3B33A

Crystal structure of the pas domain of nitrogen regulation protein nr(ii) from vibrio parahaemolyticus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
TSLPSAILNNMVTATLILDDGLAIRYANPAAELLFSQSAKRIVEQSLSQLIQHASLDLALLTQPLQSGQSITDSDVTFVVDGRPLMLEVTVSPITWQRQLMLLVEMRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of PAS domain of nitrogen regulation protein NR(II) from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Transferase
molecule keywords Sensor protein
total genus 24
structure length 109
sequence length 109
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3b33A00
3K3CA 1TS6A 3BY9A 2L1MA 1OTBA 4F3LA 4HJ6A 1JNUA 1T1AA 3LI8A 5J3WA 3B33A 4XT2A 2R78A 4L9GA 3LIDA 5IU1A 3F1OA 3NOUC 5TBMB 3MR0A 4GHIB 4HNBA 5F68A 2WKQA 4I3IA 5HDDA 1X0OA 3GECA 3MJQA 2W27A 4PKYG 4R38A 4EW7A 4HI4A 1LL8A 3BWLA 3FC7A 1F98A 3K3DA 4GS9B 4BBUA 5J4EA 5HSQA 5F6AA 4I3AA 3LICA 1OT9A 4M4XA 4WF0A 2Z6DA 2YKHA 3ULFA 4EEPA 4R6LA 4EETB 3H7WA 1NWZA 1P97A 3CLOA 2L4RA 2D01A 3H82B 2V9AA 3NHQA 4K08A 2VV6A 4YWZA 5J7EA 1GSVA 2V1AA 4WLAA 2OWHA 2B02A 2PHYA 1VB6A 1XJ6A 5DKLA 1D06A 3RH8B 2KDKA 2ZOIA 3MXQA 1LSVA 1XFQA 3LIFA 5HZHA 4EEUA 4HJ4A 2PYPA 2OOLA 3EEHA 5AVFA 3E4QA 5IS1A 1F9IA 4L9EA 5HWTA 3NJAA 1XJ2A 2OWJA 1DP8A 1OTIA 3H82A 4GHIA 4PKYA 4R70A 4B9OA 1T18A 2PD8A 3UB9A 1S4SA 4LRXC 4RQ9A 3E4PA 4GS9A 4HY8A 2GJ3A 2J80A 3LIEA 3UMDA 1TS7A 1TS8A 1DP6A 4WL9A 4NXFA 2VV8A 1T1BA 2P7JA 3D72A 3E4OA 2WKPA 3H9WA 3UMEA 4KUKA 5HDCA 2VV7A 4HP4A 1KOUA 4LLOB 4WN5A 4LRZE 3MFXA 5HD5A 4HP9A 3UB7A 2A24B 1D7EA 1S1ZA 3LIBA 1UGUA 4LRYC 2QJ7A 5I5LA 4BBTA 3NOTC 1ODVA 1S67L 1OTEA 4GW9A 2INWA 5DKKA 2EA9A 4MN6A 2D02A 1OJ5A 2VLGA 5AVEA 3UB8A 5TBMA 3UE6A 4LPZA 2ZBBA 3UB6A 4HH3A 2VEAA 1T1CA 1LT0A 1OTDA 4JGPA 2QHKA 4I39A 3CAXA 3KX0X 4NXBA 1S66L 2CMNA 1XJ3A 2PD7A 1S1YA 4NXGA 3VE3A 1S4RA 3VOLA 3HJIA 1MZUA 1UWPX 2L0WA 2A24A 3F1NA 3BY8A 3PHYA 4HJ3A 1Y28A 1OTAA 4KQDA 2PR5A 1GSXA 2BASA 2QJ5A 3H7WB 1DRMA 4HH2A 4HHDA 2QKPA 2ZOHA 1XJ4A 2YKFA 3LIAA 3A0VA 2I9VA 3P7NA 3ICYA 2V1BA 5A8BA 3F1NB 4R3AA 5G4YA 2JN7A 1V9YA 2K7SA 3IBRA 4H6JB 5EFWA 1EW0A 2KX6A 3IS2A 1T19A 4KUOA 3C2WA 5G4ZA 5HD3A 4EQ1A 3RTYA 4JGQA 4JGRA 4JGOA 4BBVA 3LI9A 5F5YA 1OJGA 5DJTA 1GSWA 1TS0A 4F3LB 4GCZA 2HV1A 4HIAA 2Z6CA 2V0UA 3MQQA 5DJUA 5F69A 2M1CA 1G28A 4DJ3A 3F1PB 3CWFA 2PYRA 3F1OB 1BYWA 3EWKA 4I3JA 4I5SA 4XT2B 4EXOA 3OLOA 1N9OA 3T50A 4HQAA 2W0NA 1N9NA 1XFNA 2WKRA 3A0RA 3IS2B 3LUQA 4H6JA 3VE4A 5HWWA 3GDIA 1DP9A 1LSXA 4E04A 3PYPA 3G6OA 5HWVA 5HDSA 3A0SA 4HOIA 2QWSA 4I38A 4WUJA 3C8CA 1P0ZA 2JHEA 4EESA 1WA9A 4MN5A 3LYXA 1OT6A 3NOPC 2V0WA 4EERA 1LSWA 3FG8A 4NXEA 4DJ2A 1N9LA 5KIZA 4L9FA 2PR6A 3ZQ5A 3MQOA 3F1PA 3SW1A 1UWNX 2PDRA 3HJKA 2H28A 1V9ZA
chains in the Genus database with same CATH superfamily
4E3MA 3KO6A 1ONHA 1Z09A 1K4FA 4K0WA 1YMXA 4D60A 2E8JA 1C3BA 4EW7A 4HI4A 3BWLA 2VGLS 4P6ZS 5F6AA 4M4XA 1NWZA 3H82B 1IKGA 3EGDC 5EVIC 5E2GA 4DKIA 4N9LA 2KDKA 2ZOIA 1KVLA 2ZQ9A 3IX3A 4KG6A 3NY4A 2PD8A 3VOZA 2WGIA 1PFLA 5FDHA 5HX9A 5JYOA 4MEZA 4DXBA 1DJCA 2P7JA 3E4OA 5DTKA 3NI9A 4EWFA 2JE5A 4HP4A 4R23A 3G34A 1D7EA 4BBTA 1ES4A 3D9YA 5DFYA 2ZQ8A 3UB8A 1CI8A 3UB6A 3A3DA 4IBRA 5A91A 1K0KA 4EBPA 1MZUA 5F1FA 4HJ3A 1VEUA 2PR5A 2PRFA 3HVFA 3PBNA 2HP9A 3ZYTA 3P7NA 5EVLA 1I2WA 3IS2A 5CGWA 2XDMA 3RTYA 4JGRA 2A3UA 1KDWA 5DJTA 3VFFA 4YFMA 1K38A 3LEQA 3GVBA 4B88A 1L2SA 5DJUA 3MQQA 5AQAA 1CEFA 3CWFA 4P6BA 4XT2B 1JVJA 4R3BA 1D1JA 4ZRRA 4LGWA 1K57A 2WADA 3LYXA 1CF0A 1H3QA 4ZDXA 3SW1A 1GCEA 5AJGA 3OC2A 1TS6A 4B93A 1S6RA 2GNXA 3UDIA 2K2NA 4P0MA 2J9PA 5DF9A 2R9WA 3C38A 2WKHA 3TRCA 3C5AA 4GS9B 1BTLA 3ITAA 2JKRI 2JCHA 1OT9A 4OOLA 4CQHA 3V5MA 3LY3A 2HZ5A 5JYPA 1SDNA 1WYBA 2GZAA 2IWBA 2OSUA 1LI9A 3RXXA 1MXOA 1YT4A 2I72A 3C7VA 2Y91A 1AWIA 4B4ZA 2JC7A 4LV1A 4OONA 4WZ5C 4LRXC 4RQ9A 2ZL1B 4GS9A 1P9WA 2Y2PA 4KQQA 4LRZE 2A24B 4LRYC 1EI5A 3T4TA 5DKKA 1H5XA 3UB5P 4BMWA 3ZCZA 3ZG0A 4JGPA 3T4KA 3UO9A 4NXBA 3PHYA 3VP1A 2AVXA 1W79A 1W8QA 2QKPA 2ZOHA 3HLGA 4FCFA 5CEBA 2V1BA 2JN7A 3UDXA 2Q9MA 5E2EA 1KGEA 3EQUA 4OLGA 3IBJA 4ESPA 2G7UA 4GCZA 4BD1A 1FILA 1QMFA 2W1TA 4EXOA 4N1HA 5GHZA 5FA7A 4H6JA 4GZBA 4EESA 3ZNYA 1KE0A 3BFEA 1OT6A 4S2PA 3ZHHA 1LSWA 3ZQ5A 4S2KA 1HZOA 4EBNA 4R4SA 3HCYA 2JKRM 3MMHA 4XT2A 4L9GA 3LIDA 2VZWA 1L3LA 1X0OA 4S2LA 1XA7A 1U60A 4C3QA 3K3DA 1RGZA 4EETB 4EEPA 5FQIA 1FCOA 1VQQA 3WS2A 1VETB 2PHYA 1EROA 1YM1A 1NZUA 1XFQA 3DTIA 4E6XA 2V1ZA 2ZM0A 3MZFA 4L9EA 4OP5A 4B9OA 2HJ9C 3C4PA 1GHIA 5FI7A 3NDGA 4UHUA 1W63Q 2WKPA 2ZQDA 3O3VA 5HDCA 1GHMA 4EQIA 3HREA 3VSKA 4HP9A 4UEYA 2LB5A 2O9CA 1OJ5A 3HLWA 1NJ4A 4E3IA 3BECA 1PWGA 1S66L 1K55A 3VE3A 3LR5A 2EFUA 5F1GA 3PAGA 3BFDA 4MN7A 1OTAA 2Y2LA 2Y55A 2I9VA 4KZBA 1BULA 5AQ7A 5G4YA 3U2AA 4CLCD 5CHMA 1T19A 4U0TA 1NY0A 2HV1A 2HPBA 5FQ9A 4DJ3A 4Q8IA 3PBQA 2PYRA 3G35A 4UA9A 4DN0A 3E0YA 5FI2A 4Z1WA 2GX5A 1SZVA 1YLYA 3S7NA 4UA6A 1SKOA 4O0PA 3MQOA 3VOYA 1NRFA 3K3CA 1L0EA 1MKIA 4F3LA 4Y13A 2PAVP 5HL1A 2WKQA 4I3IA 2Y2GA 5J4EA 5FDSA 1YMSA 2YKHA 2XRNA 5K5BA 4BQMA 4FOFA 1KE4A 3EGXC 3HLEA 4EV4A 3JVUA 3V67A 3E2KA 2VJWA 3TE8A 1VHMA 2WAEA 3KSHA 4OH0A 2Y2JA 4GDNA 2WKIA 3HL9A 1KDSA 5TGFA 3A3IA 3FPVA 1KOUA 5FAQA 1LHYA 4KQRA 1FSYA 4YINA 2W3DA 2WAFA 1PNEA 2VLGA 1TDLA 4K91A 2WGWA 3PXPA 4UAAA 4EU0A 2XFTA 3UPPA 5HL6A 4OQIA 4ZBEA 2YKFA 2EX9A 4R3AA 3IBRA 3EEAA 4AFIA 1E3UD 2O9BA 3GMWA 3B42A 4H8RA 4O8GA 3AGDA 3N8RA 1I2SA 4YOFA 1BYWA 1Y54A 2WUQA 2B5RA 2WKRA 3S4XA 3OPPA 1G6AA 3VE4A 4EBLA 3PBTA 4M3KA 3SH8A 4L9FA 4D2OA 1E25A 3IX4A 4Q0JA 1T1AA 3LI8A 5TBMB 1VETA 2J3WA 3GECA 3HLCA 2FZ0A 4GD8A 3QNBA 1H0MA 5EECA 4P87A 3NDEA 3CLOA 4Z9QA 2V9AA 4QB8A 5CRFA 1GSVA 2V1AA 4OPQA 1PYYA 3QHYA 5A93A 1MWRA 5AVFA 1OTIA 3G4PA 4FH4A 4JXVA 1LL5A 3T1RA 4OLDA 4Y0TA 3MFXA 3ZG5A 1FR6A 2EWVA 2JBFA 1GHPA 2Y2QA 4Y7PA 4MN6A 3Q7ZA 1XX2A 4UQIS 1GA9A 1NXYA 3HLFA 1O7EA 4UA7A 1DRMA 4HH2A 3OPRA 4JF6A 2XGNA 2K7SA 1V9YA 5EOEA 3HUMA 3ZGAB 1EWZA 3CHWP 2UWXA 2H0YA 1GSWA 5BOHA 3HUNA 3W4OA 3PBOA 1N9OA 1PIOA 2QZ6A 2Y2MA 2ZM2A 3N6IA 4DDSA 3DWKA 4X53A 5HDSA 4CPKA 3OCNA 5EM1A 1DJBA 1HTZA 1V9ZA 1PRQA 3M2JA 2L1MA 4RA7A 2H10A 1JWPA 3UDFA 2DRWA 4OP8A 3T4JA 4PKYG 1KGFA 1IELA 3BFGA 1F98A 4UQIM 4BBUA 4WF0A 2RL3A 5FAOA 4IUHA 4MBKA 5FI6A 4XUXA 1ERQA 2B02A 1XJ6A 2JKGA 5M18A 1J3WA 2ZC6B 3EEHA 3CUEA 4EUVA 5HPFA 3LGOA 1PI5A 4L0LA 5EOOA 5FAPA 1TS8A 2BG1A 5L10A 4S2NC 4IHQA 4JLFA 3WS1A 3UE1A 2KOIA 2H5SA 2Y79A 5HAIA 3VV4A 5IHVA 1L0FA 5FSRA 1O07A 3V3SA 3CAXA 2W1TB 1IKIA 1S1YA 3B47A 3DBAA 4KQDA 3MZEA 3KYEA 3LY4A 3IXDA 2P74A 4BLMA 1S0WA 2PT7A 2ZMVA 4LV3A 1YLWA 5DVAA 1SKFA 1OPXA 1OJGA 3TW8A 4N9KA 3R7WA 4WM9A 2IA2A 3IWOA 1IOUA 4WYYA 4E3JA 4S2JA 2FH5A 4HQAA 2W0NA 4IUKA 4U3TA 4GNUA 1KVMA 2X71A 5HARA 3T1QB 2P9VB 2VA0A 3EOIA 4NEED 4EERA 3S7PA 3DTMA 3HJKA 1Q2PA 5C5KA 1CK3A 2NUTC 4LCLA 1SDEA 4P6ZM 3VP0A 3TJZC 1TF1A 1SKOB 4JBFA 4LFUA 3BJNA 3H7WA 5CECA 3QP6A 5DKLA 2ZC5B 3SS5A 3ZG8B 3FZCA 3NJAA 3CG5A 2GDNA 1S4SA 1XP4A 1G6OA 4ETXA 1KGGA 4Y0UA 4WL9A 3H9WA 1CQAA 2MJ6A 4KQOA 1G68A 4LLOB 1ZC2A 4Y5FA 1K55C 4QJGA 2XR0A 2Z2MB 4X1MA 1YPRA 5FQKA 3R7WB 2EXBA 2VEAA 4X6TA 3O5YA 1PZPA 1XJ3A 2L0WA 2DNSA 1MY8A 1TD5A 3Q1FA 4FD8A 5HD3A 5A90A 1YLZA 2M1CA 2HDSA 4GOGA 5EVIB 3T50A 2G2WA 3IS2B 2HDUA 2JKFA 5FATA 3A3FA 4RX2A 3L9KA 1P0ZA 4X56A 1WA9A 3QP1A 3FWLA 3VP4A 4WBGA 5D3OA 1UWNX 3NHQA 3WS5A 2P08A 3TOIA 1WE4A 3CUEC 5E2FA 4O01A 3UPNA 1F2KA 3KSGA 3FPWA 1LI0A 3OPLA 2DCFA 3G31A 2XA7M 2L4RA 2VV6A 3GSGA 1KE3A 4IVIA 3DAVA 2X02A 3RH8B 3ZFZA 1LSVA 3LR0A 4MLLA 1L0GA 4OKPA 2V20A 5L07A 2BTFP 3TSGA 3TG9A 4OOMA 3E4PA 2QMIA 3KSFA 1K6SA 3QP2A 4X25A 3UMEA 1K25A 4WN5A 5HD5A 1HD8A 3GTCA 5TFQA 3OPHA 1Q2QA 5DTTA 4RYEA 1K57C 1YQSA 5FQMA 5AQBA 4U0XA 3H7WB 4HHDA 5A8BA 2R9XA 3MXRA 4PAUA 4EQ1A 3MBZA 3LEZA 1FCMA 4XXRA 3LI9A 1BSGA 4OQHA 2C6WB 4PM6A 4I5SA 2EX6A 5EM0A 3V3RA 1N9NA 4GN2A 1ESUA 4E04A 4S2IA 3N7WA 3P01A 1LL9A 2XSSA 4JXGA 1IYOA 2ZQ7A 2J3TD 2Y59A 4MBFA 3IF5A 2JKTM 2Y2HA 4B4XA 4GHIB 4HNBA 1A0KA 1VM1A 5DF8A 3OBFA 2Z6DA 5HSQA 3MXSA 2HJEA 3IWQA 2X01A 2W3FA 4E6WA 2HDQA 5KSCA 2QYBA 3FV7A 5GLBA 4CLCA 2VK3A 1JWVA 3C7UA 4FH2A 3T4OA 3IXHA 3LO7A 2FFFB 1DJAA 3G2YA 2J80A 1TS7A 4QWOA 2ZM8A 4NXFA 4PM9A 1ES3A 1UGUA 2OAP1 3O88A 3NOTC 4Q0HA 1OTEA 1S67L 3V50A 4LPZA 1T1CA 2O99A 3IF6C 1XGIA 3BLMA 1Y28A 3VP2A 2WZZA 2BASA 2QJ5A 2EXAA 1XJ4A 1DY6A 3V39A 5F82A 3E98A 1BLCA 3UE3A 5HFOA 4DDYA 4LCMA 1HLUP 3EWKA 1MWTA 4PM5A 4BL2A 1ONGA 3A0SA 4HOIA 3Q07A 2JHEA 4YNRA 2V0WA 1ACFA 4G3VA 2HF6A 4WLAA 3CMZA 3BY9A 3BYDA 1JNUA 4ZJ3A 3MR0A 3FC7A 4DE3A 1ES2A 1JTDA 4MCWA 2P9VA 4DE2A 2HP5A 1NLYA 2W3EA 4S2MA 2PU4A 4HESA 3IHAA 2XD5A 5HZHA 3T4LA 2OOLA 3HUOA 1AXBA 1T18A 1Z6FA 3ZVWA 2VV8A 3BRMA 3P98A 3VSLA 3CPTB 4GDBA 5I5LA 2EA9A 3DTEA 5CGXA 5TBMA 1ERMA 1JWZA 1PW8A 4C6YA 4E3OA 3CI6A 4Y3IA 3M6BA 3KYZA 4NXGA 4KZ9A 3NBLA 3IH8A 1MKMA 1YLPA 3BW6A 3F1NB 5EFWA 4E3LA 5G4ZA 5M1AA 4JGQA 2OLVA 4KZ8A 2ZJ9A 2Z6CA 1MWSA 1SHVA 2VGJA 3GV9A 3LR4A 1SCWA 2XROA 1BT5A 1LSXA 3SS4A 1QMEA 1XKZA 4I38A 1IFQA 2PU2A 3CZDA 1K56D 3UY6A 2PR6A 5FEGA 4CLCC 2PDRA 2A49A 1P9RA 1NYMA 3DTKA 3RXWA 3CITA 3F1OA 3DW0A 5KMWA 4DF6A 3IT9A 2FFYA 3LICA 3ULFA 4R6LA 2OLUA 2W3GA 4K08A 5J7EA 4WMCA 4BD0A 2OWHA 5FQQA 2WZXA 3WRZA 1LLBA 3IF6A 4QY6A 1XJ2A 1K4EA 2ZC7A 3QNCA 5L8MA 1MWUA 5CGSA 4OQ0A 5GLDA 5GHXA 1ODVA 4FSFA 1ZHHB 2INWA 4DE1A 3MKEA 4EUZA 4X1LA 4E3KA 2OAQ1 2PD7A 3O87A 2LB9A 4HBTA 1IYSA 2KLIA 1W63M 2NUPC 2J8YA 1CI9A 3DWZA 5LBRA 2M7VA 4OPZA 2K31A 1NZOA 4WZ5A 4HBUA 3C2WA 2Q9NA 4WZ4A 4BBVA 3MQ0A 1ZTUA 4NG2A 4F3LB 2BLSA 2V0UA 2H0TA 4GD6A 3JVVA 4I3JA 5HAQA 3S7OA 3G6OA 5HWVA 3C8CA 4G3WA 5M19A 3RJUA 2ZL1A 3I7JA 3VFHA 5KSHA 1L0DA 3G30A 3OZHA 3IHBA 4R0QA 2HP6A 2O0YA 3B33A 5IU1A 3BEBA 5HDDA 3HBRA 4S2OA 4O7DA 5CXWA 3NC8A 2CC1A 3HLDA 2VX8A 2W3HA 4II7A 2Y2IA 3N4IA 1YSQA 1VB6A 2VGKA 3CJMA 3MXQA 3U4LP 5HWTA 4JXWA 2Y4AA 3HLBA 1XA1A 4JF4A 5FEFA 5EVID 2XLNA 4F94A 2ZC3B 1T1BA 4MBHA 1BLPA 1MC0A 4PM8A 3M2KA 1MBLA 4KZ7A 4Y2FA 3UB9A 5AVEA 3EQVA 3GQZA 2WGVA 3NIAA 4KG2A 2WGWB 4LV0A 3Q7VB 4I39A 2CMNA 1GA0A 1W7FA 4R4RA 5FL3A 4C75A 1MPLA 1N9BA 4DRTA 3LIAA 4H6JB 4BL3A 2ZMAA 2Z2LB 5U47A 4HIAA 2WKEA 1G5UA 3VP3A 1G28A 4NKPA 2WK0A 4ARZA 1OMEA 5GLAA 2XQZA 3GDIA 4QPRA 3VMAA 3K2NA 3ISGA 4WUJA 5HAPA 1XPBA 4ME4A 4JPMA 3S7QA 3M6HA 3NOPC 3FYZA 4MNRA 5EE8A 2PBDP 5FQJA 3JYIA 4NK3A 4KZ5A 1YKDA 3NCKA 1K6RA 3Q82A 5J3WA 1RCJA 3NOUC 5F68A 1H8MA 3FKVA 3MJQA 4R38A 5CEDA 1E4DA 4LV2A 4OPRA 3R4KA 4DE0A 4KZ4A 2ZC4B 2A2LA 2V8CA 2EX8A 4PMAA 3O86A 3C4OA 4GLQA 2PYPA 1FOFA 2WYXA 2XEPA 3H82A 4KZAA 3BM6A 3G32A 5GL9A 2ZQAA 4HY8A 2GJ3A 4WELA 3UMDA 4BJPA 2V8FA 4GJ4A 3D72A 3T4QA 3A3EA 2VV7A 3ZVTA 4N1XA 2QJ7A 1FQGA 1YLTA 4GW9A 4DMZA 3UE6A 1M6KA 4Q0IA 2ZBBA 4HH3A 3D4FA 4Y0OA 5EPHA 1OTDA 3KX0X 4OOYA 3S22A 2JKTI 4E3NA 3C30A 2ZQCA 1UWPX 3F1NA 3ZG7B 1GSXA 4FUWA 4S2NA 1FIKA 3UN7A 5AQ9A 1RP5A 5G18A 2XD1A 3PBRA 5E2HA 4X55A 3IWIA 5GHYA 3W8KA 2J3TC 4QD4A 1NRJA 5CHUA 3A3JA 1ESIA 1TDGA 3S1YA 3WRTA 3A0RA 3LUQA 1ALQA 2OV5A 4GKUA 3UNWA 2VKSA 3GRJA 1CJFA 3UPOA 2XK1A 2RCXA 4JKTA 3E2LA 4JXSA 3W4QA 3BLSA 4ARZB 4HJ6A 2ZD8A 1ZG4A 3PBSA 3WWXA 5E43A 1NLZA 1JTGA 3SH7A 1K54C 3N8SA 3LR3A 5EV0A 1Y4OA 4N92A 4I3AA 4KG5A 3B3XA 2D01A 4YWZA 2DMWA 1PW1A 3N8LA 4QY5A 4KZ6A 3LIFA 4HJ4A 3OOVA 3IF6B 2OWJA 1DP8A 1PI4A 4R70A 3Q7VA 2HDRA 2Y2NA 5L09A 1ES5A 3ZNTA 1J9MA 5TJJA 2O9AA 1ZG6A 2ACGA 3MKFA 1S1ZA 3LIBA 4IEDA 5TR7A 1M40A 2J9OA 2G2UA 5CERA 1IYPA 1W5DA 1LT0A 5GLCA 5CHJA 4PHTA 3VOLA 3HJIA 4KUKA 4WEJA 2A24A 3BY8A 3SH9A 3MF0A 2ZMFA 4NETA 3A0VA 3ICYA 3KYQA 1PWCA 5FASA 3AGEA 3F1PB 4OVDA 1H8ZA 1F5MA 3RFBA 3BQ8A 4JF5A 1PZOA 3W4PA 1HVBA 2Y2OA 5CX7A 4MN5A 3SZTA 5I94A 4DJ2A 1XGJA 5A92A 3IQAA 3D3OA 3UE0A 2H28A 5HPIA 3SS3A 5DFXA 1K56A 1STZA 5EVEA 3LFVA 2B95A 1NYYA 4ZJ2A 1IYQA 1XXMA 1TVFA 3IX8A 4G3KA 4Y17A 4IBXA 4ZAMA 1BLSA 1IEMA 2E8IA 4X68A 4CJNA 4R1GA 4ZJ1A 5KZHA 4R3JA 4EEUA 3OCLA 4PPRA 5IS1A 4LENA 1F9IA 4X69A 3JPUA 4PKYA 4ETZA 3WS0A 4KENB 3LCEA 2HGVA 1FSWA 5DF7A 4XUZA 4GB7A 1W8YA 3T4SA 3UB7A 4WEKA 3PR6A 1VEUB 1BUEA 3W2ZA 2J7VA 3ZDJA 5J8XA 3QP8A 2QHKA 1WYCA 1S4RA 4MMNA 3PAEA 2QPNA 3ZG9B 3G2ZA 4DXCA 2KX6A 4Y15A 2Q0OA 4JGOA 2XH9A 1TS0A 4KZ3A 5F69A 1K54A 4CLCE 3IH9A 4QHCA 3F1OB 4ID4A 2EX2A 3OLOA 1FR1A 3QP5A 1XFNA 4HEFA 1YAXA 3NECA 2C5WB 5HWWA 3T1XA 3PYPA 5HW3A 1YSPA 3T1SA 3MSHA 4BWIA 4ZTKA 3FG8A 5L2FA 2EWWA 2B18A 4A5RA 2W1RA 3MS6A 1OTBA 1E3UA 2R78A 3FKWA 5CTNA 2W27A 4RX3A 1LL8A 4K0XA 4OPYA 1P97A 3NULA 1FCNA 3GR2A 1D06A 3ITBA 3QP4A 3L7HA 1TEMA 3AGFA 3MZDA 3E4QA 1CEGA 4GHIA 1BZAA 4BENA 3BQAA 3LIEA 1DP6A 2XA7S 4OQGA 4IVKA 5EVIA 1ZKJA 5EUAA 1N4OA 5CTMA 2Y2KA 3KSIA 4RVAA 5DTSA 2Y8HA 2D02A 2EFXA 4CLCB 2V2FF 1RGYA 2UV0E 2M7UA 4PM7A 3BFFA 5IT5A 3WS4A 3BFCA 5F83A 3CPTA 1I5QA 2IWCA 1PWDA 1EW0A 4KUOA 3T12B 3IXBA 3IXGA 3PTEA 2IWDA 3MFDA 3P09A 5F5YA 1BLHA 4WMCD 4P85A 2PBYA 2ZLYA 1H8YA 5MC7A 4IJGA 4QU3A 2P04A 4FTXA 4MDZA 1DP9A 2VGLM 2QWSA 2XFSA 4NXEA 5KIZA 1N9LA 3Q81A 3F1PA 2XF3A 1YLJA 3SOIA
chains in the Genus database with same CATH topology
3KO6A 1YKDA 2JKTM 4Q0JA 1T1AA 3LI8A 5J3WA 5TBMB 3NOUC 4GHIB 4HNBA 5F68A 1H8MA 2J3WA 3GECA 2FZ0A 3MJQA 4R38A 4EW7A 4HI4A 3BWLA 2VGLS 4P6ZS 3OBFA 5F6AA 4M4XA 2Z6DA 5HSQA 3R4KA 1NWZA 3CLOA 2A2LA 3H82B 2V9AA 2HJEA 1GSVA 2V1AA 2W3FA 3EGDC 2QYBA 2KDKA 2ZOIA 4GLQA 4CLCA 2PYPA 5AVFA 3T4OA 1OTIA 3H82A 2PD8A 4HY8A 2GJ3A 2J80A 4WELA 3UMDA 1TS7A 4BJPA 4GJ4A 4NXFA 3D72A 2P7JA 3E4OA 3T4QA 2VV7A 4HP4A 3MFXA 2EWVA 1D7EA 4BBTA 1UGUA 2OAP1 2QJ7A 3NOTC 4Q0HA 5DFYA 1OTEA 1S67L 4GW9A 4DMZA 4MN6A 3UE6A 4Q0IA 3UB8A 4LPZA 2ZBBA 3UB6A 4HH3A 1T1CA 1OTDA 2O99A 3KX0X 2JKTI 4UQIS 3C30A 1MZUA 1UWPX 3F1NA 4HJ3A 1Y28A 2PR5A 1GSXA 2BASA 2QJ5A 1DRMA 4HH2A 3PBNA 3ZYTA 1XJ4A 3P7NA 2K7SA 1V9YA 3E98A 3IS2A 3PBRA 3RTYA 4JGRA 5DJTA 3UE3A 1GSWA 5DJUA 3MQQA 3CWFA 2J3TC 3EWKA 1NRJA 3PBOA 4XT2B 1N9OA 3A0RA 3LUQA 4ZRRA 5HDSA 3A0SA 4HOIA 2JHEA 3OCNA 2VKSA 3LYXA 4YNRA 1H3QA 2V0WA 4G3VA 3SW1A 2HF6A 4WLAA 1V9ZA 5AJGA 3OC2A 1TS6A 4B93A 3BY9A 2L1MA 4ARZB 2GNXA 4HJ6A 1JNUA 2K2NA 3PBSA 5DF9A 1NLZA 3MR0A 3T4JA 3C38A 4PKYG 3TRCA 3LR3A 3FC7A 1F98A 4GS9B 4UQIM 4MCWA 4BBUA 2JKRI 4I3AA 1OT9A 4WF0A 4OOLA 4CQHA 2D01A 4IUHA 4YWZA 1NLYA 2DMWA 2W3EA 2B02A 1XJ6A 2GZAA 3LIFA 5HZHA 4HJ4A 3T4LA 2OOLA 3EEHA 3OOVA 3CUEA 2OWJA 4EUVA 1DP8A 5HPFA 4R70A 1T18A 4LRXC 4RQ9A 4L0LA 4GS9A 1TS8A 2VV8A 5TJJA 1P9WA 2O9AA 4LRZE 4IHQA 2A24B 1S1ZA 3LIBA 4LRYC 5I5LA 2KOIA 3T4TA 2Y79A 5DKKA 2EA9A 3VV4A 5TBMA 4BMWA 1LT0A 4JGPA 3T4KA 3CAXA 2W1TB 4NXBA 3CI6A 4Y3IA 3KYZA 1S1YA 4NXGA 4PHTA 3VOLA 3HJIA 3PHYA 3B47A 3DBAA 2A24A 4KUKA 3BY8A 4WEJA 4KQDA 1MKMA 3MF0A 2QKPA 3BW6A 2ZOHA 2ZMFA 3A0VA 3ICYA 2V1BA 3F1NB 2JN7A 5EFWA 5G4ZA 2PT7A 2ZMVA 3KYQA 3EQUA 4JGQA 1OPXA 3IBJA 1OJGA 3TW8A 2G7UA 3R7WA 2IA2A 4GCZA 2Z6CA 1IOUA 3F1PB 2W1TA 4EXOA 1F5MA 3LR4A 2FH5A 4HQAA 2W0NA 4IUKA 4H6JA 3RFBA 3BQ8A 2XROA 1LSXA 4I38A 4EESA 1IFQA 5CX7A 4MN5A 1OT6A 2VA0A 3EOIA 1LSWA 4NEED 4EERA 4DJ2A 2PR6A 3S7PA 3ZQ5A 3D3OA 4CLCC 2PDRA 3HJKA 1P9RA 2H28A 5HPIA 5C5KA 2NUTC 5DFXA 1STZA 3HCYA 2JKRM 3MMHA 3LFVA 4XT2A 3CITA 4L9GA 3LIDA 3F1OA 2VZWA 1X0OA 4P6ZM 3K3DA 3TJZC 1TF1A 3LICA 3BJNA 3ULFA 4EETB 4G3KA 4R6LA 4EEPA 3H7WA 2W3GA 4K08A 5J7EA 2OWHA 2PHYA 5DKLA 1XFQA 4EEUA 3OCLA 5IS1A 1F9IA 4L9EA 3NJAA 1XJ2A 4PKYA 4B9OA 4ETZA 1S4SA 2HJ9C 5L8MA 1G6OA 4ETXA 4WL9A 3H9WA 1W63Q 2HGVA 2WKPA 2MJ6A 4KQOA 5HDCA 4LLOB 3T4SA 4HP9A 4WEKA 3PR6A 4Y5FA 3UB7A 4UEYA 2LB5A 1ODVA 2O9CA 4FSFA 1ZHHB 2INWA 1OJ5A 3R7WB 3W2ZA 2VEAA 3O5YA 2QHKA 1S66L 2OAQ1 1XJ3A 2PD7A 3VE3A 3LR5A 2LB9A 1S4RA 2L0WA 4MMNA 4MN7A 1OTAA 2KLIA 1W63M 2NUPC 2I9VA 5LBRA 2M7VA 1TD5A 2K31A 3U2AA 5G4YA 4CLCD 2KX6A 1T19A 3C2WA 5HD3A 4JGOA 4BBVA 3MQ0A 1TS0A 1ZTUA 4F3LB 2HV1A 5F69A 2V0UA 4CLCE 2M1CA 4DJ3A 3PBQA 2PYRA 3F1OB 3JVVA 4I3JA 3OLOA 3E0YA 4DN0A 3T50A 4Z1WA 1XFNA 3IS2B 2GX5A 1YAXA 3S7OA 5HWWA 3PYPA 3G6OA 5HWVA 1YSPA 3C8CA 1P0ZA 4G3WA 3S7NA 1WA9A 4BWIA 4O0PA 3FG8A 2EWWA 3MQOA 2B18A 5KSHA 1UWNX 2W1RA 3NHQA 3K3CA 2P08A 4F3LA 1OTBA 3CUEC 4O01A 2O0YA 3B33A 2R78A 3KSGA 5IU1A 3FPWA 5HDDA 2WKQA 4I3IA 2W27A 1LL8A 5J4EA 2YKHA 2XA7M 2XRNA 5K5BA 1P97A 2L4RA 4FOFA 2VX8A 2VV6A 2W3HA 3EGXC 3JVUA 4II7A 3V67A 1YSQA 2VJWA 1VB6A 1D06A 3RH8B 3MXQA 1LSVA 3LR0A 3TE8A 1VHMA 3E4QA 5HWTA 4GHIA 3KSHA 4OOMA 3E4PA 3BQAA 3LIEA 3KSFA 1DP6A 2XA7S 1T1BA 3FPVA 3UMEA 1KOUA 1MC0A 4WN5A 5HD5A 3KSIA 4Y2FA 3UB9A 2W3DA 5AVEA 2Y8HA 2D02A 3EQVA 2VLGA 4CLCB 3PXPA 2M7UA 4I39A 2CMNA 4EU0A 5IT5A 5FL3A 3H7WB 5HL6A 4HHDA 2YKFA 3LIAA 5A8BA 4R3AA 3IBRA 4H6JB 1EW0A 4KUOA 4PAUA 3EEAA 4EQ1A 4AFIA 3LI9A 5F5YA 2O9BA 4HIAA 3B42A 4O8GA 1G28A 4YOFA 1BYWA 4I5SA 4NKPA 5MC7A 4IJGA 2P04A 4ARZA 1N9NA 2WKRA 4MDZA 3VE4A 3GDIA 1DP9A 2VGLM 4E04A 4QPRA 3K2NA 2QWSA 4WUJA 3P01A 2XSSA 3PBTA 4ME4A 3S7QA 3NOPC 4NXEA 5KIZA 1N9LA 4L9FA 3F1PA 2J3TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K3C A;  1TS6 A;  3BY9 A;  2L1M A;  1OTB A;  4F3L A;  4HJ6 A;  1JNU A;  1T1A A;  3LI8 A;  5J3W A;  3B33 A;  4XT2 A;  2R78 A;  4L9G A;  3LID A;  5IU1 A;  3F1O A;  3NOU C;  5TBM B;  3MR0 A;  4GHI B;  4HNB A;  5F68 A;  2WKQ A;  4I3I A;  5HDD A;  1X0O A;  3GEC A;  3MJQ A;  2W27 A;  4PKY G;  4R38 A;  4EW7 A;  4HI4 A;  1LL8 A;  3BWL A;  3FC7 A;  1F98 A;  3K3D A;  4GS9 B;  4BBU A;  5J4E A;  5HSQ A;  5F6A A;  4I3A A;  3LIC A;  1OT9 A;  4M4X A;  4WF0 A;  2Z6D A;  2YKH A;  3ULF A;  4EEP A;  4R6L A;  4EET B;  3H7W A;  1NWZ A;  1P97 A;  3CLO A;  2L4R A;  2D01 A;  3H82 B;  2V9A A;  3NHQ A;  4K08 A;  2VV6 A;  4YWZ A;  5J7E A;  1GSV A;  2V1A A;  4WLA A;  2OWH A;  2B02 A;  2PHY A;  1VB6 A;  1XJ6 A;  5DKL A;  1D06 A;  3RH8 B;  2KDK A;  2ZOI A;  3MXQ A;  1LSV A;  1XFQ A;  3LIF A;  5HZH A;  4EEU A;  4HJ4 A;  2PYP A;  2OOL A;  3EEH A;  5AVF A;  3E4Q A;  5IS1 A;  1F9I A;  4L9E A;  5HWT A;  3NJA A;  1XJ2 A;  2OWJ A;  1DP8 A;  1OTI A;  3H82 A;  4GHI A;  4PKY A;  4R70 A;  4B9O A;  1T18 A;  2PD8 A;  3UB9 A;  1S4S A;  4LRX C;  4RQ9 A;  3E4P A;  4GS9 A;  4HY8 A;  2GJ3 A;  2J80 A;  3LIE A;  3UMD A;  1TS7 A;  1TS8 A;  1DP6 A;  4WL9 A;  4NXF A;  2VV8 A;  1T1B A;  2P7J A;  3D72 A;  3E4O A;  2WKP A;  3H9W A;  3UME A;  4KUK A;  5HDC A;  2VV7 A;  4HP4 A;  1KOU A;  4LLO B;  4WN5 A;  4LRZ E;  3MFX A;  5HD5 A;  4HP9 A;  3UB7 A;  2A24 B;  1D7E A;  1S1Z A;  3LIB A;  1UGU A;  4LRY C;  2QJ7 A;  5I5L A;  4BBT A;  3NOT C;  1ODV A;  1S67 L;  1OTE A;  4GW9 A;  2INW A;  5DKK A;  2EA9 A;  4MN6 A;  2D02 A;  1OJ5 A;  2VLG A;  5AVE A;  3UB8 A;  5TBM A;  3UE6 A;  4LPZ A;  2ZBB A;  3UB6 A;  4HH3 A;  2VEA A;  1T1C A;  1LT0 A;  1OTD A;  4JGP A;  2QHK A;  4I39 A;  3CAX A;  3KX0 X;  4NXB A;  1S66 L;  2CMN A;  1XJ3 A;  2PD7 A;  1S1Y A;  4NXG A;  3VE3 A;  1S4R A;  3VOL A;  3HJI A;  1MZU A;  1UWP X;  2L0W A;  2A24 A;  3F1N A;  3BY8 A;  3PHY A;  4HJ3 A;  1Y28 A;  1OTA A;  4KQD A;  2PR5 A;  1GSX A;  2BAS A;  2QJ5 A;  3H7W B;  1DRM A;  4HH2 A;  4HHD A;  2QKP A;  2ZOH A;  1XJ4 A;  2YKF A;  3LIA A;  3A0V A;  2I9V A;  3P7N A;  3ICY A;  2V1B A;  5A8B A;  3F1N B;  4R3A A;  5G4Y A;  2JN7 A;  1V9Y A;  2K7S A;  3IBR A;  4H6J B;  5EFW A;  1EW0 A;  2KX6 A;  3IS2 A;  1T19 A;  4KUO A;  3C2W A;  5G4Z A;  5HD3 A;  4EQ1 A;  3RTY A;  4JGQ A;  4JGR A;  4JGO A;  4BBV A;  3LI9 A;  5F5Y A;  1OJG A;  5DJT A;  1GSW A;  1TS0 A;  4F3L B;  4GCZ A;  2HV1 A;  4HIA A;  2Z6C A;  2V0U A;  3MQQ A;  5DJU A;  5F69 A;  2M1C A;  1G28 A;  4DJ3 A;  3F1P B;  3CWF A;  2PYR A;  3F1O B;  1BYW A;  3EWK A;  4I3J A;  4I5S A;  4XT2 B;  4EXO A;  3OLO A;  1N9O A;  3T50 A;  4HQA A;  2W0N A;  1N9N A;  1XFN A;  2WKR A;  3A0R A;  3IS2 B;  3LUQ A;  4H6J A;  3VE4 A;  5HWW A;  3GDI A;  1DP9 A;  1LSX A;  4E04 A;  3PYP A;  3G6O A;  5HWV A;  5HDS A;  3A0S A;  4HOI A;  2QWS A;  4I38 A;  4WUJ A;  3C8C A;  1P0Z A;  2JHE A;  4EES A;  1WA9 A;  4MN5 A;  3LYX A;  1OT6 A;  3NOP C;  2V0W A;  4EER A;  1LSW A;  3FG8 A;  4NXE A;  4DJ2 A;  1N9L A;  5KIZ A;  4L9F A;  2PR6 A;  3ZQ5 A;  3MQO A;  3F1P A;  3SW1 A;  1UWN X;  2PDR A;  3HJK A;  2H28 A;  1V9Z A; 
#chains in the Genus database with same CATH topology
 4E3M A;  3KO6 A;  1ONH A;  1Z09 A;  1K4F A;  4K0W A;  1YMX A;  4D60 A;  2E8J A;  1C3B A;  4EW7 A;  4HI4 A;  3BWL A;  2VGL S;  4P6Z S;  5F6A A;  4M4X A;  1NWZ A;  3H82 B;  1IKG A;  3EGD C;  5EVI C;  5E2G A;  4DKI A;  4N9L A;  2KDK A;  2ZOI A;  1KVL A;  2ZQ9 A;  3IX3 A;  4KG6 A;  3NY4 A;  2PD8 A;  3VOZ A;  2WGI A;  1PFL A;  5FDH A;  5HX9 A;  5JYO A;  4MEZ A;  4DXB A;  1DJC A;  2P7J A;  3E4O A;  5DTK A;  3NI9 A;  4EWF A;  2JE5 A;  4HP4 A;  4R23 A;  3G34 A;  1D7E A;  4BBT A;  1ES4 A;  3D9Y A;  5DFY A;  2ZQ8 A;  3UB8 A;  1CI8 A;  3UB6 A;  3A3D A;  4IBR A;  5A91 A;  1K0K A;  4EBP A;  1MZU A;  5F1F A;  4HJ3 A;  1VEU A;  2PR5 A;  2PRF A;  3HVF A;  3PBN A;  2HP9 A;  3ZYT A;  3P7N A;  5EVL A;  1I2W A;  3IS2 A;  5CGW A;  2XDM A;  3RTY A;  4JGR A;  2A3U A;  1KDW A;  5DJT A;  3VFF A;  4YFM A;  1K38 A;  3LEQ A;  3GVB A;  4B88 A;  1L2S A;  5DJU A;  3MQQ A;  5AQA A;  1CEF A;  3CWF A;  4P6B A;  4XT2 B;  1JVJ A;  4R3B A;  1D1J A;  4ZRR A;  4LGW A;  1K57 A;  2WAD A;  3LYX A;  1CF0 A;  1H3Q A;  4ZDX A;  3SW1 A;  1GCE A;  5AJG A;  3OC2 A;  1TS6 A;  4B93 A;  1S6R A;  2GNX A;  3UDI A;  2K2N A;  4P0M A;  2J9P A;  5DF9 A;  2R9W A;  3C38 A;  2WKH A;  3TRC A;  3C5A A;  4GS9 B;  1BTL A;  3ITA A;  2JKR I;  2JCH A;  1OT9 A;  4OOL A;  4CQH A;  3V5M A;  3LY3 A;  2HZ5 A;  5JYP A;  1SDN A;  1WYB A;  2GZA A;  2IWB A;  2OSU A;  1LI9 A;  3RXX A;  1MXO A;  1YT4 A;  2I72 A;  3C7V A;  2Y91 A;  1AWI A;  4B4Z A;  2JC7 A;  4LV1 A;  4OON A;  4WZ5 C;  4LRX C;  4RQ9 A;  2ZL1 B;  4GS9 A;  1P9W A;  2Y2P A;  4KQQ A;  4LRZ E;  2A24 B;  4LRY C;  1EI5 A;  3T4T A;  5DKK A;  1H5X A;  3UB5 P;  4BMW A;  3ZCZ A;  3ZG0 A;  4JGP A;  3T4K A;  3UO9 A;  4NXB A;  3PHY A;  3VP1 A;  2AVX A;  1W79 A;  1W8Q A;  2QKP A;  2ZOH A;  3HLG A;  4FCF A;  5CEB A;  2V1B A;  2JN7 A;  3UDX A;  2Q9M A;  5E2E A;  1KGE A;  3EQU A;  4OLG A;  3IBJ A;  4ESP A;  2G7U A;  4GCZ A;  4BD1 A;  1FIL A;  1QMF A;  2W1T A;  4EXO A;  4N1H A;  5GHZ A;  5FA7 A;  4H6J A;  4GZB A;  4EES A;  3ZNY A;  1KE0 A;  3BFE A;  1OT6 A;  4S2P A;  3ZHH A;  1LSW A;  3ZQ5 A;  4S2K A;  1HZO A;  4EBN A;  4R4S A;  3HCY A;  2JKR M;  3MMH A;  4XT2 A;  4L9G A;  3LID A;  2VZW A;  1L3L A;  1X0O A;  4S2L A;  1XA7 A;  1U60 A;  4C3Q A;  3K3D A;  1RGZ A;  4EET B;  4EEP A;  5FQI A;  1FCO A;  1VQQ A;  3WS2 A;  1VET B;  2PHY A;  1ERO A;  1YM1 A;  1NZU A;  1XFQ A;  3DTI A;  4E6X A;  2V1Z A;  2ZM0 A;  3MZF A;  4L9E A;  4OP5 A;  4B9O A;  2HJ9 C;  3C4P A;  1GHI A;  5FI7 A;  3NDG A;  4UHU A;  1W63 Q;  2WKP A;  2ZQD A;  3O3V A;  5HDC A;  1GHM A;  4EQI A;  3HRE A;  3VSK A;  4HP9 A;  4UEY A;  2LB5 A;  2O9C A;  1OJ5 A;  3HLW A;  1NJ4 A;  4E3I A;  3BEC A;  1PWG A;  1S66 L;  1K55 A;  3VE3 A;  3LR5 A;  2EFU A;  5F1G A;  3PAG A;  3BFD A;  4MN7 A;  1OTA A;  2Y2L A;  2Y55 A;  2I9V A;  4KZB A;  1BUL A;  5AQ7 A;  5G4Y A;  3U2A A;  4CLC D;  5CHM A;  1T19 A;  4U0T A;  1NY0 A;  2HV1 A;  2HPB A;  5FQ9 A;  4DJ3 A;  4Q8I A;  3PBQ A;  2PYR A;  3G35 A;  4UA9 A;  4DN0 A;  3E0Y A;  5FI2 A;  4Z1W A;  2GX5 A;  1SZV A;  1YLY A;  3S7N A;  4UA6 A;  1SKO A;  4O0P A;  3MQO A;  3VOY A;  1NRF A;  3K3C A;  1L0E A;  1MKI A;  4F3L A;  4Y13 A;  2PAV P;  5HL1 A;  2WKQ A;  4I3I A;  2Y2G A;  5J4E A;  5FDS A;  1YMS A;  2YKH A;  2XRN A;  5K5B A;  4BQM A;  4FOF A;  1KE4 A;  3EGX C;  3HLE A;  4EV4 A;  3JVU A;  3V67 A;  3E2K A;  2VJW A;  3TE8 A;  1VHM A;  2WAE A;  3KSH A;  4OH0 A;  2Y2J A;  4GDN A;  2WKI A;  3HL9 A;  1KDS A;  5TGF A;  3A3I A;  3FPV A;  1KOU A;  5FAQ A;  1LHY A;  4KQR A;  1FSY A;  4YIN A;  2W3D A;  2WAF A;  1PNE A;  2VLG A;  1TDL A;  4K91 A;  2WGW A;  3PXP A;  4UAA A;  4EU0 A;  2XFT A;  3UPP A;  5HL6 A;  4OQI A;  4ZBE A;  2YKF A;  2EX9 A;  4R3A A;  3IBR A;  3EEA A;  4AFI A;  1E3U D;  2O9B A;  3GMW A;  3B42 A;  4H8R A;  4O8G A;  3AGD A;  3N8R A;  1I2S A;  4YOF A;  1BYW A;  1Y54 A;  2WUQ A;  2B5R A;  2WKR A;  3S4X A;  3OPP A;  1G6A A;  3VE4 A;  4EBL A;  3PBT A;  4M3K A;  3SH8 A;  4L9F A;  4D2O A;  1E25 A;  3IX4 A;  4Q0J A;  1T1A A;  3LI8 A;  5TBM B;  1VET A;  2J3W A;  3GEC A;  3HLC A;  2FZ0 A;  4GD8 A;  3QNB A;  1H0M A;  5EEC A;  4P87 A;  3NDE A;  3CLO A;  4Z9Q A;  2V9A A;  4QB8 A;  5CRF A;  1GSV A;  2V1A A;  4OPQ A;  1PYY A;  3QHY A;  5A93 A;  1MWR A;  5AVF A;  1OTI A;  3G4P A;  4FH4 A;  4JXV A;  1LL5 A;  3T1R A;  4OLD A;  4Y0T A;  3MFX A;  3ZG5 A;  1FR6 A;  2EWV A;  2JBF A;  1GHP A;  2Y2Q A;  4Y7P A;  4MN6 A;  3Q7Z A;  1XX2 A;  4UQI S;  1GA9 A;  1NXY A;  3HLF A;  1O7E A;  4UA7 A;  1DRM A;  4HH2 A;  3OPR A;  4JF6 A;  2XGN A;  2K7S A;  1V9Y A;  5EOE A;  3HUM A;  3ZGA B;  1EWZ A;  3CHW P;  2UWX A;  2H0Y A;  1GSW A;  5BOH A;  3HUN A;  3W4O A;  3PBO A;  1N9O A;  1PIO A;  2QZ6 A;  2Y2M A;  2ZM2 A;  3N6I A;  4DDS A;  3DWK A;  4X53 A;  5HDS A;  4CPK A;  3OCN A;  5EM1 A;  1DJB A;  1HTZ A;  1V9Z A;  1PRQ A;  3M2J A;  2L1M A;  4RA7 A;  2H10 A;  1JWP A;  3UDF A;  2DRW A;  4OP8 A;  3T4J A;  4PKY G;  1KGF A;  1IEL A;  3BFG A;  1F98 A;  4UQI M;  4BBU A;  4WF0 A;  2RL3 A;  5FAO A;  4IUH A;  4MBK A;  5FI6 A;  4XUX A;  1ERQ A;  2B02 A;  1XJ6 A;  2JKG A;  5M18 A;  1J3W A;  2ZC6 B;  3EEH A;  3CUE A;  4EUV A;  5HPF A;  3LGO A;  1PI5 A;  4L0L A;  5EOO A;  5FAP A;  1TS8 A;  2BG1 A;  5L10 A;  4S2N C;  4IHQ A;  4JLF A;  3WS1 A;  3UE1 A;  2KOI A;  2H5S A;  2Y79 A;  5HAI A;  3VV4 A;  5IHV A;  1L0F A;  5FSR A;  1O07 A;  3V3S A;  3CAX A;  2W1T B;  1IKI A;  1S1Y A;  3B47 A;  3DBA A;  4KQD A;  3MZE A;  3KYE A;  3LY4 A;  3IXD A;  2P74 A;  4BLM A;  1S0W A;  2PT7 A;  2ZMV A;  4LV3 A;  1YLW A;  5DVA A;  1SKF A;  1OPX A;  1OJG A;  3TW8 A;  4N9K A;  3R7W A;  4WM9 A;  2IA2 A;  3IWO A;  1IOU A;  4WYY A;  4E3J A;  4S2J A;  2FH5 A;  4HQA A;  2W0N A;  4IUK A;  4U3T A;  4GNU A;  1KVM A;  2X71 A;  5HAR A;  3T1Q B;  2P9V B;  2VA0 A;  3EOI A;  4NEE D;  4EER A;  3S7P A;  3DTM A;  3HJK A;  1Q2P A;  5C5K A;  1CK3 A;  2NUT C;  4LCL A;  1SDE A;  4P6Z M;  3VP0 A;  3TJZ C;  1TF1 A;  1SKO B;  4JBF A;  4LFU A;  3BJN A;  3H7W A;  5CEC A;  3QP6 A;  5DKL A;  2ZC5 B;  3SS5 A;  3ZG8 B;  3FZC A;  3NJA A;  3CG5 A;  2GDN A;  1S4S A;  1XP4 A;  1G6O A;  4ETX A;  1KGG A;  4Y0U A;  4WL9 A;  3H9W A;  1CQA A;  2MJ6 A;  4KQO A;  1G68 A;  4LLO B;  1ZC2 A;  4Y5F A;  1K55 C;  4QJG A;  2XR0 A;  2Z2M B;  4X1M A;  1YPR A;  5FQK A;  3R7W B;  2EXB A;  2VEA A;  4X6T A;  3O5Y A;  1PZP A;  1XJ3 A;  2L0W A;  2DNS A;  1MY8 A;  1TD5 A;  3Q1F A;  4FD8 A;  5HD3 A;  5A90 A;  1YLZ A;  2M1C A;  2HDS A;  4GOG A;  5EVI B;  3T50 A;  2G2W A;  3IS2 B;  2HDU A;  2JKF A;  5FAT A;  3A3F A;  4RX2 A;  3L9K A;  1P0Z A;  4X56 A;  1WA9 A;  3QP1 A;  3FWL A;  3VP4 A;  4WBG A;  5D3O A;  1UWN X;  3NHQ A;  3WS5 A;  2P08 A;  3TOI A;  1WE4 A;  3CUE C;  5E2F A;  4O01 A;  3UPN A;  1F2K A;  3KSG A;  3FPW A;  1LI0 A;  3OPL A;  2DCF A;  3G31 A;  2XA7 M;  2L4R A;  2VV6 A;  3GSG A;  1KE3 A;  4IVI A;  3DAV A;  2X02 A;  3RH8 B;  3ZFZ A;  1LSV A;  3LR0 A;  4MLL A;  1L0G A;  4OKP A;  2V20 A;  5L07 A;  2BTF P;  3TSG A;  3TG9 A;  4OOM A;  3E4P A;  2QMI A;  3KSF A;  1K6S A;  3QP2 A;  4X25 A;  3UME A;  1K25 A;  4WN5 A;  5HD5 A;  1HD8 A;  3GTC A;  5TFQ A;  3OPH A;  1Q2Q A;  5DTT A;  4RYE A;  1K57 C;  1YQS A;  5FQM A;  5AQB A;  4U0X A;  3H7W B;  4HHD A;  5A8B A;  2R9X A;  3MXR A;  4PAU A;  4EQ1 A;  3MBZ A;  3LEZ A;  1FCM A;  4XXR A;  3LI9 A;  1BSG A;  4OQH A;  2C6W B;  4PM6 A;  4I5S A;  2EX6 A;  5EM0 A;  3V3R A;  1N9N A;  4GN2 A;  1ESU A;  4E04 A;  4S2I A;  3N7W A;  3P01 A;  1LL9 A;  2XSS A;  4JXG A;  1IYO A;  2ZQ7 A;  2J3T D;  2Y59 A;  4MBF A;  3IF5 A;  2JKT M;  2Y2H A;  4B4X A;  4GHI B;  4HNB A;  1A0K A;  1VM1 A;  5DF8 A;  3OBF A;  2Z6D A;  5HSQ A;  3MXS A;  2HJE A;  3IWQ A;  2X01 A;  2W3F A;  4E6W A;  2HDQ A;  5KSC A;  2QYB A;  3FV7 A;  5GLB A;  4CLC A;  2VK3 A;  1JWV A;  3C7U A;  4FH2 A;  3T4O A;  3IXH A;  3LO7 A;  2FFF B;  1DJA A;  3G2Y A;  2J80 A;  1TS7 A;  4QWO A;  2ZM8 A;  4NXF A;  4PM9 A;  1ES3 A;  1UGU A;  2OAP 1;  3O88 A;  3NOT C;  4Q0H A;  1OTE A;  1S67 L;  3V50 A;  4LPZ A;  1T1C A;  2O99 A;  3IF6 C;  1XGI A;  3BLM A;  1Y28 A;  3VP2 A;  2WZZ A;  2BAS A;  2QJ5 A;  2EXA A;  1XJ4 A;  1DY6 A;  3V39 A;  5F82 A;  3E98 A;  1BLC A;  3UE3 A;  5HFO A;  4DDY A;  4LCM A;  1HLU P;  3EWK A;  1MWT A;  4PM5 A;  4BL2 A;  1ONG A;  3A0S A;  4HOI A;  3Q07 A;  2JHE A;  4YNR A;  2V0W A;  1ACF A;  4G3V A;  2HF6 A;  4WLA A;  3CMZ A;  3BY9 A;  3BYD A;  1JNU A;  4ZJ3 A;  3MR0 A;  3FC7 A;  4DE3 A;  1ES2 A;  1JTD A;  4MCW A;  2P9V A;  4DE2 A;  2HP5 A;  1NLY A;  2W3E A;  4S2M A;  2PU4 A;  4HES A;  3IHA A;  2XD5 A;  5HZH A;  3T4L A;  2OOL A;  3HUO A;  1AXB A;  1T18 A;  1Z6F A;  3ZVW A;  2VV8 A;  3BRM A;  3P98 A;  3VSL A;  3CPT B;  4GDB A;  5I5L A;  2EA9 A;  3DTE A;  5CGX A;  5TBM A;  1ERM A;  1JWZ A;  1PW8 A;  4C6Y A;  4E3O A;  3CI6 A;  4Y3I A;  3M6B A;  3KYZ A;  4NXG A;  4KZ9 A;  3NBL A;  3IH8 A;  1MKM A;  1YLP A;  3BW6 A;  3F1N B;  5EFW A;  4E3L A;  5G4Z A;  5M1A A;  4JGQ A;  2OLV A;  4KZ8 A;  2ZJ9 A;  2Z6C A;  1MWS A;  1SHV A;  2VGJ A;  3GV9 A;  3LR4 A;  1SCW A;  2XRO A;  1BT5 A;  1LSX A;  3SS4 A;  1QME A;  1XKZ A;  4I38 A;  1IFQ A;  2PU2 A;  3CZD A;  1K56 D;  3UY6 A;  2PR6 A;  5FEG A;  4CLC C;  2PDR A;  2A49 A;  1P9R A;  1NYM A;  3DTK A;  3RXW A;  3CIT A;  3F1O A;  3DW0 A;  5KMW A;  4DF6 A;  3IT9 A;  2FFY A;  3LIC A;  3ULF A;  4R6L A;  2OLU A;  2W3G A;  4K08 A;  5J7E A;  4WMC A;  4BD0 A;  2OWH A;  5FQQ A;  2WZX A;  3WRZ A;  1LLB A;  3IF6 A;  4QY6 A;  1XJ2 A;  1K4E A;  2ZC7 A;  3QNC A;  5L8M A;  1MWU A;  5CGS A;  4OQ0 A;  5GLD A;  5GHX A;  1ODV A;  4FSF A;  1ZHH B;  2INW A;  4DE1 A;  3MKE A;  4EUZ A;  4X1L A;  4E3K A;  2OAQ 1;  2PD7 A;  3O87 A;  2LB9 A;  4HBT A;  1IYS A;  2KLI A;  1W63 M;  2NUP C;  2J8Y A;  1CI9 A;  3DWZ A;  5LBR A;  2M7V A;  4OPZ A;  2K31 A;  1NZO A;  4WZ5 A;  4HBU A;  3C2W A;  2Q9N A;  4WZ4 A;  4BBV A;  3MQ0 A;  1ZTU A;  4NG2 A;  4F3L B;  2BLS A;  2V0U A;  2H0T A;  4GD6 A;  3JVV A;  4I3J A;  5HAQ A;  3S7O A;  3G6O A;  5HWV A;  3C8C A;  4G3W A;  5M19 A;  3RJU A;  2ZL1 A;  3I7J A;  3VFH A;  5KSH A;  1L0D A;  3G30 A;  3OZH A;  3IHB A;  4R0Q A;  2HP6 A;  2O0Y A;  3B33 A;  5IU1 A;  3BEB A;  5HDD A;  3HBR A;  4S2O A;  4O7D A;  5CXW A;  3NC8 A;  2CC1 A;  3HLD A;  2VX8 A;  2W3H A;  4II7 A;  2Y2I A;  3N4I A;  1YSQ A;  1VB6 A;  2VGK A;  3CJM A;  3MXQ A;  3U4L P;  5HWT A;  4JXW A;  2Y4A A;  3HLB A;  1XA1 A;  4JF4 A;  5FEF A;  5EVI D;  2XLN A;  4F94 A;  2ZC3 B;  1T1B A;  4MBH A;  1BLP A;  1MC0 A;  4PM8 A;  3M2K A;  1MBL A;  4KZ7 A;  4Y2F A;  3UB9 A;  5AVE A;  3EQV A;  3GQZ A;  2WGV A;  3NIA A;  4KG2 A;  2WGW B;  4LV0 A;  3Q7V B;  4I39 A;  2CMN A;  1GA0 A;  1W7F A;  4R4R A;  5FL3 A;  4C75 A;  1MPL A;  1N9B A;  4DRT A;  3LIA A;  4H6J B;  4BL3 A;  2ZMA A;  2Z2L B;  5U47 A;  4HIA A;  2WKE A;  1G5U A;  3VP3 A;  1G28 A;  4NKP A;  2WK0 A;  4ARZ A;  1OME A;  5GLA A;  2XQZ A;  3GDI A;  4QPR A;  3VMA A;  3K2N A;  3ISG A;  4WUJ A;  5HAP A;  1XPB A;  4ME4 A;  4JPM A;  3S7Q A;  3M6H A;  3NOP C;  3FYZ A;  4MNR A;  5EE8 A;  2PBD P;  5FQJ A;  3JYI A;  4NK3 A;  4KZ5 A;  1YKD A;  3NCK A;  1K6R A;  3Q82 A;  5J3W A;  1RCJ A;  3NOU C;  5F68 A;  1H8M A;  3FKV A;  3MJQ A;  4R38 A;  5CED A;  1E4D A;  4LV2 A;  4OPR A;  3R4K A;  4DE0 A;  4KZ4 A;  2ZC4 B;  2A2L A;  2V8C A;  2EX8 A;  4PMA A;  3O86 A;  3C4O A;  4GLQ A;  2PYP A;  1FOF A;  2WYX A;  2XEP A;  3H82 A;  4KZA A;  3BM6 A;  3G32 A;  5GL9 A;  2ZQA A;  4HY8 A;  2GJ3 A;  4WEL A;  3UMD A;  4BJP A;  2V8F A;  4GJ4 A;  3D72 A;  3T4Q A;  3A3E A;  2VV7 A;  3ZVT A;  4N1X A;  2QJ7 A;  1FQG A;  1YLT A;  4GW9 A;  4DMZ A;  3UE6 A;  1M6K A;  4Q0I A;  2ZBB A;  4HH3 A;  3D4F A;  4Y0O A;  5EPH A;  1OTD A;  3KX0 X;  4OOY A;  3S22 A;  2JKT I;  4E3N A;  3C30 A;  2ZQC A;  1UWP X;  3F1N A;  3ZG7 B;  1GSX A;  4FUW A;  4S2N A;  1FIK A;  3UN7 A;  5AQ9 A;  1RP5 A;  5G18 A;  2XD1 A;  3PBR A;  5E2H A;  4X55 A;  3IWI A;  5GHY A;  3W8K A;  2J3T C;  4QD4 A;  1NRJ A;  5CHU A;  3A3J A;  1ESI A;  1TDG A;  3S1Y A;  3WRT A;  3A0R A;  3LUQ A;  1ALQ A;  2OV5 A;  4GKU A;  3UNW A;  2VKS A;  3GRJ A;  1CJF A;  3UPO A;  2XK1 A;  2RCX A;  4JKT A;  3E2L A;  4JXS A;  3W4Q A;  3BLS A;  4ARZ B;  4HJ6 A;  2ZD8 A;  1ZG4 A;  3PBS A;  3WWX A;  5E43 A;  1NLZ A;  1JTG A;  3SH7 A;  1K54 C;  3N8S A;  3LR3 A;  5EV0 A;  1Y4O A;  4N92 A;  4I3A A;  4KG5 A;  3B3X A;  2D01 A;  4YWZ A;  2DMW A;  1PW1 A;  3N8L A;  4QY5 A;  4KZ6 A;  3LIF A;  4HJ4 A;  3OOV A;  3IF6 B;  2OWJ A;  1DP8 A;  1PI4 A;  4R70 A;  3Q7V A;  2HDR A;  2Y2N A;  5L09 A;  1ES5 A;  3ZNT A;  1J9M A;  5TJJ A;  2O9A A;  1ZG6 A;  2ACG A;  3MKF A;  1S1Z A;  3LIB A;  4IED A;  5TR7 A;  1M40 A;  2J9O A;  2G2U A;  5CER A;  1IYP A;  1W5D A;  1LT0 A;  5GLC A;  5CHJ A;  4PHT A;  3VOL A;  3HJI A;  4KUK A;  4WEJ A;  2A24 A;  3BY8 A;  3SH9 A;  3MF0 A;  2ZMF A;  4NET A;  3A0V A;  3ICY A;  3KYQ A;  1PWC A;  5FAS A;  3AGE A;  3F1P B;  4OVD A;  1H8Z A;  1F5M A;  3RFB A;  3BQ8 A;  4JF5 A;  1PZO A;  3W4P A;  1HVB A;  2Y2O A;  5CX7 A;  4MN5 A;  3SZT A;  5I94 A;  4DJ2 A;  1XGJ A;  5A92 A;  3IQA A;  3D3O A;  3UE0 A;  2H28 A;  5HPI A;  3SS3 A;  5DFX A;  1K56 A;  1STZ A;  5EVE A;  3LFV A;  2B95 A;  1NYY A;  4ZJ2 A;  1IYQ A;  1XXM A;  1TVF A;  3IX8 A;  4G3K A;  4Y17 A;  4IBX A;  4ZAM A;  1BLS A;  1IEM A;  2E8I A;  4X68 A;  4CJN A;  4R1G A;  4ZJ1 A;  5KZH A;  4R3J A;  4EEU A;  3OCL A;  4PPR A;  5IS1 A;  4LEN A;  1F9I A;  4X69 A;  3JPU A;  4PKY A;  4ETZ A;  3WS0 A;  4KEN B;  3LCE A;  2HGV A;  1FSW A;  5DF7 A;  4XUZ A;  4GB7 A;  1W8Y A;  3T4S A;  3UB7 A;  4WEK A;  3PR6 A;  1VEU B;  1BUE A;  3W2Z A;  2J7V A;  3ZDJ A;  5J8X A;  3QP8 A;  2QHK A;  1WYC A;  1S4R A;  4MMN A;  3PAE A;  2QPN A;  3ZG9 B;  3G2Z A;  4DXC A;  2KX6 A;  4Y15 A;  2Q0O A;  4JGO A;  2XH9 A;  1TS0 A;  4KZ3 A;  5F69 A;  1K54 A;  4CLC E;  3IH9 A;  4QHC A;  3F1O B;  4ID4 A;  2EX2 A;  3OLO A;  1FR1 A;  3QP5 A;  1XFN A;  4HEF A;  1YAX A;  3NEC A;  2C5W B;  5HWW A;  3T1X A;  3PYP A;  5HW3 A;  1YSP A;  3T1S A;  3MSH A;  4BWI A;  4ZTK A;  3FG8 A;  5L2F A;  2EWW A;  2B18 A;  4A5R A;  2W1R A;  3MS6 A;  1OTB A;  1E3U A;  2R78 A;  3FKW A;  5CTN A;  2W27 A;  4RX3 A;  1LL8 A;  4K0X A;  4OPY A;  1P97 A;  3NUL A;  1FCN A;  3GR2 A;  1D06 A;  3ITB A;  3QP4 A;  3L7H A;  1TEM A;  3AGF A;  3MZD A;  3E4Q A;  1CEG A;  4GHI A;  1BZA A;  4BEN A;  3BQA A;  3LIE A;  1DP6 A;  2XA7 S;  4OQG A;  4IVK A;  5EVI A;  1ZKJ A;  5EUA A;  1N4O A;  5CTM A;  2Y2K A;  3KSI A;  4RVA A;  5DTS A;  2Y8H A;  2D02 A;  2EFX A;  4CLC B;  2V2F F;  1RGY A;  2UV0 E;  2M7U A;  4PM7 A;  3BFF A;  5IT5 A;  3WS4 A;  3BFC A;  5F83 A;  3CPT A;  1I5Q A;  2IWC A;  1PWD A;  1EW0 A;  4KUO A;  3T12 B;  3IXB A;  3IXG A;  3PTE A;  2IWD A;  3MFD A;  3P09 A;  5F5Y A;  1BLH A;  4WMC D;  4P85 A;  2PBY A;  2ZLY A;  1H8Y A;  5MC7 A;  4IJG A;  4QU3 A;  2P04 A;  4FTX A;  4MDZ A;  1DP9 A;  2VGL M;  2QWS A;  2XFS A;  4NXE A;  5KIZ A;  1N9L A;  3Q81 A;  3F1P A;  2XF3 A;  1YLJ A;  3SOI A; 
#chains in the Genus database with same CATH homology
 3KO6 A;  1YKD A;  2JKT M;  4Q0J A;  1T1A A;  3LI8 A;  5J3W A;  5TBM B;  3NOU C;  4GHI B;  4HNB A;  5F68 A;  1H8M A;  2J3W A;  3GEC A;  2FZ0 A;  3MJQ A;  4R38 A;  4EW7 A;  4HI4 A;  3BWL A;  2VGL S;  4P6Z S;  3OBF A;  5F6A A;  4M4X A;  2Z6D A;  5HSQ A;  3R4K A;  1NWZ A;  3CLO A;  2A2L A;  3H82 B;  2V9A A;  2HJE A;  1GSV A;  2V1A A;  2W3F A;  3EGD C;  2QYB A;  2KDK A;  2ZOI A;  4GLQ A;  4CLC A;  2PYP A;  5AVF A;  3T4O A;  1OTI A;  3H82 A;  2PD8 A;  4HY8 A;  2GJ3 A;  2J80 A;  4WEL A;  3UMD A;  1TS7 A;  4BJP A;  4GJ4 A;  4NXF A;  3D72 A;  2P7J A;  3E4O A;  3T4Q A;  2VV7 A;  4HP4 A;  3MFX A;  2EWV A;  1D7E A;  4BBT A;  1UGU A;  2OAP 1;  2QJ7 A;  3NOT C;  4Q0H A;  5DFY A;  1OTE A;  1S67 L;  4GW9 A;  4DMZ A;  4MN6 A;  3UE6 A;  4Q0I A;  3UB8 A;  4LPZ A;  2ZBB A;  3UB6 A;  4HH3 A;  1T1C A;  1OTD A;  2O99 A;  3KX0 X;  2JKT I;  4UQI S;  3C30 A;  1MZU A;  1UWP X;  3F1N A;  4HJ3 A;  1Y28 A;  2PR5 A;  1GSX A;  2BAS A;  2QJ5 A;  1DRM A;  4HH2 A;  3PBN A;  3ZYT A;  1XJ4 A;  3P7N A;  2K7S A;  1V9Y A;  3E98 A;  3IS2 A;  3PBR A;  3RTY A;  4JGR A;  5DJT A;  3UE3 A;  1GSW A;  5DJU A;  3MQQ A;  3CWF A;  2J3T C;  3EWK A;  1NRJ A;  3PBO A;  4XT2 B;  1N9O A;  3A0R A;  3LUQ A;  4ZRR A;  5HDS A;  3A0S A;  4HOI A;  2JHE A;  3OCN A;  2VKS A;  3LYX A;  4YNR A;  1H3Q A;  2V0W A;  4G3V A;  3SW1 A;  2HF6 A;  4WLA A;  1V9Z A;  5AJG A;  3OC2 A;  1TS6 A;  4B93 A;  3BY9 A;  2L1M A;  4ARZ B;  2GNX A;  4HJ6 A;  1JNU A;  2K2N A;  3PBS A;  5DF9 A;  1NLZ A;  3MR0 A;  3T4J A;  3C38 A;  4PKY G;  3TRC A;  3LR3 A;  3FC7 A;  1F98 A;  4GS9 B;  4UQI M;  4MCW A;  4BBU A;  2JKR I;  4I3A A;  1OT9 A;  4WF0 A;  4OOL A;  4CQH A;  2D01 A;  4IUH A;  4YWZ A;  1NLY A;  2DMW A;  2W3E A;  2B02 A;  1XJ6 A;  2GZA A;  3LIF A;  5HZH A;  4HJ4 A;  3T4L A;  2OOL A;  3EEH A;  3OOV A;  3CUE A;  2OWJ A;  4EUV A;  1DP8 A;  5HPF A;  4R70 A;  1T18 A;  4LRX C;  4RQ9 A;  4L0L A;  4GS9 A;  1TS8 A;  2VV8 A;  5TJJ A;  1P9W A;  2O9A A;  4LRZ E;  4IHQ A;  2A24 B;  1S1Z A;  3LIB A;  4LRY C;  5I5L A;  2KOI A;  3T4T A;  2Y79 A;  5DKK A;  2EA9 A;  3VV4 A;  5TBM A;  4BMW A;  1LT0 A;  4JGP A;  3T4K A;  3CAX A;  2W1T B;  4NXB A;  3CI6 A;  4Y3I A;  3KYZ A;  1S1Y A;  4NXG A;  4PHT A;  3VOL A;  3HJI A;  3PHY A;  3B47 A;  3DBA A;  2A24 A;  4KUK A;  3BY8 A;  4WEJ A;  4KQD A;  1MKM A;  3MF0 A;  2QKP A;  3BW6 A;  2ZOH A;  2ZMF A;  3A0V A;  3ICY A;  2V1B A;  3F1N B;  2JN7 A;  5EFW A;  5G4Z A;  2PT7 A;  2ZMV A;  3KYQ A;  3EQU A;  4JGQ A;  1OPX A;  3IBJ A;  1OJG A;  3TW8 A;  2G7U A;  3R7W A;  2IA2 A;  4GCZ A;  2Z6C A;  1IOU A;  3F1P B;  2W1T A;  4EXO A;  1F5M A;  3LR4 A;  2FH5 A;  4HQA A;  2W0N A;  4IUK A;  4H6J A;  3RFB A;  3BQ8 A;  2XRO A;  1LSX A;  4I38 A;  4EES A;  1IFQ A;  5CX7 A;  4MN5 A;  1OT6 A;  2VA0 A;  3EOI A;  1LSW A;  4NEE D;  4EER A;  4DJ2 A;  2PR6 A;  3S7P A;  3ZQ5 A;  3D3O A;  4CLC C;  2PDR A;  3HJK A;  1P9R A;  2H28 A;  5HPI A;  5C5K A;  2NUT C;  5DFX A;  1STZ A;  3HCY A;  2JKR M;  3MMH A;  3LFV A;  4XT2 A;  3CIT A;  4L9G A;  3LID A;  3F1O A;  2VZW A;  1X0O A;  4P6Z M;  3K3D A;  3TJZ C;  1TF1 A;  3LIC A;  3BJN A;  3ULF A;  4EET B;  4G3K A;  4R6L A;  4EEP A;  3H7W A;  2W3G A;  4K08 A;  5J7E A;  2OWH A;  2PHY A;  5DKL A;  1XFQ A;  4EEU A;  3OCL A;  5IS1 A;  1F9I A;  4L9E A;  3NJA A;  1XJ2 A;  4PKY A;  4B9O A;  4ETZ A;  1S4S A;  2HJ9 C;  5L8M A;  1G6O A;  4ETX A;  4WL9 A;  3H9W A;  1W63 Q;  2HGV A;  2WKP A;  2MJ6 A;  4KQO A;  5HDC A;  4LLO B;  3T4S A;  4HP9 A;  4WEK A;  3PR6 A;  4Y5F A;  3UB7 A;  4UEY A;  2LB5 A;  1ODV A;  2O9C A;  4FSF A;  1ZHH B;  2INW A;  1OJ5 A;  3R7W B;  3W2Z A;  2VEA A;  3O5Y A;  2QHK A;  1S66 L;  2OAQ 1;  1XJ3 A;  2PD7 A;  3VE3 A;  3LR5 A;  2LB9 A;  1S4R A;  2L0W A;  4MMN A;  4MN7 A;  1OTA A;  2KLI A;  1W63 M;  2NUP C;  2I9V A;  5LBR A;  2M7V A;  1TD5 A;  2K31 A;  3U2A A;  5G4Y A;  4CLC D;  2KX6 A;  1T19 A;  3C2W A;  5HD3 A;  4JGO A;  4BBV A;  3MQ0 A;  1TS0 A;  1ZTU A;  4F3L B;  2HV1 A;  5F69 A;  2V0U A;  4CLC E;  2M1C A;  4DJ3 A;  3PBQ A;  2PYR A;  3F1O B;  3JVV A;  4I3J A;  3OLO A;  3E0Y A;  4DN0 A;  3T50 A;  4Z1W A;  1XFN A;  3IS2 B;  2GX5 A;  1YAX A;  3S7O A;  5HWW A;  3PYP A;  3G6O A;  5HWV A;  1YSP A;  3C8C A;  1P0Z A;  4G3W A;  3S7N A;  1WA9 A;  4BWI A;  4O0P A;  3FG8 A;  2EWW A;  3MQO A;  2B18 A;  5KSH A;  1UWN X;  2W1R A;  3NHQ A;  3K3C A;  2P08 A;  4F3L A;  1OTB A;  3CUE C;  4O01 A;  2O0Y A;  3B33 A;  2R78 A;  3KSG A;  5IU1 A;  3FPW A;  5HDD A;  2WKQ A;  4I3I A;  2W27 A;  1LL8 A;  5J4E A;  2YKH A;  2XA7 M;  2XRN A;  5K5B A;  1P97 A;  2L4R A;  4FOF A;  2VX8 A;  2VV6 A;  2W3H A;  3EGX C;  3JVU A;  4II7 A;  3V67 A;  1YSQ A;  2VJW A;  1VB6 A;  1D06 A;  3RH8 B;  3MXQ A;  1LSV A;  3LR0 A;  3TE8 A;  1VHM A;  3E4Q A;  5HWT A;  4GHI A;  3KSH A;  4OOM A;  3E4P A;  3BQA A;  3LIE A;  3KSF A;  1DP6 A;  2XA7 S;  1T1B A;  3FPV A;  3UME A;  1KOU A;  1MC0 A;  4WN5 A;  5HD5 A;  3KSI A;  4Y2F A;  3UB9 A;  2W3D A;  5AVE A;  2Y8H A;  2D02 A;  3EQV A;  2VLG A;  4CLC B;  3PXP A;  2M7U A;  4I39 A;  2CMN A;  4EU0 A;  5IT5 A;  5FL3 A;  3H7W B;  5HL6 A;  4HHD A;  2YKF A;  3LIA A;  5A8B A;  4R3A A;  3IBR A;  4H6J B;  1EW0 A;  4KUO A;  4PAU A;  3EEA A;  4EQ1 A;  4AFI A;  3LI9 A;  5F5Y A;  2O9B A;  4HIA A;  3B42 A;  4O8G A;  1G28 A;  4YOF A;  1BYW A;  4I5S A;  4NKP A;  5MC7 A;  4IJG A;  2P04 A;  4ARZ A;  1N9N A;  2WKR A;  4MDZ A;  3VE4 A;  3GDI A;  1DP9 A;  2VGL M;  4E04 A;  4QPR A;  3K2N A;  2QWS A;  4WUJ A;  3P01 A;  2XSS A;  3PBT A;  4ME4 A;  3S7Q A;  3NOP C;  4NXE A;  5KIZ A;  1N9L A;  4L9F A;  3F1P A;  2J3T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...