P74 A;  1M40 A;  3T4K A;  4OVD A;  3ULF A;  5FI7 A;  1GA0 A;  2O99 A;  4IUH A;  4OP5 A;  1NZU A;  2PBY A;  2B5R A;  4GHI B;  2W27 A;  3UE6 A;  1OTI A;  5K5B A;  5CEC A;  3ZCZ A;  3CUE A;  4ARZ A;  4B93 A;  1K56 A;  1OTD A;  4OOM A;  3UY6 A;  1PI4 A;  2VV7 A;  4EES A;  4XUX A;  4PKY G;  1MWU A;  4X53 A;  2IWD A;  4BBV A;  3GR2 A;  4KZ3 A;  2P9V B;  4HP4 A;  3ZG7 B;  5I94 A;  3T50 A;  1F2K A;  3FG8 A;  4M3K A;  4MLL A;  3GEC A;  2V2F F;  1NLZ A;  4KZ9 A;  3OCL A;  4Y0U A;  4KUO A;  5F1G A;  3C7U A;  3EOI A;  1D7E A;  3LY3 A;  3VV4 A;  2FZ0 A;  5GLD A;  1YKD A;  4BL2 A;  3TW8 A;  3MQO A;  4DXB A;  1K56 D;  3PBS A;  4OH0 A;  4UQI S;  5J7E A;  2WGI A;  3QP1 A;  3T1Q B;  4RA7 A;  1ERO A;  4HES A;  2WKQ A;  4GB7 A;  4S2K A;  3W4P A;  2PR5 A;  4Y15 A;  4II7 A;  1SDE A;  5LBR A;  3PR6 A;  4OON A;  5TBM B;  4CLC E;  3TG9 A;  5FA7 A;  3UE3 A;  4BEN A;  2Y8H A;  3T1X A;  5EVI A;  2BLS A;  2XRN A;  4QPR A;  1NXY A;  1YSP A;  1VET A;  2WUQ A;  1PWD A;  3B33 A;  2V8F A;  3N8L A;  3PBR A;  2WAD A;  2JKT I;  3FWL A;  4Q0H A;  4E3N A;  1F9I A;  4MBF A;  4AFI A;  4K0X A;  3HUM A;  3E4O A;  4KQD A;  2ZQ9 A;  4GS9 B;  3MR0 A;  3K3C A;  3QNB A;  4EXO A;  4DDS A;  3KYE A;  2W3F A;  2QMI A;  5CXW A;  3IXH A;  4H6J A;  1Q2Q A;  1OJ5 A;  3VP2 A;  3C30 A;  3JPU A;  1DJB A;  3G4P A;  2BG1 A;  1GSW A;  3OC2 A;  4R3B A;  5DJU A;  2V9A A;  1FCM A;  4XXR A;  3PBT A;  4EQ1 A;  4EW7 A;  1HZO A;  1CF0 A;  2V8C A;  4MNR A;  4JKT A;  3E98 A;  3VOY A;  3A0R A;  3IF6 C;  2ZQ7 A;  1L0D A;  4XT2 A;  5FI2 A;  3HVF A;  1IFQ A;  4P6Z M;  1XFN A;  4GNU A;  4OOL A;  4WM9 A;  2H5S A;  3HLG A;  4ZTK A;  1OJG A;  4HJ3 A;  1WA9 A;  3V39 A;  5HWV A;  2XGN A;  3O86 A;  5JYO A;  2Y2O A;  3NI9 A;  4N1X A;  5A8B A;  4RQ9 A;  3UNW A;  4HH3 A;  5IS1 A;  1P9R A;  1KDS A;  5A90 A;  1TS7 A;  4FH4 A;  3FV7 A;  3LYX A;  2XFT A;  4KZA A;  5AQ7 A;  5TBM A;  4WF0 A;  3R7W A;  5EVI B;  1BTL A;  2PHY A;  3RTY A;  2V0U A;  1LL9 A;  2VEA A;  3Q7Z A;  2VGK A;  3IWO A;  3VOL A;  4GD8 A;  1K38 A;  3MQ0 A;  3RXX A;  4BBT A;  2V1Z A;  5GLC A;  4PM5 A;  3F1O A;  3N6I A;  5KSC A;  3PAG A;  4I3J A;  5FAT A;  5G18 A;  4KZB A;  3MZF A;  2W1T B;  4LFU A;  1LSW A;  1N9B A;  3QNC A;  4PM7 A;  2Y2K A;  5EM1 A;  2QZ6 A;  4BMW A;  4S2P A;  2PAV P;  3FZC A;  2RCX A;  4P0M A;  3A3F A;  4UEY A;  3CAX A;  3ZHH A;  3FKV A;  3IX8 A;  5D3O A;  4R38 A;  5CTN A;  3QP2 A;  3EQU A;  1S0W A;  4UA9 A;  4KZ5 A;  4JGO A;  3SW1 A;  4JXS A;  3SH8 A;  3NC8 A;  3S7O A;  1JWV A;  3FPW A;  3RXW A;  4S2M A;  2HJ9 C;  3MFD A;  1H8Y A;  4ZDX A;  2ZMF A;  1S4R A;  2L0W A;  5EOE A;  4ZBE A;  4WBG A;  3V3R A;  5DTS A;  4NXF A;  2X71 A;  3NEC A;  5F6A A;  5E43 A;  3ZNY A;  2HF6 A;  2Y59 A;  3DWK A;  1YQS A;  2JN7 A;  3IF5 A;  4LCM A;  3LIA A;  4QHC A;  4ME4 A;  1BZA A;  4P85 A;  4ARZ B;  3I7J A;  4E3J A;  3HBR A;  5F83 A;  1FCN A;  4G3W A;  2L1M A;  5G4Y A;  2W3G A;  4UAA A;  4ZJ2 A;  5AQA A;  3MS6 A;  5IU1 A;  3ITB A;  4KZ8 A;  2P04 A;  5FDH A;  2ZM0 A;  5EVI D;  2J3T C;  1ONG A;  4C3Q A;  2D02 A;  4PHT A;  1K6S A;  3UPO A;  1PW8 A;  2INW A;  4EQI A;  2OAQ 1;  1LT0 A;  5F82 A;  3T4Q A;  4C6Y A;  3UB7 A;  4K08 A;  4LGW A;  5A92 A;  4OP8 A;  1W7F A;  3HJI A;  3ZVT A;  4MN5 A;  2MJ6 A;  4BLM A;  4LEN A;  3KX0 X;  3PTE A;  1ZG4 A;  1ES3 A;  1HLU P;  4DN0 A;  3U2A A;  4BQM A;  3O87 A;  4DE1 A;  3H9W A;  3VSK A;  1Q2P A;  2GZA A;  4S2N C;  2WKR A;  2Y2L A;  1F98 A;  3LCE A;  1GA9 A;  2ZC6 B;  1DJC A;  4Y7P A;  4GS9 A;  4QY5 A;  3C5A A;  3S22 A;  4O7D A;  4WZ4 A;  4XUZ A;  3T4S A;  1PIO A;  4F3L A;  1E3U D;  4H6J B;  5DJT A;  4I3I A;  2XSS A;  2EFU A;  1MKM A;  2XK1 A;  5HDC A;  4HBT A;  1WYB A;  1T19 A;  3G32 A;  1H8Z A;  3OPR A;  3NBL A;  4KG2 A;  5CGW A;  4Y0O A;  4R3J A;  1T1A A;  2GX5 A;  4KG5 A;  4R70 A;  2Z6C A;  5HD3 A;  1KGE A;  4XT2 B;  4EEP A;  1W63 Q;  4CQH A;  3G6O A;  3MF0 A;  5F1F A;  1K54 A;  1TDG A;  1VHM A;  1L0F A;  5AVF A;  1E4D A;  3Q81 A;  4L9G A;  1I2W A;  3V5M A;  5CER A;  1SKO B;  2WZX A;  2PRF A;  2QYB A;  3IQA A;  3HUN A;  4PM6 A;  4X1L A;  2LB9 A;  3ZYT A;  2ZJ9 A;  5KZH A;  2P7J A;  3BJN A;  4P6B A;  3G34 A;  4CLC D;  3DW0 A;  5GHX A;  1PZP A;  3IHA A;  2XF3 A;  3BLM A;  3W4Q A;  1VET B;  2EWW A;  4OPY A;  2VGL S;  4BBU A;  3OPP A;  1YT4 A;  3RFB A;  4HQA A;  4Y3I A;  3IT9 A;  5EFW A;  1C3B A;  1DP9 A;  4X55 A;  3S4X A;  4GN2 A;  5G4Z A;  5I5L A;  1ES4 A;  3H7W A;  1MPL A;  3IH8 A;  1TVF A;  1SCW A;  5DFX A;  1K4F A;  1W8Q A;  2XA7 S;  4X25 A;  1SHV A;  1G68 A;  2DMW A;  4FCF A;  1XJ3 A;  2VA0 A;  3UN7 A;  1S6R A;  4PPR A;  1LHY A;  2W1T A;  5HD5 A;  3WS2 A;  3E2K A;  4G3V A;  4PKY A;  1OTE A;  3VP1 A;  4KEN B;  2JHE A;  1DY6 A;  2HV1 A;  3KO6 A;  1TEM A;  3P01 A;  4K0W A;  3W2Z A;  1NRJ A;  2PYP A;  1M6K A;  4GLQ A;  3NIA A;  3VOZ A;  3IXD A;  2OWH A;  2WGV A;  4FSF A;  2R78 A;  3UPN A;  1TS0 A;  4DE3 A;  4EER A;  3BYD A;  1CI8 A;  3G2Y A;  3SS4 A;  2WYX A;  1W79 A;  4EBL A;  5L2F A;  3LR4 A;  1SDN A;  2E8I A;  4HNB A;  4CLC C;  2Y2G A;  1FR1 A;  1XJ6 A;  4NKP A;  5J3W A;  1Z6F A;  3TJZ C;  1XX2 A;  3LIC A;  2ZL1 B;  5AVE A;  3R7W B;  3NJA A;  5HDD A;  5HAR A;  1UWP X;  4OQ0 A;  1IYQ A;  2P08 A;  1KE0 A;  3IS2 B;  2FH5 A;  4UA7 A;  1AXB A;  3NHQ A;  5FEF A;  4NEE D;  3U4L P;  4DJ3 A;  4KQO A;  5EE8 A;  3OPH A;  1GHI A;  4YNR A;  2O9A A;  4FTX A;  2Y4A A;  3G35 A;  2JKG A;  2VGL M;  1MC0 A;  2VK3 A;  2OSU A;  4N1H A;  4G3K A;  1IYS A;  5TFQ A;  1L0G A;  1HD8 A;  3F1P B;  4HJ6 A;  1WE4 A;  3BEB A;  5HFO A;  5HPI A;  1YLT A;  3KSH A;  5EVL A;  2Y91 A;  1FSY A;  4JF6 A;  5AQ9 A;  5EV0 A;  3NOP C;  3C38 A;  4R4R A;  1K57 A;  5FQM A;  1HVB A;  2K31 A;  2G2W A;  3PBQ A;  1BLH A;  5GHY A;  4WLA A;  5M1A A;  4DXC A;  2VV6 A;  5GL9 A;  2WKP A;  1T1C A;  1YMS A;  4UQI M;  3UPP A;  2J9P A;  4L0L A;  5DF7 A;  4JXG A;  3ZG9 B;  3HLF A;  2V20 A;  4EBN A;  4A5R A;  4E3K A;  5DF9 A;  3OCN A;  3SOI A;  4QU3 A;  4U0T A;  4E04 A;  4OQI A;  4N92 A;  2KOI A;  5CHJ A;  2ZL1 A;  3E4P A;  4R1G A;  3ZGA B;  4HP9 A;  2EX2 A;  3KYQ A;  1XA7 A;  2VX8 A;  2WK0 A;  3JVV A;  4GD6 A;  3K2N A;  1KE4 A;  3CJM A;  1K55 C;  2JKR M;  1L3L A;  1NYY A;  3CI6 A;  4DRT A;  2Y2N A;  1MKI A;  4OPR A;  1SKO A;  3HLD A;  4ESP A;  4I3A A;  3TOI A;  2NUP C;  2B18 A;  2NUT C;  4GDN A;  4N9L A;  4GJ4 A;  4X69 A;  2G7U A;  1W63 M;  1TF1 A;  4O8G A;  4DDY A;  1ESI A;  2V1B A;  1K25 A;  3QP6 A;  3AGF A;  1IYO A;  2VGJ A;  1JNU A;  2XH9 A;  5DF8 A;  3NY4 A;  1VB6 A;  2VV8 A;  1MZU A;  3MJQ A;  3UB8 A;  2J3W A;  3Q82 A;  1S67 L;  4YIN A;  5CEB A;  1O07 A;  1XPB A;  4Y5F A;  1JVJ A;  1PRQ A;  4E3I A;  1J9M A;  1BUL A;  1DJA A;  1FCO A;  3LR3 A;  4KQR A;  2Y2Q A;  1G28 A;  1XP4 A;  4S2N A;  3P7N A;  1YLW A;  4WEJ A;  1FIK A;  5CHM A;  2HP5 A;  2PU4 A;  3CMZ A;  2OLV A;  4HIA A;  2JBF A;  3CIT A;  5FI6 A;  3NUL A;  1KGG A;  3IBR A;  1XKZ A;  3VMA A;  2L4R A;  4D2O A;  2JKT M;  4WZ5 C;  4BJP A;  3Q1F A;  5FEG A;  3NOT C;  1BSG A;  3VP0 A;  5M19 A;  5GHZ A;  3EGX C;  1CQA A;  2EWV A;  5TGF A;  3ZVW A;  2ZQA A;  2HDQ A;  3MMH A;  3MZE A;  3T12 B;  2ZD8 A;  3D9Y A;  5HPF A;  4QD4 A;  2Y79 A;  2D01 A;  4S2J A;  3RH8 B;  3UME A;  4JGR A;  5C5K A;  3EQV A;  2ZQ8 A;  4S2L A;  1ERM A;  2H0Y A;  5A91 A;  3BY9 A;  4MN6 A;  4X1M A;  1YMX A;  1VEU B;  4DKI A;  4WL9 A;  2XDM A;  1OTB A;  5EOO A;  4IVK A;  3MXR A;  2QKP A;  5EM0 A;  4NXG A;  4JXV A;  1K54 C;  4I38 A;  4UHU A;  2OOL A;  3LEZ A;  1G6A A;  3CZD A;  1LL8 A;  2GDN A;  2ZOH A;  5E2F A;  5HWT A;  3LIB A;  3NDE A;  1MY8 A;  5DKK A;  3BRM A;  4Y2F A;  3N4I A;  3V50 A;  1YLY A;  3PXP A;  2PD7 A;  4YWZ A;  1PFL A;  3OPL A;  2KLI A;  5HAP A;  4WEK A;  4E3M A;  4ZJ1 A;  4YOF A;  4KZ4 A;  4B4X A;  4FH2 A;  3WS1 A;  3F1P A;  2UV0 E;  1JTG A;  1A0K A;  1I2S A;  1YLJ A;  4LLO B;  3MQQ A;  3MKF A;  4QJG A;  4JGQ A;  4QY6 A;  3EEH A;  1GSV A;  4NG2 A;  3S7P A;  3AGD A;  1K57 C;  3A0S A;  2H10 A;  3BFE A;  3P98 A;  4F94 A;  1N9O A;  4WN5 A;  3BLS A;  2FFF B;  2Q9N A;  5FAQ A;  4EEU A;  3UMD A;  3BW6 A;  3BEC A;  3S1Y A;  1YPR A;  3HRE A;  1MWS A;  4GW9 A;  3SH7 A;  3IWQ A;  1JWP A;  3GRJ A;  2W3H A;  4IJG A;  4H8R A;  1ALQ A;  2J9O A;  3G31 A;  4IBR A;  4RX3 A;  4KUK A;  2W3D A;  1OPX A;  4LV3 A;  3H82 B;  4MMN A;  2H28 A;  4K91 A;  1IEM A;  2JKR I;  1K6R A;  3BFG A;  2I72 A;  3PBN A;  1IYP A;  1ES2 A;  2P9V A;  2ZOI A;  2JC7 A;  3MXS A;  4EU0 A;  4Y17 A;  4ZJ3 A;  5CX7 A;  5KSH A;  2K7S A;  5CHU A;  5TR7 A;  4S2O A;  3UDX A;  4EWF A;  3M2J A;  2PD8 A;  4ETZ A;  1XJ4 A;  1WYC A;  2XEP A;  3KSF A;  4KZ7 A;  1K0K A;  1NWZ A;  3KSI A;  4OKP A;  5EVI C;  1KE3 A;  4EUV A;  2M7U A;  3QHY A;  1MBL A;  2VJW A;  4NK3 A;  1J3W A;  4HY8 A;  1OT9 A;  3L7H A;  1H3Q A;  1ZKJ A;  1E3U A;  5FQ9 A;  3DTK A;  3KYZ A;  1N9N A;  3O88 A;  4LCL A;  5CGX A;  4OOY A;  3GV9 A;  2X01 A;  4WMC D;  5HL6 A;  4HI4 A;  3PAE A;  3WRZ A;  2HJE A;  3BY8 A;  4PMA A;  2WKI A;  2WAE A;  3M2K A;  1O7E A;  1EI5 A;  1YM1 A;  3LI9 A;  1IEL A;  5HZH A;  4ID4 A;  1UGU A;  3SS5 A;  5E2H A;  3IF6 B;  1PZO A;  4HEF A;  3C8C A;  1MWR A;  2KDK A;  2C6W B;  1ESU A;  2A2L A;  4GCZ A;  3B3X A;  2JKF A;  3CPT A;  4Z1W A;  1RGY A;  3H82 A;  4LV1 A;  3BWL A;  3DBA A;  4PAU A;  1FQG A;  3DTI A;  3EEA A;  4X6T A;  4M4X A;  3A3D A;  5CTM A;  3N7W A;  2M1C A;  2ZM2 A;  3BM6 A;  3D4F A;  2Y55 A;  3PBO A;  3LEQ A;  1FIL A;  1NYM A;  1SKF A;  2ZLY A;  4LRZ E;  5HAQ A;  4NXB A;  1L0E A;  3WWX A;  2XR0 A;  1H0M A;  1ERQ A;  3MSH A;  2RL3 A;  2HDR A;  1CI9 A;  5M18 A;  5DTT A;  1YSQ A;  2AVX A;  2CC1 A;  2Y2J A;  3UDI A;  1KOU A;  4DE0 A;  3IH9 A;  4KG6 A;  2WKH A;  4EV4 A;  5DVA A;  4OPZ A;  3A3I A;  4LPZ A;  5IT5 A;  3FKW A;  3NCK A;  5TJJ A;  4HBU A;  2B95 A;  3A0V A;  4FUW A;  4X68 A;  1LL5 A;  1P9W A;  1VEU A;  5L8M A;  2QJ7 A;  3UE1 A;  4FOF A;  3LY4 A;  1U60 A;  3T1R A;  3V3S A;  2Z2L B;  1ZC2 A;  2QPN A;  5FQI A;  1PNE A;  2W1R A;  1PYY A;  2V1A A;  3CWF A;  3IWI A;  1GSX A;  3BQA A;  4OPQ A;  4DF6 A;  4F3L B;  1NZO A;  3S7Q A;  3F1O B;  3VSL A;  2EXA A;  5A93 A;  4DMZ A;  3R4K A;  3CG5 A;  3DAV A;  4LV0 A;  5FQQ A;  2OAP 1;  1Z09 A;  4BD1 A;  3MXQ A;  4E6X A;  1HTZ A;  3E0Y A;  1BLS A;  3WS5 A;  5DTK A;  4DE2 A;  2R9W A;  3SH9 A;  2EX6 A;  1UWN X;  4U3T A;  1LLB A;  4BD0 A;  4Y13 A;  5AJG A;  3HCY A;  4BL3 A;  2J3T D;  1S4S A;  1G5U A;  3EWK A;  3QP5 A;  3SZT A;  1MWT A;  2K2N A;  3A3E A;  1YLZ A;  1OME A;  5HW3 A;  4RX2 A;  1XA1 A;  1YAX A;  1OTA A;  3BFC A;  4R3A A;  5F68 A;  4OQH A;  3IHB A;  3M6B A;  2PYR A;  3IXB A;  1H5X A;  5L10 A;  2O9B A;  4R23 A;  2IWC A;  3NDG A;  4EET B;  3IX4 A;  3BFD A;  3L9K A;  3ZNT A;  4E3O A;  1W5D A;  2HDS A;  3VE3 A;  2HPB A;  2HGV A;  5HAI A;  1KGF A;  3LI8 A;  3HJK A;  2IA2 A;  4B88 A;  3JYI A;  3C4P A;  1XJ2 A;  5FAO A;  2PT7 A;  3MKE A;  3Q7V B;  3VFH A;  3ICY A;  1S66 L;  4D60 A;  4OQG A;  2BTF P;  2Y2P A;  4CJN A;  4KQQ A;  3A3J A;  3HLW A;  2W3E A;  1ZTU A;  5HDS A;  1PWG A;  4P6Z S;  2Z2M B;  2VKS A;  3D3O A;  5HL1 A;  1D1J A;  3LGO A;  3UB5 P;  1ZHH B;  3HLB A;  2EX8 A;  3E2L A;  2XD5 A;  1JTD A;  4ZAM A;  1ZG6 A;  1V9Y A;  4RYE A;  3CLO A;  1LI9 A;  1RCJ A;  1LI0 A;  4UA6 A;  5CRF A;  3M6H A;  3WS4 A;  5L09 A;  4L9E A;  5E2G A;  3P09 A;  4MDZ A;  1OT6 A;  1P97 A;  3VP4 A;  1BLP A;  1STZ A;  1AWI A;  1FR6 A;  2XFS A;  1Y4O A;  2QJ5 A;  4QWO A;  2DRW A;  2O9C A;  2CMN A;  4MBH A;  5FL3 A;  1ONH A;  4JLF A;  3W8K A;  1KVL A;  2WKE A;  4CPK A;  2G2U A;  3HUO A;  1VM1 A;  1K55 A;  4GHI A;  3VFF A;  4JBF A;  3DTM A;  2WAF A;  4IBX A;  3T4T A;  2GNX A;  3OOV A;  3KSG A;  5GLA A;  1LSV A;  2PR6 A;  1N4O A;  3Q7V A;  3VE4 A;  4CLC B;  1PI5 A;  2Z6D A;  1SZV A;  1GHM A;  1YLP A;  1IKI A;  1ODV A;  4O0P A;  3QP4 A;  1PW1 A;  3T4O A;  1CEF A;  2Q9M A;  3ZG0 A; 
#chains in the Genus database with same CATH homology
 4KUK A;  2W3D A;  4AFI A;  2HV1 A;  3E4O A;  3UB6 A;  4KQD A;  1OPX A;  2YKH A;  3KO6 A;  3P01 A;  4GS9 B;  3H82 B;  3MR0 A;  4MMN A;  1T18 A;  3W2Z A;  3K3C A;  2H28 A;  1NRJ A;  2PYP A;  4EXO A;  4MCW A;  2GJ3 A;  3S7N A;  4GLQ A;  1BYW A;  1S1Z A;  2JKR I;  2W3F A;  3PBN A;  2OWH A;  4H6J A;  1F5M A;  4FSF A;  3EGD C;  1OJ5 A;  2R78 A;  3C30 A;  1TS0 A;  5J4E A;  2ZOI A;  4EU0 A;  4EER A;  1GSW A;  3OC2 A;  5CX7 A;  5F5Y A;  5KSH A;  2K7S A;  5DJU A;  2V9A A;  1XFQ A;  3LR4 A;  3PBT A;  4HNB A;  4CLC C;  4EQ1 A;  1H8M A;  4EW7 A;  2KX6 A;  1XJ6 A;  2PD8 A;  4ETZ A;  4NKP A;  5J3W A;  1XJ4 A;  3LIF A;  3E98 A;  3TJZ C;  3KSF A;  3A0R A;  1NWZ A;  3KSI A;  4EUV A;  1D06 A;  3LIC A;  2PDR A;  5AVE A;  2ZBB A;  3H7W B;  4I5S A;  1NLY A;  2M7U A;  3R7W B;  4JGP A;  2VJW A;  3NJA A;  4XT2 A;  5HDD A;  1IFQ A;  4HY8 A;  1UWP X;  1OT9 A;  4P6Z M;  2P08 A;  1H3Q A;  3IS2 B;  2FH5 A;  1XFN A;  1V9Z A;  4OOL A;  3NHQ A;  3KYZ A;  4NEE D;  3PYP A;  1N9N A;  3JVU A;  5F69 A;  4DJ3 A;  1OJG A;  4HJ3 A;  1WA9 A;  4KQO A;  5HWV A;  4YNR A;  5A8B A;  4RQ9 A;  1N9L A;  2O9A A;  3CUE C;  4HH3 A;  5IS1 A;  5HL6 A;  3LIE A;  1P9R A;  2VGL M;  3MFX A;  1MC0 A;  4HI4 A;  1TS7 A;  2HJE A;  3BY8 A;  3LYX A;  4G3K A;  3LR5 A;  3LI9 A;  5TBM A;  4CLC A;  4WF0 A;  5HSQ A;  5HZH A;  4HHD A;  3R7W A;  1UGU A;  1DP6 A;  4NXE A;  2PHY A;  3RTY A;  2V0U A;  3F1P B;  4HJ6 A;  1T1B A;  2VEA A;  3FPV A;  5HPI A;  3C8C A;  3KSH A;  2KDK A;  3VOL A;  2A2L A;  4GCZ A;  2B02 A;  3LR0 A;  4Z1W A;  3T4L A;  4DJ2 A;  3MQ0 A;  2VZW A;  3H82 A;  3BWL A;  4BBT A;  3DBA A;  4PAU A;  3EEA A;  1TS8 A;  3NOP C;  3C38 A;  4M4X A;  3F1N B;  2V0W A;  3LFV A;  3F1O A;  4I39 A;  2M1C A;  2K31 A;  5KIZ A;  3PBO A;  3PBQ A;  3TE8 A;  4I3J A;  4WLA A;  2VV6 A;  3C2W A;  4LRZ E;  1LSX A;  1Y28 A;  3IBJ A;  1G6O A;  2WKP A;  2W1T B;  4NXB A;  1T1C A;  1LSW A;  4UQI M;  4L0L A;  3IS2 A;  2W0N A;  4BMW A;  5DF9 A;  3OCN A;  1YSQ A;  4UEY A;  3CAX A;  4E04 A;  1IOU A;  1KOU A;  4ZRR A;  2KOI A;  4IHQ A;  4R38 A;  3E4P A;  3EQU A;  3OLO A;  4LPZ A;  5IT5 A;  1TD5 A;  4HP9 A;  5TJJ A;  3KYQ A;  4R6L A;  4JGO A;  3SW1 A;  2VX8 A;  3JVV A;  3E4Q A;  4WEL A;  3S7O A;  3K2N A;  2J80 A;  3A0V A;  3FPW A;  2A24 B;  2HJ9 C;  4Q0J A;  1P9W A;  4ETX A;  3LID A;  2ZMF A;  2JKR M;  5L8M A;  1S4R A;  2QJ7 A;  2L0W A;  2OWJ A;  3CI6 A;  4FOF A;  4LRY C;  2QHK A;  4NXF A;  2VLG A;  5F6A A;  2HF6 A;  5DFY A;  3ZQ5 A;  2M7V A;  1DP8 A;  2JN7 A;  3LIA A;  4ME4 A;  2W1R A;  1X0O A;  4I3A A;  2NUP C;  2B18 A;  2NUT C;  4ARZ B;  2V1A A;  3B47 A;  3CWF A;  1GSX A;  3BQA A;  4G3W A;  4GJ4 A;  5MC7 A;  4F3L B;  2L1M A;  3S7Q A;  2G7U A;  1W63 M;  1TF1 A;  3F1O B;  3GDI A;  3PHY A;  4O8G A;  5G4Y A;  1P0Z A;  2W3G A;  2V1B A;  4DMZ A;  3R4K A;  2YKF A;  3LUQ A;  4HH2 A;  2OAP 1;  5IU1 A;  1EW0 A;  3MXQ A;  2P04 A;  3E0Y A;  2J3T C;  1JNU A;  2D02 A;  1UWN X;  4PHT A;  3F1N A;  1VB6 A;  2INW A;  2VV8 A;  1MZU A;  3MJQ A;  2OAQ 1;  4Q0I A;  3K3D A;  5AJG A;  2J3W A;  3O5Y A;  3UB8 A;  2ZMV A;  1LT0 A;  3HCY A;  3T4Q A;  2J3T D;  1S67 L;  3UB7 A;  1S4S A;  4K08 A;  3TRC A;  3EWK A;  1TS6 A;  5HWW A;  2K2N A;  3HJI A;  5DKL A;  4MN5 A;  3V67 A;  4Y5F A;  4O01 A;  2MJ6 A;  1DRM A;  3KX0 X;  1YAX A;  1OTA A;  3UB9 A;  2QWS A;  3LR3 A;  4DN0 A;  5F68 A;  4R3A A;  3U2A A;  1G28 A;  2I9V A;  4HOI A;  3P7N A;  2PYR A;  3B42 A;  2O9B A;  3H9W A;  2XRO A;  2GZA A;  2WKR A;  4EET B;  2O0Y A;  4WEJ A;  4L9F A;  1F98 A;  4LRX C;  4MN7 A;  3VE3 A;  4GS9 A;  2HGV A;  2EA9 A;  4B9O A;  4HIA A;  4HJ4 A;  3CIT A;  3OBF A;  2A24 A;  3LI8 A;  3T4S A;  3HJK A;  3IBR A;  1S1Y A;  2LB5 A;  4F3L A;  2IA2 A;  2L4R A;  2JKT M;  4BJP A;  4H6J B;  5DJT A;  3T4J A;  3NOT C;  4I3I A;  2BAS A;  1XJ2 A;  2XA7 M;  2PT7 A;  2XSS A;  3ICY A;  1MKM A;  3EGX C;  5HDC A;  1S66 L;  2EWV A;  3BQ8 A;  4WUJ A;  3MMH A;  2W3E A;  1T19 A;  1ZTU A;  4BWI A;  5HPF A;  3NOU C;  5HDS A;  2Y79 A;  2D01 A;  4P6Z S;  3RH8 B;  3UME A;  4JGR A;  5C5K A;  2VKS A;  3EQV A;  1T1A A;  2GX5 A;  3D3O A;  3D72 A;  4R70 A;  2Z6C A;  5HD3 A;  1ZHH B;  4IUK A;  3BY9 A;  4MN6 A;  3FC7 A;  4XT2 B;  4WL9 A;  3T4K A;  1OTB A;  4EEP A;  1W63 Q;  4CQH A;  3G6O A;  3MF0 A;  3ULF A;  2O99 A;  1V9Y A;  4IUH A;  2QKP A;  1VHM A;  4NXG A;  4GHI B;  2W27 A;  5AVF A;  4L9G A;  1OTI A;  3UE6 A;  3CLO A;  4I38 A;  2OOL A;  1LL8 A;  2QYB A;  2ZOH A;  5K5B A;  3CUE A;  4ARZ A;  4L9E A;  4B93 A;  2LB9 A;  5HWT A;  1OTD A;  4OOM A;  3LIB A;  5DKK A;  4Y2F A;  2VV7 A;  1OT6 A;  4MDZ A;  3ZYT A;  4EES A;  4PKY G;  1P97 A;  4BBV A;  3PXP A;  1STZ A;  2P7J A;  4HP4 A;  2PD7 A;  3BJN A;  3T50 A;  4CLC D;  4YWZ A;  3FG8 A;  2QJ5 A;  3GEC A;  2KLI A;  2O9C A;  4WEK A;  2CMN A;  5FL3 A;  4YOF A;  2EWW A;  1NLZ A;  2VGL S;  3F1P A;  3OCL A;  4BBU A;  3RFB A;  4KUO A;  4HQA A;  4Y3I A;  4LLO B;  3EOI A;  1D7E A;  5EFW A;  3MQQ A;  3VV4 A;  2FZ0 A;  1YKD A;  4GHI A;  1DP9 A;  4JGQ A;  3MQO A;  5G4Z A;  3TW8 A;  3EEH A;  1GSV A;  5I5L A;  3PBS A;  3S7P A;  3H7W A;  3T4T A;  4UQI S;  5J7E A;  2GNX A;  5DFX A;  3A0S A;  2XA7 S;  1N9O A;  2WKQ A;  4WN5 A;  3OOV A;  2PR5 A;  2DMW A;  4EEU A;  3KSG A;  1LSV A;  2PR6 A;  3UMD A;  1XJ3 A;  2VA0 A;  3BW6 A;  4II7 A;  5LBR A;  3PR6 A;  3VE4 A;  5TBM B;  4CLC B;  2Z6D A;  4CLC E;  3UE3 A;  2W1T A;  4GW9 A;  2Y8H A;  5HD5 A;  1ODV A;  4O0P A;  2XRN A;  4QPR A;  2W3H A;  1YSP A;  4IJG A;  4G3V A;  4PKY A;  1OTE A;  3B33 A;  3PBR A;  2JKT I;  3T4O A;  4Q0H A;  2JHE A;  1F9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...