3B33A

Crystal structure of the pas domain of nitrogen regulation protein nr(ii) from vibrio parahaemolyticus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
TSLPSAILNNMVTATLILDDGLAIRYANPAAELLFSQSAKRIVEQSLSQLIQHASLDLALLTQPLQSGQSITDSDVTFVVDGRPLMLEVTVSPITWQRQLMLLVEMRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of PAS domain of nitrogen regulation protein NR(II) from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Transferase
molecule keywords Sensor protein
total genus 24
structure length 109
sequence length 109
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3b33A00
1G28A 3MFXA 3LIBA 4EESA 3E4OA 3CAXA 1LSWA 5DKLA 1GSVA 4DJ3A 1TS8A 5HDSA 3MR0A 5HD5A 1P0ZA 4HOIA 4L9FA 3GDIA 4NXBA 2WKQA 3BY8A 3FC7A 4KUKA 1BYWA 3MQQA 2P7JA 4R6LA 1S1YA 2PYRA 2Z6CA 3C2WA 5AVEA 3UB8A 2W0NA 1N9NA 2A24A 5HD3A 2KDKA 2PYPA 2WKPA 2A24B 2J80A 4KUOA 1OTEA 1T19A 1JNUA 3H82A 1XJ2A 5TBMA 3CLOA 5F69A 4YWZA 4I3AA 3VE3A 5HDCA 5J3WA 4NXFA 4BBUA 1XJ6A 1N9OA 5HWWA 2Z6DA 1TS0A 1WA9A 1T1BA 1XJ4A 2QJ5A 3K3CA 4I39A 4JGPA 4PKYA 1OJ5A 3NOPC 4XT2A 5F5YA 3EEHA 3KX0X 3LIDA 3RH8B 3F1OA 3H9WA 5G4ZA 3UMDA 4R38A 5HZHA 4HP9A 1XJ3A 4I5SA 1KOUA 4EQ1A 3H7WB 3A0VA 1S67L 2GJ3A 3E4QA 5F6AA 1XFQA 4H6JA 3LIEA 3NOUC 4HNBA 2V0WA 4PKYG 4DJ2A 1DP8A 4JGOA 4WL9A 3D72A 5EFWA 4F3LB 2JHEA 2CMNA 3RTYA 4LLOB 3UMEA 4BBTA 2PHYA 3CWFA 3IS2B 4I38A 4JGQA 1OTAA 5F68A 2VV8A 3K3DA 3UB6A 4BBVA 5HWVA 4EXOA 1GSXA 5DJUA 1S1ZA 2VV7A 4KQDA 5G4YA 3MXQA 3VOLA 2INWA 4RQ9A 2V0UA 2OWJA 1GSWA 3LIAA 3LI9A 4HI4A 4I3IA 1D06A 5DJTA 5HWTA 3NJAA 2PR5A 2ZOIA 1MZUA 5HSQA 3UE6A 5KIZA 1V9ZA 3EWKA 3F1PA 3ICYA 4WF0A 1F98A 1UWNX 2L1MA 3IBRA 4HQAA 3ULFA 4E04A 2V1AA 4HIAA 4R70A 3LUQA 3A0SA 1NWZA 3MJQA 4GHIB 4MN6A 3B33A 1DP9A 3GECA 4GS9B 4B9OA 2PD7A 4MN5A 3HJKA 4EETB 1EW0A 1F9IA 1OTIA 4HJ6A 3UB9A 2EA9A 1UWPX 1LSXA 2OWHA 4GHIA 3F1NA 1LT0A 1S4SA 4GW9A 3T50A 1UGUA 4WUJA 5A8BA 2QJ7A 3BWLA 2YKFA 3LI8A 4LRXC 2B02A 1X0OA 3LIFA 1ODVA 4L9EA 4M4XA 1V9YA 1OT9A 2WKRA 2YKHA 5J7EA 1DRMA 2V1BA 4HHDA 4LPZA 4L9GA 2VEAA 4EW7A 2ZOHA 1LSVA 2V9AA 3F1NB 3P7NA 4JGRA 1OTBA 4HJ3A 1D7EA 2H28A 5IU1A 2K7SA 2L4RA 3VE4A 2ZBBA 4HJ4A 5DKKA 3IS2A 2QKPA 3ZQ5A 4GS9A 3E4PA 3UB7A 1T1CA 1N9LA 5AVFA 4GCZA 3LICA 4EERA 3A0RA 3FG8A 3PHYA 5HDDA 1P97A 2QWSA 4H6JB 2D01A 4K08A 4NXGA 4NXEA 3OLOA 1S4RA 1Y28A 2QHKA 3F1PB 3H7WA 4HH3A 1S66L 4WN5A 2KX6A 2OOLA 3NOTC 4EEUA 3SW1A 2VV6A 5I5LA 3MQOA 1T1AA 2D02A 1T18A 1OT6A 2VLGA 1XFNA 3F1OB 2JN7A 3BY9A 4WLAA 1DP6A 2R78A 4I3JA 4XT2B 1TS7A 2HV1A 2PD8A 2I9VA 3NHQA 4HP4A 3HJIA 2W27A 4EEPA 1OJGA 4LRZE 2PR6A 2L0WA 1VB6A 3H82B 1LL8A 5TBMB 4HY8A 4F3LA 2BASA 1OTDA 4HH2A 4R3AA 2PDRA 5J4EA 5IS1A 1TS6A 3C8CA 3LYXA 4LRYC 3G6OA 3PYPA 2M1CA
chains in the Genus database with same CATH superfamily
3VFHA 5HD5A 1BUEA 5HPIA 4KUKA 2FH5A 1CF0A 5FEGA 4Z1WA 1IOUA 5F69A 3ZFZA 3LR3A 3K3CA 3LR5A 3A3FA 3E0YA 4I5SA 4IBRA 1VETB 5CX7A 1L0EA 4PKYG 4F94A 3BEBA 1YLYA 4EUZA 2J9PA 2EFUA 1GHMA 1FILA 1ONHA 3VMAA 2WAEA 1K56A 3JVUA 1MZUA 1NYMA 4QPRA 3NC8A 3ULFA 5FAQA 5GLBA 4U3TA 1UWNX 3LO7A 3A0SA 1LI9A 4MN5A 5AJGA 1OTIA 2AVXA 2WKEA 3Q7VB 1K38A 1SZVA 2JKTI 4MBFA 2E8JA 3N6IA 2XLNA 4G3VA 4CLCC 3EOIA 1PFLA 3NI9A 2VEAA 4EW7A 4JGRA 2P08A 2XD1A 4KZ3A 3T1XA 4OOLA 4GCZA 5AVFA 4EERA 3SH7A 2Y8HA 3MFDA 1JWZA 4OPRA 2R9WA 2D02A 2HV1A 1AWIA 3NHQA 3T1RA 5A90A 4R23A 4KQQA 5TBMB 3N8SA 3E2LA 2ZL1B 3SOIA 2A2LA 4OQ0A 2VX8A 4WM9A 4CLCA 1YLWA 2WKQA 1YMXA 1YSPA 2Z6CA 4FH4A 1IYQA 3LFVA 4LGWA 2PU4A 3DW0A 4UA6A 1XJ6A 4GN2A 3WRZA 2QJ5A 4QHCA 4L0LA 2ZMVA 1ERMA 2ZC5B 3H9WA 4Y5FA 1S67L 5IHVA 1K6RA 2J3TC 2J3TD 3UB6A 4NEED 3DWZA 4ZBEA 1NJ4A 4ETZA 5KIZA 3EWKA 4JKTA 3ICYA 2XFTA 4HQAA 4RYEA 3MJQA 2JBFA 4Y3IA 2ZC7A 2PD7A 4EETB 4IVIA 3GQZA 5L8MA 3F1NA 1KGGA 4HESA 4OQHA 4WUJA 5CGXA 3T4JA 3EQUA 1RCJA 3WS5A 2WKRA 2C5WB 4B93A 1FQGA 2ZOHA 2GDNA 3D3OA 4KZ6A 5EVID 1BLCA 2XQZA 3E4PA 4QU3A 3BFFA 4NXGA 4JPMA 1S66L 5F1FA 2OOLA 1XFNA 1F5MA 3PBSA 1DJBA 3GRJA 3HJIA 4EEPA 2Y2LA 2PR6A 1FCOA 3CI6A 1KVLA 1YSQA 4CLCD 3N7WA 4S2NA 2PBDP 1L0DA 2LB9A 5EVLA 5G18A 3UB8A 3PAGA 1WA9A 4Y0TA 3HLGA 3HUNA 3IXDA 3QP6A 3IX8A 2FFFB 2HDSA 3DBAA 3H7WB 3HBRA 1ES2A 1U60A 2R9XA 3QP5A 3C7UA 2KOIA 4BBVA 5DJUA 5D3OA 3MXQA 2Y2NA 3VSLA 2V0UA 1GSWA 1PW8A 5HWTA 2ZOIA 3G32A 1PIOA 4EBPA 5FQKA 1DP9A 3OPLA 2JKRI 5MC7A 4XUXA 5F1GA 4CQHA 5DFYA 2P9VB 3DTEA 4M4XA 1MY8A 1YMSA 3IBJA 2W1RA 3IWIA 4MBKA 5EM1A 2OLVA 3BECA 4S2PA 1YPRA 2WZXA 3ZG0A 4Y2FA 1EWZA 4Y7PA 1S0WA 2M7VA 2PD8A 2JKFA 4RX2A 4DE2A 4BD0A 5FASA 2HPBA 4CPKA 3FYZA 1NLZA 2QMIA 4B4XA 3MFXA 1K4FA 3IF6A 1HVBA 1E4DA 5E2FA 3GDIA 3ZVTA 4O8GA 2H5SA 5EUAA 1G6OA 2WKPA 1T19A 2ZMAA 3FPWA 4YWZA 5HWWA 1KDWA 5GHZA 1TS0A 1OJ5A 3NOPC 3EEHA 2G2UA 4HEFA 3MZEA 1KOUA 3QP8A 4WZ5C 2BTFP 4K0XA 4PM7A 1Q2QA 1LI0A 4GJ4A 4IHQA 1OTAA 1PWGA 4WMCD 1S1ZA 1YLTA 3VP0A 1C3BA 4RQ9A 4WMCA 4ZJ3A 1YQSA 2Y55A 1QMFA 2HDQA 4KENB 4GLQA 3EEAA 2WKIA 4GS9B 1EI5A 5GHXA 1PRQA 1TDGA 5DF7A 4JF5A 4K91A 5HL1A 1K25A 2QJ7A 3BWLA 2O9CA 1K0KA 2Y2MA 4JBFA 4N9KA 1Y54A 1SHVA 4QD4A 2XH9A 4NK3A 5J7EA 3IS2A 3HREA 4U0XA 2XD5A 2ZLYA 5HDDA 3UDFA 4NXEA 3F1PB 1Y28A 4HH3A 4YNRA 3NECA 4EEUA 3DAVA 3NBLA 1SDEA 3VV4A 1WYBA 4GNUA 3EQVA 1DJAA 2W27A 1JWVA 3DTIA 3P01A 1W79A 1LL8A 1FR6A 1W7FA 5EOOA 2BASA 5CHJA 4ZJ1A 5IS1A 2B5RA 3Q81A 4R6LA 5HARA 3LIBA 3U2AA 2Y2PA 1JTGA 1CI9A 2IA2A 5L07A 1K54C 4NXBA 2DNSA 2PYRA 3O5YA 1N9NA 5HD3A 4OLGA 2XROA 1TD5A 3H82A 4GZBA 5HFOA 1N9OA 4UQIM 1YLJA 1G5UA 4I39A 4IEDA 5F5YA 4LFUA 3HLBA 4LV2A 3F1OA 4B88A 2C6WB 3LIEA 2EX2A 1BULA 4EBNA 2JHEA 3RFBA 1DJCA 4QY5A 2VV8A 1GSXA 3AGDA 3LI9A 3T12B 3NJAA 4KZAA 2O9AA 4WF0A 3VFFA 1MBLA 4R70A 1E3UA 4QB8A 3D4FA 3FKVA 4B9OA 3HJKA 4GB7A 4G3KA 1MXOA 3MSHA 3C4PA 3GVBA 2B02A 2ZQCA 4L9EA 5C5KA 3CPTA 3MBZA 3Q82A 3F1NB 1D7EA 1N9LA 3FG8A 3TOIA 4S2KA 2D01A 3OLOA 1S4RA 3VE3A 4Y15A 2HZ5A 2JC7A 1T1AA 4OKPA 4QWOA 1OT6A 3KYZA 4X6TA 1CJFA 4OH0A 5DTSA 2KLIA 4OONA 3UE3A 2EWVA 4HY8A 3UPOA 3TSGA 1OTDA 3B47A 5FQ9A 3RXWA 2G7UA 2Q9NA 1SKOB 4IBXA 1PYYA 3BFDA 5EM0A 3OC2A 2A3UA 2JKRM 1H5XA 1PW1A 1FR1A 1FSWA 3WS0A 5FAOA 3ITAA 4C6YA 1RP5A 5TFQA 4JXGA 3GSGA 4WBGA 4CLCB 1KDSA 2HJ9C 2EXBA 3IHAA 5GHYA 1MPLA 1XFQA 4H6JA 5EV0A 4ME4A 3V67A 1BLPA 3VP1A 3N4IA 1XGIA 2OWJA 3HLCA 1NY0A 2ZM2A 4Q0IA 2VA0A 3UE1A 3GECA 5EVIC 1UWPX 5DTTA 1K57A 2ZC6B 4UQIS 5DVAA 3T4OA 2QPNA 3Q07A 1ODVA 3E2KA 1LL9A 5EVIB 5K5BA 2W3EA 3ZG7B 4HJ4A 2ZQDA 1XPBA 3OBFA 1SKFA 3SW1A 4WLAA 5EE8A 4X69A 5FEFA 1OJGA 2E8IA 4LV0A 3O86A 1KGEA 4F3LA 5J4EA 3JVVA 3PYPA 4X56A 3UE0A 1Z6FA 2WK0A 3VP4A 3V5MA 3C30A 5IT5A 4X68A 2W1TA 1ACFA 3C2WA 2H0YA 2EX9A 2J80A 4NETA 3M6HA 3G30A 4IVKA 5DFXA 3EGXC 1XJ4A 2X71A 4GDBA 4R38A 5M19A 3PAEA 3BQAA 3BQ8A 2VGJA 1DP8A 5GLCA 4X25A 3UMEA 3RTYA 4LLOB 4I38A 1N9BA 4ESPA 4WZ4A 2PR5A 2ZM8A 3O3VA 4UHUA 3ZNYA 2V8CA 5A92A 3WS4A 1F9IA 3UB9A 1EROA 4IUKA 1LL5A 1K4EA 5A8BA 2YKFA 2EFXA 1MWUA 1V9YA 1OT9A 4IJGA 1DRMA 4C3QA 4OLDA 2V9AA 3V50A 4MDZA 4N9LA 5LBRA 4CJNA 2ZBBA 1PNEA 3P09A 5I94A 2ZC3B 1T1CA 1IYOA 3IH8A 2J9OA 3Q1FA 3IXBA 4FUWA 3MKFA 1HD8A 5I5LA 2JE5A 4RVAA 3MZDA 2QZ6A 3PBRA 2Z2MB 5EVEA 2FZ0A 1GHPA 3P98A 3NDEA 3SS4A 3ZDJA 3G6OA 2XFSA 4KZ8A 2PU2A 1I5QA 2ACGA 1GSVA 4PPRA 3S7QA 4QY6A 4LCLA 5AVEA 5EOEA 4KUOA 3RJUA 4S2LA 3CLOA 1H8ZA 5DF8A 4GDNA 4C75A 3S4XA 4ARZB 4WL9A 5E2EA 2PHYA 2M7UA 3QP1A 2EWWA 4I3IA 5TJJA 3I7JA 4S2JA 3OOVA 3UNWA 1V9ZA 2Y79A 3F1PA 4Y13A 1YT4A 3IBRA 3C7VA 1CK3A 3PBOA 3Q7VA 3KYEA 3PBNA 2HGVA 2GX5A 2EA9A 1W5DA 4P6BA 3L7HA 1P9RA 4KG5A 3T1QB 1MWSA 5HX9A 2ZQ9A 3MQ0A 2QKPA 3UDIA 3UB7A 5L09A 1ERQA 4O7DA 2QWSA 4H6JB 5FI2A 1NRJA 3UN7A 3VP2A 2VKSA 3TRCA 4NKPA 3KYQA 5HAIA 3N8RA 4PM9A 3VOYA 4X55A 4EUVA 3KO6A 2L0WA 2PAVP 3A3EA 2XSSA 4X1MA 1VETA 1Y4OA 3WS1A 5CRFA 2WGWB 3GTCA 1ZG4A 1NXYA 3MQQA 1K57C 4Q0HA 2OV5A 2W0NA 3WRTA 4BL2A 1XA1A 5EPHA 3QP4A 3O88A 2WGWA 4JGPA 5CXWA 1OPXA 2DCFA 3KX0X 2WZZA 2Y91A 4HBUA 3ZG5A 4EQ1A 2GJ3A 2PRFA 1O07A 1MC0A 3QHYA 5HW3A 5FQMA 1FOFA 4YINA 2UV0E 3C38A 4KG6A 1DY6A 4EXOA 1KVMA 4HI4A 4Q8IA 4DRTA 3ISGA 4N1XA 5HSQA 5KSCA 1IYSA 3ZGAB 3W8KA 2V1AA 3T4LA 2HF6A 2HP6A 4UAAA 4GHIA 1UGUA 3LEQA 3IF6C 5F82A 1X0OA 3LIFA 2YKHA 2NUTC 2V1BA 4L9GA 3UPPA 1KE4A 3QP2A 5AQAA 2K7SA 1ES3A 1IEMA 3BRMA 3WS2A 4EV4A 4OP8A 1G6AA 2Y2HA 3ITBA 3V3SA 1KE0A 4GOGA 5AQ7A 1VEUA 3V3RA 2I9VA 1XA7A 1BTLA 3LGOA 1BSGA 2PT7A 3QNCA 4JXWA 3W4OA 1O7EA 2ZQAA 3T4QA 1G28A 4CLCE 1KGFA 3MR0A 4KZBA 1JVJA 5CERA 1QMEA 3FZCA 5M1AA 1BZAA 2BLSA 2KDKA 1XJ2A 3B3XA 3HCYA 5HDCA 3VP3A 1L0GA 4GD8A 5CEBA 2I72A 3KSHA 3IXHA 3M2KA 5CEDA 1ZKJA 1H0MA 3BM6A 3BLMA 1YLPA 4FH2A 4XXRA 2INWA 3NDGA 1HLUP 1VM1A 2Q9MA 5EECA 3SH8A 1CEFA 1RGZA 4P0MA 4BENA 4DDYA 4P85A 4HBTA 4DDSA 3UB5P 3BFGA 1EW0A 5TGFA 3NIAA 1PI4A 1ZHHB 1LT0A 3V39A 2Y59A 3S7NA 5CHMA 3LI8A 1LHYA 3ZYTA 3M6BA 2Q0OA 1K56D 4FSFA 3BLSA 4D60A 3VE4A 1K55C 2RL3A 4WYYA 3DWKA 3G2ZA 4D2OA 1NYYA 2O9BA 3S7OA 4HP4A 3LCEA 1VB6A 1ES4A 2V8FA 2XR0A 4BL3A 1K54A 3ZNTA 3M2JA 1ALQA 5DKLA 1TS8A 4E6WA 1YKDA 4P6ZS 3FC7A 1LLBA 2A24A 4S2NC 1ES5A 2W1TB 4II7A 4DF6A 1T1BA 4PKYA 2V20A 3IQAA 3A0VA 3S1YA 1NZUA 4HNBA 3G35A 1N4OA 1ESIA 3ZVWA 5FDSA 1MKIA 4H8RA 4O0PA 3ZG9B 1NRFA 1IFQA 5U47A 1MWTA 3VOZA 3JPUA 4LV1A 2QYBA 3O87A 3CPTB 3U4LP 3A3IA 1XX2A 3G2YA 2P9VA 3LUQA 4MNRA 1BLHA 3IWOA 2H10A 3BFEA 1MKMA 5CTNA 4S2OA 1MWRA 1G68A 2DMWA 2Y2OA 2EX8A 1OTBA 3ZQ5A 4JXVA 1PI5A 5CECA 1GHIA 4G3WA 4WN5A 4BBTA 4R1GA 2ZMFA 2VLGA 4PMAA 3BY9A 4I3JA 3WWXA 4EBLA 1TS7A 3MKEA 4R4RA 5FQQA 4NG2A 1FCNA 4R3JA 3IF5A 5JYOA 2HP5A 2K2NA 2ZD8A 2VGLM 5FAPA 3C4OA 4KQRA 4DE0A 1E3UD 1ZTUA 4ZTKA 2JKGA 3HLEA 3UDXA 4YOFA 4E3NA 3LR4A 5E43A 4OQIA 4S2IA 4BBUA 4DE1A 5BOHA 3NULA 4GKUA 4E3MA 1GA0A 5KMWA 3LIDA 5G4ZA 3C5AA 3IHBA 1XJ3A 3HUMA 4XUZA 2HDUA 5EFWA 5CGSA 4JGQA 3IS2B 5AQBA 2H0TA 2HJEA 2XRNA 3L9KA 3VSKA 4AFIA 4KQDA 1JTDA 3HLWA 3LIAA 1D06A 3PBTA 1K55A 2V2FF 4N1HA 4E04A 3K2NA 4UA7A 4P6ZM 4MN6A 4KZ5A 1WYCA 3N8LA 5AQ9A 1WE4A 3HVFA 3SZTA 2Y2IA 3BYDA 2WGVA 4JLFA 1SCWA 4DKIA 1BLSA 1CQAA 4UEYA 1H8YA 4YFMA 3P7NA 1J9MA 1KE3A 5DKKA 2B18A 3CMZA 3A0RA 3T4TA 3ZG8B 3IX3A 1H3QA 5DTKA 4DXBA 4GD6A 4E3LA 1TF1A 3G31A 4DMZA 1Z09A 3GMWA 3TJZC 1IKGA 5GL9A 1PWDA 5JYPA 3ZHHA 4EU0A 4M3KA 3LYXA 1HTZA 2WYXA 2M1CA 3KSIA 1LSWA 3HUOA 1FIKA 2XA7S 4OP5A 4HOIA 2HP9A 2XK1A 4WEJA 1S1YA 1E25A 2ZL1A 3KSFA 2A24B 2VJWA 4LENA 4RX3A 4OVDA 2MJ6A 5FDHA 2EX6A 1CI8A 4KZ7A 1W63Q 1I2SA 3BW6A 1A0KA 5FQJA 4ZRRA 3GV9A 5KZHA 2Z2LB 3RH8B 2ZC4B 4X1LA 5J8XA 3MMHA 1GA9A 2WGIA 3UO9A 3OPRA 1PZPA 2RCXA 4E3OA 5HAQA 3EGDC 3PR6A 5G4YA 2VGLS 5FA7A 4ZDXA 3ZCZA 3UE6A 3LY3A 5M18A 4JXSA 3MS6A 5FI6A 2O99A 2W3DA 2VZWA 1IYPA 2BG1A 3G34A 3FV7A 3OZHA 1P9WA 1SDNA 1YAXA 2Y4AA 1FCMA 5KSHA 4OPZA 3KSGA 4MMNA 4HHDA 3LEZA 5IU1A 4MN7A 4FTXA 3BFCA 3HL9A 2UWXA 1M40A 1P97A 4K08A 4R4SA 1ESUA 5FL3A 4DJ3A 3MQOA 5CHUA 1RGYA 3UY6A 4DXCA 4KG2A 4BMWA 4LRZE 4WZ5A 4DE3A 2ZQ8A 1XXMA 4HH2A 4R3AA 1TS6A 3AGEA 2EXAA 4EESA 3B42A 2OLUA 2OSUA 2DRWA 2NUPC 4L9FA 1ZG6A 3S22A 2K31A 4PHTA 5GLAA 2JKTM 1JNUA 1XP4A 4PM6A 4NXFA 2Z6DA 1F2KA 3IF6B 4XT2A 2ZJ9A 3CG5A 3SS5A 1K6SA 3OCNA 3UMDA 2ZQ7A 3E4QA 3IT9A 1VQQA 4Y0OA 3SH9A 1IKIA 2CMNA 4U0TA 5HWVA 3K3DA 2XEPA 2VV7A 3IX4A 5HAPA 4HIAA 4FD8A 4JF6A 4MBHA 1XGJA 1ZC2A 4N92A 4WEKA 2JCHA 2W3GA 2Y2GA 2CC1A 1OMEA 4GW9A 4MEZA 2X02A 3PTEA 4MCWA 1H8MA 2V1ZA 3D9YA 5TR7A 1LSVA 4FOFA 5A91A 2H28A 4E3KA 4PAUA 2Y2QA 3NCKA 3CITA 2VK3A 3PHYA 2QHKA 2P74A 3H7WA 1W8YA 3NOTC 2VV6A 4OPQA 3F1OB 1T18A 2JN7A 3PBQA 4A5RA 2ZM0A 3Q7ZA 4RA7A 1STZA 3SS3A 3H82B 1TVFA 3MZFA 3IXGA 3C8CA 4LRYC 4Y0UA 3FWLA 4EWFA 4ETXA 1PWCA 5HDSA 3HLFA 1P0ZA 3A3DA 2O0YA 2J7VA 4BLMA 3G4PA 1BYWA 2P7JA 3CHWP 5A93A 1JWPA 2PYPA 4Q0JA 3PXPA 5TBMA 1OTEA 1IELA 4I3AA 4IUHA 2J3WA 3W4QA 3OPHA 2WADA 3TE8A 5FATA 2OAQ1 1BT5A 1SKOA 2IWDA 4MLLA 5F6AA 4BJPA 4Y17A 2V0WA 4EQIA 2X01A 4DJ2A 4JGOA 3CJMA 1YM1A 3IWQA 1AXBA 4OQGA 5F68A 3A3JA 2VGKA 4X53A 4E6XA 3FPVA 1L2SA 3NY4A 1GCEA 5GLDA 3BJNA 5HPFA 3OCLA 4FCFA 3W4PA 1F98A 5FQIA 2L1MA 2HDRA 1NWZA 3LR0A 4GHIB 4JF4A 3B33A 3LY4A 3JYIA 1LSXA 3GR2A 4LRXC 1S6RA 4K0WA 3R4KA 5L2FA 1YLZA 4LV3A 1TEMA 3S7PA 3W2ZA 2WUQA 3AGFA 2L4RA 4BWIA 5FSRA 1Q2PA 3QNBA 4UA9A 1ONGA 1DP6A 4O01A 3E98A 2OAP1 2W3FA 3R7WA 2J8YA 2XA7M 4R0QA 4PM8A 3MF0A 1M6KA 3E4OA 3CAXA 2A49A 5DF9A 5CGWA 3DTMA 1NLYA 4P87A 4E3IA 3BY8A 1VHMA 5F83A 5E2HA 1J3WA 1FSYA 5CTMA 4E3JA 3FKWA 4S2MA 2XF3A 5J3WA 2Y2KA 2Y2JA 1TDLA 1PZOA 3MXRA 2WKHA 5HZHA 4HP9A 2LB5A 3NOUC 3D72A 4B4ZA 4F3LB 2IWCA 3UPNA 2W3HA 3CWFA 1CEGA 3R7WB 2XDMA 3VOLA 1W8QA 4BQMA 1VEUB 4Z9QA 2GZAA 5DJTA 4KZ9A 4R3BA 2XGNA 4KQOA 3T1SA 2IWBA 1L3LA 4KZ4A 2P04A 3T4SA 3HLDA 1NZOA 4ZAMA 3RXXA 3T4KA 4HJ6A 4DN0A 2OWHA 3T50A 4BD1A 1S4SA 3CUEC 2B95A 5EVIA 3MXSA 1W63M 2GNXA 2G2WA 4LCMA 4PM5A 4LPZA 3TW8A 3IH9A 4OPYA 3CUEA 4HJ3A 4WELA 2PBYA 5HL6A 2FFYA 4GS9A 2WAFA 3LICA 4ARZA 1HZOA 2KX6A 3CZDA 3DTKA 1I2WA 2R78A 4XT2B 1XKZA 5FI7A 5E2GA 3TG9A 1D1JA 4ID4A 4OOYA 4OOMA 1L0FA 4ZJ2A 4QJGA 2PDRA 3OPPA 5L10A
chains in the Genus database with same CATH topology
3LIBA 3U2AA 3KSIA 1LSWA 2XA7S 5HD5A 2IA2A 4HOIA 4NXBA 5HPIA 4WEJA 4KUKA 3MQQA 2FH5A 1S1YA 2PYRA 4Z1WA 4Q0HA 3O5YA 2W0NA 1N9NA 3KSFA 5HD3A 2A24B 2XROA 1IOUA 1TD5A 3H82A 2VJWA 5F69A 2MJ6A 1N9OA 4UQIM 1W63Q 3LR3A 3BW6A 3K3CA 4I39A 4JGPA 3LR5A 1OPXA 4ZRRA 5F5YA 3KX0X 3RH8B 3F1OA 3E0YA 4EQ1A 4I5SA 3MMHA 2GJ3A 5CX7A 4PKYG 3LIEA 1MC0A 2JHEA 3RFBA 3C38A 2VV8A 4EXOA 1GSXA 3EGDC 3PR6A 5G4YA 2VGLS 3LI9A 4HI4A 3NJAA 3JVUA 1MZUA 5HSQA 3UE6A 4QPRA 2O9AA 4WF0A 3ULFA 1UWNX 2V1AA 3T4LA 4R70A 3A0SA 2O99A 4B9OA 2W3DA 4MN5A 5AJGA 3HJKA 4G3KA 1OTIA 2HF6A 2VZWA 4GHIA 1UGUA 2JKTI 1P9WA 1YAXA 4G3VA 4CLCC 2B02A 1X0OA 3LIFA 4L9EA 3EOIA 5C5KA 5KSHA 2YKHA 2NUTC 3KSGA 4MMNA 2V1BA 4HHDA 4L9GA 2VEAA 4EW7A 4JGRA 3F1NB 1D7EA 5IU1A 4MN7A 2K7SA 2P08A 1N9LA 4OOLA 4GCZA 5AVFA 4EERA 3FG8A 2Y8HA 1P97A 4K08A 2D01A 3OLOA 1S4RA 3VE3A 5FL3A 4DJ3A 3MQOA 1T1AA 2D02A 1OT6A 2HV1A 2I9VA 3KYZA 3NHQA 4BMWA 4LRZE 2KLIA 5TBMB 3UE3A 2EWVA 4HY8A 2PT7A 1OTDA 4HH2A 4R3AA 3B47A 1TS6A 2G7UA 2A2LA 3T4QA 1G28A 4EESA 3B42A 4CLCE 2VX8A 3MR0A 3OC2A 2NUPC 4CLCA 2JKRM 4L9FA 2WKQA 1YSPA 2K31A 4PHTA 2Z6CA 2KDKA 2JKTM 1JNUA 1XJ2A 3LFVA 3HCYA 5HDCA 4NXFA 1XJ6A 2Z6DA 4CLCB 2QJ5A 2HJ9C 2ZMVA 4L0LA 3KSHA 4XT2A 3OCNA 3H9WA 3UMDA 4Y5FA 3E4QA 1S67L 1XFQA 4H6JA 2J3TC 2J3TD 2CMNA 4ME4A 3UB6A 5HWVA 3K3DA 3V67A 4NEED 2VV7A 2INWA 2OWJA 4ETZA 5KIZA 3EWKA 3ICYA 4HQAA 4Q0IA 4HIAA 2VA0A 3MJQA 4Y3IA 3GECA 2PD7A 4WEKA 4EETB 1EW0A 2W3GA 1UWPX 5L8MA 1ZHHB 1LT0A 3F1NA 4GW9A 4UQIS 4WUJA 3S7NA 3T4JA 3LI8A 3EQUA 3ZYTA 3T4OA 1ODVA 2WKRA 4MCWA 1H8MA 4B93A 2W3EA 4FSFA 5K5BA 2ZOHA 1LSVA 4FOFA 3D3OA 2H28A 3VE4A 4HJ4A 4PAUA 3E4PA 3CITA 3PHYA 4NXGA 3OBFA 2QHKA 3H7WA 1S66L 3NOTC 2OOLA 3SW1A 2VV6A 3F1OB 1T18A 1XFNA 4WLAA 2JN7A 3PBQA 2O9BA 3S7OA 1F5MA 3PBSA 4HP4A 1STZA 3HJIA 4EEPA 1OJGA 2PR6A 1VB6A 3H82B 4F3LA 5J4EA 3C8CA 3CI6A 4LRYC 3JVVA 3PYPA 1YSQA 4CLCD 4ETXA 5DKLA 1TS8A 5HDSA 1P0ZA 3C30A 2O0YA 5IT5A 1YKDA 2LB9A 4P6ZS 3FC7A 2W1TA 1BYWA 2P7JA 4R6LA 3UB8A 3C2WA 2A24A 2PYPA 4Q0JA 2J80A 3PXPA 1OTEA 5TBMA 4I3AA 4IUHA 2J3WA 2W1TB 4II7A 5DFXA 3EGXC 1WA9A 1T1BA 1XJ4A 4PKYA 3TE8A 4R38A 2OAQ1 3DBAA 3H7WB 3A0VA 5F6AA 3BQAA 4BJPA 4HNBA 3BQ8A 2V0WA 4DJ2A 1DP8A 4JGOA 4O0PA 3UMEA 3RTYA 4LLOB 5F68A 4I38A 2KOIA 4BBVA 5DJUA 1IFQA 3FPVA 3MXQA 2V0UA 1GSWA 5HWTA 2QYBA 2PR5A 2ZOIA 3BJNA 5HPFA 3OCLA 1F98A 2L1MA 3LUQA 1NWZA 3LR0A 4GHIB 3B33A 1DP9A 2JKRI 5MC7A 1F9IA 3UB9A 4IUKA 1LSXA 4CQHA 5DFYA 5A8BA 1MKMA 2YKFA 4LRXC 3R4KA 4M4XA 1V9YA 1OT9A 3IBJA 4IJGA 1DRMA 3W2ZA 2W1RA 3S7PA 2DMWA 2V9AA 4MDZA 1OTBA 5LBRA 2L4RA 2ZBBA 3ZQ5A 1T1CA 4G3WA 4Y2FA 4BWIA 4WN5A 4BBTA 5I5LA 2ZMFA 2VLGA 3BY9A 1DP6A 4I3JA 4O01A 2M7VA 1TS7A 3E98A 2PD8A 2OAP1 2W3FA 3PBRA 3R7WA 2FZ0A 2XA7M 2K2NA 2VGLM 1NLZA 3G6OA 3MF0A 3MFXA 3E4OA 3CAXA 5DF9A 1ZTUA 1GSVA 3S7QA 1NLYA 3GDIA 3BY8A 4O8GA 1VHMA 5AVEA 4YOFA 3LR4A 1G6OA 2WKPA 4KUOA 1T19A 3FPWA 3CLOA 4YWZA 5J3WA 4BBUA 5HWWA 1TS0A 1OJ5A 3NOPC 3EEHA 3LIDA 5G4ZA 5HZHA 4HP9A 1XJ3A 1KOUA 2LB5A 3NOUC 4ARZB 4WL9A 4GJ4A 4IHQA 3D72A 5EFWA 4F3LB 2W3HA 2PHYA 3CWFA 3IS2B 4JGQA 2M7UA 1OTAA 3R7WB 2HJEA 2XRNA 4AFIA 1S1ZA 4KQDA 3VOLA 2EWWA 4RQ9A 3LIAA 2GZAA 4I3IA 5TJJA 1D06A 5DJTA 3PBTA 3OOVA 4KQOA 1V9ZA 2Y79A 3F1PA 4GLQA 3EEAA 3IBRA 4E04A 3K2NA 4P6ZM 2P04A 4MN6A 3PBOA 3T4SA 4GS9B 3PBNA 3T4KA 4HJ6A 2HGVA 2GX5A 4DN0A 2EA9A 2OWHA 3T50A 1S4SA 3CUEC 2QJ7A 3BWLA 2O9CA 1P9RA 4UEYA 1W63M 2GNXA 5J7EA 4LPZA 3TW8A 3P7NA 3CUEA 4HJ3A 4WELA 5DKKA 3MQ0A 3IS2A 2QKPA 5HL6A 4GS9A 3UB7A 3LICA 2B18A 4ARZA 3A0RA 5HDDA 2QWSA 4H6JB 4NXEA 3T4TA 1NRJA 3F1PB 1Y28A 4HH3A 4YNRA 1H3QA 2KX6A 4EEUA 2VKSA 3TRCA 4NKPA 3KYQA 2R78A 4XT2B 3VV4A 1TF1A 3EQVA 4DMZA 2W27A 4EUVA 3TJZC 3P01A 3KO6A 2L0WA 1LL8A 4OOMA 2BASA 4EU0A 2PDRA 5IS1A 2XSSA 3LYXA 2M1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G28 A;  3MFX A;  3LIB A;  4EES A;  3E4O A;  3CAX A;  1LSW A;  5DKL A;  1GSV A;  4DJ3 A;  1TS8 A;  5HDS A;  3MR0 A;  5HD5 A;  1P0Z A;  4HOI A;  4L9F A;  3GDI A;  4NXB A;  2WKQ A;  3BY8 A;  3FC7 A;  4KUK A;  1BYW A;  3MQQ A;  2P7J A;  4R6L A;  1S1Y A;  2PYR A;  2Z6C A;  3C2W A;  5AVE A;  3UB8 A;  2W0N A;  1N9N A;  2A24 A;  5HD3 A;  2KDK A;  2PYP A;  2WKP A;  2A24 B;  2J80 A;  4KUO A;  1OTE A;  1T19 A;  1JNU A;  3H82 A;  1XJ2 A;  5TBM A;  3CLO A;  5F69 A;  4YWZ A;  4I3A A;  3VE3 A;  5HDC A;  5J3W A;  4NXF A;  4BBU A;  1XJ6 A;  1N9O A;  5HWW A;  2Z6D A;  1TS0 A;  1WA9 A;  1T1B A;  1XJ4 A;  2QJ5 A;  3K3C A;  4I39 A;  4JGP A;  4PKY A;  1OJ5 A;  3NOP C;  4XT2 A;  5F5Y A;  3EEH A;  3KX0 X;  3LID A;  3RH8 B;  3F1O A;  3H9W A;  5G4Z A;  3UMD A;  4R38 A;  5HZH A;  4HP9 A;  1XJ3 A;  4I5S A;  1KOU A;  4EQ1 A;  3H7W B;  3A0V A;  1S67 L;  2GJ3 A;  3E4Q A;  5F6A A;  1XFQ A;  4H6J A;  3LIE A;  3NOU C;  4HNB A;  2V0W A;  4PKY G;  4DJ2 A;  1DP8 A;  4JGO A;  4WL9 A;  3D72 A;  5EFW A;  4F3L B;  2JHE A;  2CMN A;  3RTY A;  4LLO B;  3UME A;  4BBT A;  2PHY A;  3CWF A;  3IS2 B;  4I38 A;  4JGQ A;  1OTA A;  5F68 A;  2VV8 A;  3K3D A;  3UB6 A;  4BBV A;  5HWV A;  4EXO A;  1GSX A;  5DJU A;  1S1Z A;  2VV7 A;  4KQD A;  5G4Y A;  3MXQ A;  3VOL A;  2INW A;  4RQ9 A;  2V0U A;  2OWJ A;  1GSW A;  3LIA A;  3LI9 A;  4HI4 A;  4I3I A;  1D06 A;  5DJT A;  5HWT A;  3NJA A;  2PR5 A;  2ZOI A;  1MZU A;  5HSQ A;  3UE6 A;  5KIZ A;  1V9Z A;  3EWK A;  3F1P A;  3ICY A;  4WF0 A;  1F98 A;  1UWN X;  2L1M A;  3IBR A;  4HQA A;  3ULF A;  4E04 A;  2V1A A;  4HIA A;  4R70 A;  3LUQ A;  3A0S A;  1NWZ A;  3MJQ A;  4GHI B;  4MN6 A;  3B33 A;  1DP9 A;  3GEC A;  4GS9 B;  4B9O A;  2PD7 A;  4MN5 A;  3HJK A;  4EET B;  1EW0 A;  1F9I A;  1OTI A;  4HJ6 A;  3UB9 A;  2EA9 A;  1UWP X;  1LSX A;  2OWH A;  4GHI A;  3F1N A;  1LT0 A;  1S4S A;  4GW9 A;  3T50 A;  1UGU A;  4WUJ A;  5A8B A;  2QJ7 A;  3BWL A;  2YKF A;  3LI8 A;  4LRX C;  2B02 A;  1X0O A;  3LIF A;  1ODV A;  4L9E A;  4M4X A;  1V9Y A;  1OT9 A;  2WKR A;  2YKH A;  5J7E A;  1DRM A;  2V1B A;  4HHD A;  4LPZ A;  4L9G A;  2VEA A;  4EW7 A;  2ZOH A;  1LSV A;  2V9A A;  3F1N B;  3P7N A;  4JGR A;  1OTB A;  4HJ3 A;  1D7E A;  2H28 A;  5IU1 A;  2K7S A;  2L4R A;  3VE4 A;  2ZBB A;  4HJ4 A;  5DKK A;  3IS2 A;  2QKP A;  3ZQ5 A;  4GS9 A;  3E4P A;  3UB7 A;  1T1C A;  1N9L A;  5AVF A;  4GCZ A;  3LIC A;  4EER A;  3A0R A;  3FG8 A;  3PHY A;  5HDD A;  1P97 A;  2QWS A;  4H6J B;  2D01 A;  4K08 A;  4NXG A;  4NXE A;  3OLO A;  1S4R A;  1Y28 A;  2QHK A;  3F1P B;  3H7W A;  4HH3 A;  1S66 L;  4WN5 A;  2KX6 A;  2OOL A;  3NOT C;  4EEU A;  3SW1 A;  2VV6 A;  5I5L A;  3MQO A;  1T1A A;  2D02 A;  1T18 A;  1OT6 A;  2VLG A;  1XFN A;  3F1O B;  2JN7 A;  3BY9 A;  4WLA A;  1DP6 A;  2R78 A;  4I3J A;  4XT2 B;  1TS7 A;  2HV1 A;  2PD8 A;  2I9V A;  3NHQ A;  4HP4 A;  3HJI A;  2W27 A;  4EEP A;  1OJG A;  4LRZ E;  2PR6 A;  2L0W A;  1VB6 A;  3H82 B;  1LL8 A;  5TBM B;  4HY8 A;  4F3L A;  2BAS A;  1OTD A;  4HH2 A;  4R3A A;  2PDR A;  5J4E A;  5IS1 A;  1TS6 A;  3C8C A;  3LYX A;  4LRY C;  3G6O A;  3PYP A;  2M1C A; 
#chains in the Genus database with same CATH topology
 3VFH A;  5HD5 A;  1BUE A;  5HPI A;  4KUK A;  2FH5 A;  1CF0 A;  5FEG A;  4Z1W A;  1IOU A;  5F69 A;  3ZFZ A;  3LR3 A;  3K3C A;  3LR5 A;  3A3F A;  3E0Y A;  4I5S A;  4IBR A;  1VET B;  5CX7 A;  1L0E A;  4PKY G;  4F94 A;  3BEB A;  1YLY A;  4EUZ A;  2J9P A;  2EFU A;  1GHM A;  1FIL A;  1ONH A;  3VMA A;  2WAE A;  1K56 A;  3JVU A;  1MZU A;  1NYM A;  4QPR A;  3NC8 A;  3ULF A;  5FAQ A;  5GLB A;  4U3T A;  1UWN X;  3LO7 A;  3A0S A;  1LI9 A;  4MN5 A;  5AJG A;  1OTI A;  2AVX A;  2WKE A;  3Q7V B;  1K38 A;  1SZV A;  2JKT I;  4MBF A;  2E8J A;  3N6I A;  2XLN A;  4G3V A;  4CLC C;  3EOI A;  1PFL A;  3NI9 A;  2VEA A;  4EW7 A;  4JGR A;  2P08 A;  2XD1 A;  4KZ3 A;  3T1X A;  4OOL A;  4GCZ A;  5AVF A;  4EER A;  3SH7 A;  2Y8H A;  3MFD A;  1JWZ A;  4OPR A;  2R9W A;  2D02 A;  2HV1 A;  1AWI A;  3NHQ A;  3T1R A;  5A90 A;  4R23 A;  4KQQ A;  5TBM B;  3N8S A;  3E2L A;  2ZL1 B;  3SOI A;  2A2L A;  4OQ0 A;  2VX8 A;  4WM9 A;  4CLC A;  1YLW A;  2WKQ A;  1YMX A;  1YSP A;  2Z6C A;  4FH4 A;  1IYQ A;  3LFV A;  4LGW A;  2PU4 A;  3DW0 A;  4UA6 A;  1XJ6 A;  4GN2 A;  3WRZ A;  2QJ5 A;  4QHC A;  4L0L A;  2ZMV A;  1ERM A;  2ZC5 B;  3H9W A;  4Y5F A;  1S67 L;  5IHV A;  1K6R A;  2J3T C;  2J3T D;  3UB6 A;  4NEE D;  3DWZ A;  4ZBE A;  1NJ4 A;  4ETZ A;  5KIZ A;  3EWK A;  4JKT A;  3ICY A;  2XFT A;  4HQA A;  4RYE A;  3MJQ A;  2JBF A;  4Y3I A;  2ZC7 A;  2PD7 A;  4EET B;  4IVI A;  3GQZ A;  5L8M A;  3F1N A;  1KGG A;  4HES A;  4OQH A;  4WUJ A;  5CGX A;  3T4J A;  3EQU A;  1RCJ A;  3WS5 A;  2WKR A;  2C5W B;  4B93 A;  1FQG A;  2ZOH A;  2GDN A;  3D3O A;  4KZ6 A;  5EVI D;  1BLC A;  2XQZ A;  3E4P A;  4QU3 A;  3BFF A;  4NXG A;  4JPM A;  1S66 L;  5F1F A;  2OOL A;  1XFN A;  1F5M A;  3PBS A;  1DJB A;  3GRJ A;  3HJI A;  4EEP A;  2Y2L A;  2PR6 A;  1FCO A;  3CI6 A;  1KVL A;  1YSQ A;  4CLC D;  3N7W A;  4S2N A;  2PBD P;  1L0D A;  2LB9 A;  5EVL A;  5G18 A;  3UB8 A;  3PAG A;  1WA9 A;  4Y0T A;  3HLG A;  3HUN A;  3IXD A;  3QP6 A;  3IX8 A;  2FFF B;  2HDS A;  3DBA A;  3H7W B;  3HBR A;  1ES2 A;  1U60 A;  2R9X A;  3QP5 A;  3C7U A;  2KOI A;  4BBV A;  5DJU A;  5D3O A;  3MXQ A;  2Y2N A;  3VSL A;  2V0U A;  1GSW A;  1PW8 A;  5HWT A;  2ZOI A;  3G32 A;  1PIO A;  4EBP A;  5FQK A;  1DP9 A;  3OPL A;  2JKR I;  5MC7 A;  4XUX A;  5F1G A;  4CQH A;  5DFY A;  2P9V B;  3DTE A;  4M4X A;  1MY8 A;  1YMS A;  3IBJ A;  2W1R A;  3IWI A;  4MBK A;  5EM1 A;  2OLV A;  3BEC A;  4S2P A;  1YPR A;  2WZX A;  3ZG0 A;  4Y2F A;  1EWZ A;  4Y7P A;  1S0W A;  2M7V A;  2PD8 A;  2JKF A;  4RX2 A;  4DE2 A;  4BD0 A;  5FAS A;  2HPB A;  4CPK A;  3FYZ A;  1NLZ A;  2QMI A;  4B4X A;  3MFX A;  1K4F A;  3IF6 A;  1HVB A;  1E4D A;  5E2F A;  3GDI A;  3ZVT A;  4O8G A;  2H5S A;  5EUA A;  1G6O A;  2WKP A;  1T19 A;  2ZMA A;  3FPW A;  4YWZ A;  5HWW A;  1KDW A;  5GHZ A;  1TS0 A;  1OJ5 A;  3NOP C;  3EEH A;  2G2U A;  4HEF A;  3MZE A;  1KOU A;  3QP8 A;  4WZ5 C;  2BTF P;  4K0X A;  4PM7 A;  1Q2Q A;  1LI0 A;  4GJ4 A;  4IHQ A;  1OTA A;  1PWG A;  4WMC D;  1S1Z A;  1YLT A;  3VP0 A;  1C3B A;  4RQ9 A;  4WMC A;  4ZJ3 A;  1YQS A;  2Y55 A;  1QMF A;  2HDQ A;  4KEN B;  4GLQ A;  3EEA A;  2WKI A;  4GS9 B;  1EI5 A;  5GHX A;  1PRQ A;  1TDG A;  5DF7 A;  4JF5 A;  4K91 A;  5HL1 A;  1K25 A;  2QJ7 A;  3BWL A;  2O9C A;  1K0K A;  2Y2M A;  4JBF A;  4N9K A;  1Y54 A;  1SHV A;  4QD4 A;  2XH9 A;  4NK3 A;  5J7E A;  3IS2 A;  3HRE A;  4U0X A;  2XD5 A;  2ZLY A;  5HDD A;  3UDF A;  4NXE A;  3F1P B;  1Y28 A;  4HH3 A;  4YNR A;  3NEC A;  4EEU A;  3DAV A;  3NBL A;  1SDE A;  3VV4 A;  1WYB A;  4GNU A;  3EQV A;  1DJA A;  2W27 A;  1JWV A;  3DTI A;  3P01 A;  1W79 A;  1LL8 A;  1FR6 A;  1W7F A;  5EOO A;  2BAS A;  5CHJ A;  4ZJ1 A;  5IS1 A;  2B5R A;  3Q81 A;  4R6L A;  5HAR A;  3LIB A;  3U2A A;  2Y2P A;  1JTG A;  1CI9 A;  2IA2 A;  5L07 A;  1K54 C;  4NXB A;  2DNS A;  2PYR A;  3O5Y A;  1N9N A;  5HD3 A;  4OLG A;  2XRO A;  1TD5 A;  3H82 A;  4GZB A;  5HFO A;  1N9O A;  4UQI M;  1YLJ A;  1G5U A;  4I39 A;  4IED A;  5F5Y A;  4LFU A;  3HLB A;  4LV2 A;  3F1O A;  4B88 A;  2C6W B;  3LIE A;  2EX2 A;  1BUL A;  4EBN A;  2JHE A;  3RFB A;  1DJC A;  4QY5 A;  2VV8 A;  1GSX A;  3AGD A;  3LI9 A;  3T12 B;  3NJA A;  4KZA A;  2O9A A;  4WF0 A;  3VFF A;  1MBL A;  4R70 A;  1E3U A;  4QB8 A;  3D4F A;  3FKV A;  4B9O A;  3HJK A;  4GB7 A;  4G3K A;  1MXO A;  3MSH A;  3C4P A;  3GVB A;  2B02 A;  2ZQC A;  4L9E A;  5C5K A;  3CPT A;  3MBZ A;  3Q82 A;  3F1N B;  1D7E A;  1N9L A;  3FG8 A;  3TOI A;  4S2K A;  2D01 A;  3OLO A;  1S4R A;  3VE3 A;  4Y15 A;  2HZ5 A;  2JC7 A;  1T1A A;  4OKP A;  4QWO A;  1OT6 A;  3KYZ A;  4X6T A;  1CJF A;  4OH0 A;  5DTS A;  2KLI A;  4OON A;  3UE3 A;  2EWV A;  4HY8 A;  3UPO A;  3TSG A;  1OTD A;  3B47 A;  5FQ9 A;  3RXW A;  2G7U A;  2Q9N A;  1SKO B;  4IBX A;  1PYY A;  3BFD A;  5EM0 A;  3OC2 A;  2A3U A;  2JKR M;  1H5X A;  1PW1 A;  1FR1 A;  1FSW A;  3WS0 A;  5FAO A;  3ITA A;  4C6Y A;  1RP5 A;  5TFQ A;  4JXG A;  3GSG A;  4WBG A;  4CLC B;  1KDS A;  2HJ9 C;  2EXB A;  3IHA A;  5GHY A;  1MPL A;  1XFQ A;  4H6J A;  5EV0 A;  4ME4 A;  3V67 A;  1BLP A;  3VP1 A;  3N4I A;  1XGI A;  2OWJ A;  3HLC A;  1NY0 A;  2ZM2 A;  4Q0I A;  2VA0 A;  3UE1 A;  3GEC A;  5EVI C;  1UWP X;  5DTT A;  1K57 A;  2ZC6 B;  4UQI S;  5DVA A;  3T4O A;  2QPN A;  3Q07 A;  1ODV A;  3E2K A;  1LL9 A;  5EVI B;  5K5B A;  2W3E A;  3ZG7 B;  4HJ4 A;  2ZQD A;  1XPB A;  3OBF A;  1SKF A;  3SW1 A;  4WLA A;  5EE8 A;  4X69 A;  5FEF A;  1OJG A;  2E8I A;  4LV0 A;  3O86 A;  1KGE A;  4F3L A;  5J4E A;  3JVV A;  3PYP A;  4X56 A;  3UE0 A;  1Z6F A;  2WK0 A;  3VP4 A;  3V5M A;  3C30 A;  5IT5 A;  4X68 A;  2W1T A;  1ACF A;  3C2W A;  2H0Y A;  2EX9 A;  2J80 A;  4NET A;  3M6H A;  3G30 A;  4IVK A;  5DFX A;  3EGX C;  1XJ4 A;  2X71 A;  4GDB A;  4R38 A;  5M19 A;  3PAE A;  3BQA A;  3BQ8 A;  2VGJ A;  1DP8 A;  5GLC A;  4X25 A;  3UME A;  3RTY A;  4LLO B;  4I38 A;  1N9B A;  4ESP A;  4WZ4 A;  2PR5 A;  2ZM8 A;  3O3V A;  4UHU A;  3ZNY A;  2V8C A;  5A92 A;  3WS4 A;  1F9I A;  3UB9 A;  1ERO A;  4IUK A;  1LL5 A;  1K4E A;  5A8B A;  2YKF A;  2EFX A;  1MWU A;  1V9Y A;  1OT9 A;  4IJG A;  1DRM A;  4C3Q A;  4OLD A;  2V9A A;  3V50 A;  4MDZ A;  4N9L A;  5LBR A;  4CJN A;  2ZBB A;  1PNE A;  3P09 A;  5I94 A;  2ZC3 B;  1T1C A;  1IYO A;  3IH8 A;  2J9O A;  3Q1F A;  3IXB A;  4FUW A;  3MKF A;  1HD8 A;  5I5L A;  2JE5 A;  4RVA A;  3MZD A;  2QZ6 A;  3PBR A;  2Z2M B;  5EVE A;  2FZ0 A;  1GHP A;  3P98 A;  3NDE A;  3SS4 A;  3ZDJ A;  3G6O A;  2XFS A;  4KZ8 A;  2PU2 A;  1I5Q A;  2ACG A;  1GSV A;  4PPR A;  3S7Q A;  4QY6 A;  4LCL A;  5AVE A;  5EOE A;  4KUO A;  3RJU A;  4S2L A;  3CLO A;  1H8Z A;  5DF8 A;  4GDN A;  4C75 A;  3S4X A;  4ARZ B;  4WL9 A;  5E2E A;  2PHY A;  2M7U A;  3QP1 A;  2EWW A;  4I3I A;  5TJJ A;  3I7J A;  4S2J A;  3OOV A;  3UNW A;  1V9Z A;  2Y79 A;  3F1P A;  4Y13 A;  1YT4 A;  3IBR A;  3C7V A;  1CK3 A;  3PBO A;  3Q7V A;  3KYE A;  3PBN A;  2HGV A;  2GX5 A;  2EA9 A;  1W5D A;  4P6B A;  3L7H A;  1P9R A;  4KG5 A;  3T1Q B;  1MWS A;  5HX9 A;  2ZQ9 A;  3MQ0 A;  2QKP A;  3UDI A;  3UB7 A;  5L09 A;  1ERQ A;  4O7D A;  2QWS A;  4H6J B;  5FI2 A;  1NRJ A;  3UN7 A;  3VP2 A;  2VKS A;  3TRC A;  4NKP A;  3KYQ A;  5HAI A;  3N8R A;  4PM9 A;  3VOY A;  4X55 A;  4EUV A;  3KO6 A;  2L0W A;  2PAV P;  3A3E A;  2XSS A;  4X1M A;  1VET A;  1Y4O A;  3WS1 A;  5CRF A;  2WGW B;  3GTC A;  1ZG4 A;  1NXY A;  3MQQ A;  1K57 C;  4Q0H A;  2OV5 A;  2W0N A;  3WRT A;  4BL2 A;  1XA1 A;  5EPH A;  3QP4 A;  3O88 A;  2WGW A;  4JGP A;  5CXW A;  1OPX A;  2DCF A;  3KX0 X;  2WZZ A;  2Y91 A;  4HBU A;  3ZG5 A;  4EQ1 A;  2GJ3 A;  2PRF A;  1O07 A;  1MC0 A;  3QHY A;  5HW3 A;  5FQM A;  1FOF A;  4YIN A;  2UV0 E;  3C38 A;  4KG6 A;  1DY6 A;  4EXO A;  1KVM A;  4HI4 A;  4Q8I A;  4DRT A;  3ISG A;  4N1X A;  5HSQ A;  5KSC A;  1IYS A;  3ZGA B;  3W8K A;  2V1A A;  3T4L A;  2HF6 A;  2HP6 A;  4UAA A;  4GHI A;  1UGU A;  3LEQ A;  3IF6 C;  5F82 A;  1X0O A;  3LIF A;  2YKH A;  2NUT C;  2V1B A;  4L9G A;  3UPP A;  1KE4 A;  3QP2 A;  5AQA A;  2K7S A;  1ES3 A;  1IEM A;  3BRM A;  3WS2 A;  4EV4 A;  4OP8 A;  1G6A A;  2Y2H A;  3ITB A;  3V3S A;  1KE0 A;  4GOG A;  5AQ7 A;  1VEU A;  3V3R A;  2I9V A;  1XA7 A;  1BTL A;  3LGO A;  1BSG A;  2PT7 A;  3QNC A;  4JXW A;  3W4O A;  1O7E A;  2ZQA A;  3T4Q A;  1G28 A;  4CLC E;  1KGF A;  3MR0 A;  4KZB A;  1JVJ A;  5CER A;  1QME A;  3FZC A;  5M1A A;  1BZA A;  2BLS A;  2KDK A;  1XJ2 A;  3B3X A;  3HCY A;  5HDC A;  3VP3 A;  1L0G A;  4GD8 A;  5CEB A;  2I72 A;  3KSH A;  3IXH A;  3M2K A;  5CED A;  1ZKJ A;  1H0M A;  3BM6 A;  3BLM A;  1YLP A;  4FH2 A;  4XXR A;  2INW A;  3NDG A;  1HLU P;  1VM1 A;  2Q9M A;  5EEC A;  3SH8 A;  1CEF A;  1RGZ A;  4P0M A;  4BEN A;  4DDY A;  4P85 A;  4HBT A;  4DDS A;  3UB5 P;  3BFG A;  1EW0 A;  5TGF A;  3NIA A;  1PI4 A;  1ZHH B;  1LT0 A;  3V39 A;  2Y59 A;  3S7N A;  5CHM A;  3LI8 A;  1LHY A;  3ZYT A;  3M6B A;  2Q0O A;  1K56 D;  4FSF A;  3BLS A;  4D60 A;  3VE4 A;  1K55 C;  2RL3 A;  4WYY A;  3DWK A;  3G2Z A;  4D2O A;  1NYY A;  2O9B A;  3S7O A;  4HP4 A;  3LCE A;  1VB6 A;  1ES4 A;  2V8F A;  2XR0 A;  4BL3 A;  1K54 A;  3ZNT A;  3M2J A;  1ALQ A;  5DKL A;  1TS8 A;  4E6W A;  1YKD A;  4P6Z S;  3FC7 A;  1LLB A;  2A24 A;  4S2N C;  1ES5 A;  2W1T B;  4II7 A;  4DF6 A;  1T1B A;  4PKY A;  2V20 A;  3IQA A;  3A0V A;  3S1Y A;  1NZU A;  4HNB A;  3G35 A;  1N4O A;  1ESI A;  3ZVW A;  5FDS A;  1MKI A;  4H8R A;  4O0P A;  3ZG9 B;  1NRF A;  1IFQ A;  5U47 A;  1MWT A;  3VOZ A;  3JPU A;  4LV1 A;  2QYB A;  3O87 A;  3CPT B;  3U4L P;  3A3I A;  1XX2 A;  3G2Y A;  2P9V A;  3LUQ A;  4MNR A;  1BLH A;  3IWO A;  2H10 A;  3BFE A;  1MKM A;  5CTN A;  4S2O A;  1MWR A;  1G68 A;  2DMW A;  2Y2O A;  2EX8 A;  1OTB A;  3ZQ5 A;  4JXV A;  1PI5 A;  5CEC A;  1GHI A;  4G3W A;  4WN5 A;  4BBT A;  4R1G A;  2ZMF A;  2VLG A;  4PMA A;  3BY9 A;  4I3J A;  3WWX A;  4EBL A;  1TS7 A;  3MKE A;  4R4R A;  5FQQ A;  4NG2 A;  1FCN A;  4R3J A;  3IF5 A;  5JYO A;  2HP5 A;  2K2N A;  2ZD8 A;  2VGL M;  5FAP A;  3C4O A;  4KQR A;  4DE0 A;  1E3U D;  1ZTU A;  4ZTK A;  2JKG A;  3HLE A;  3UDX A;  4YOF A;  4E3N A;  3LR4 A;  5E43 A;  4OQI A;  4S2I A;  4BBU A;  4DE1 A;  5BOH A;  3NUL A;  4GKU A;  4E3M A;  1GA0 A;  5KMW A;  3LID A;  5G4Z A;  3C5A A;  3IHB A;  1XJ3 A;  3HUM A;  4XUZ A;  2HDU A;  5EFW A;  5CGS A;  4JGQ A;  3IS2 B;  5AQB A;  2H0T A;  2HJE A;  2XRN A;  3L9K A;  3VSK A;  4AFI A;  4KQD A;  1JTD A;  3HLW A;  3LIA A;  1D06 A;  3PBT A;  1K55 A;  2V2F F;  4N1H A;  4E04 A;  3K2N A;  4UA7 A;  4P6Z M;  4MN6 A;  4KZ5 A;  1WYC A;  3N8L A;  5AQ9 A;  1WE4 A;  3HVF A;  3SZT A;  2Y2I A;  3BYD A;  2WGV A;  4JLF A;  1SCW A;  4DKI A;  1BLS A;  1CQA A;  4UEY A;  1H8Y A;  4YFM A;  3P7N A;  1J9M A;  1KE3 A;  5DKK A;  2B18 A;  3CMZ A;  3A0R A;  3T4T A;  3ZG8 B;  3IX3 A;  1H3Q A;  5DTK A;  4DXB A;  4GD6 A;  4E3L A;  1TF1 A;  3G31 A;  4DMZ A;  1Z09 A;  3GMW A;  3TJZ C;  1IKG A;  5GL9 A;  1PWD A;  5JYP A;  3ZHH A;  4EU0 A;  4M3K A;  3LYX A;  1HTZ A;  2WYX A;  2M1C A;  3KSI A;  1LSW A;  3HUO A;  1FIK A;  2XA7 S;  4OP5 A;  4HOI A;  2HP9 A;  2XK1 A;  4WEJ A;  1S1Y A;  1E25 A;  2ZL1 A;  3KSF A;  2A24 B;  2VJW A;  4LEN A;  4RX3 A;  4OVD A;  2MJ6 A;  5FDH A;  2EX6 A;  1CI8 A;  4KZ7 A;  1W63 Q;  1I2S A;  3BW6 A;  1A0K A;  5FQJ A;  4ZRR A;  3GV9 A;  5KZH A;  2Z2L B;  3RH8 B;  2ZC4 B;  4X1L A;  5J8X A;  3MMH A;  1GA9 A;  2WGI A;  3UO9 A;  3OPR A;  1PZP A;  2RCX A;  4E3O A;  5HAQ A;  3EGD C;  3PR6 A;  5G4Y A;  2VGL S;  5FA7 A;  4ZDX A;  3ZCZ A;  3UE6 A;  3LY3 A;  5M18 A;  4JXS A;  3MS6 A;  5FI6 A;  2O99 A;  2W3D A;  2VZW A;  1IYP A;  2BG1 A;  3G34 A;  3FV7 A;  3OZH A;  1P9W A;  1SDN A;  1YAX A;  2Y4A A;  1FCM A;  5KSH A;  4OPZ A;  3KSG A;  4MMN A;  4HHD A;  3LEZ A;  5IU1 A;  4MN7 A;  4FTX A;  3BFC A;  3HL9 A;  2UWX A;  1M40 A;  1P97 A;  4K08 A;  4R4S A;  1ESU A;  5FL3 A;  4DJ3 A;  3MQO A;  5CHU A;  1RGY A;  3UY6 A;  4DXC A;  4KG2 A;  4BMW A;  4LRZ E;  4WZ5 A;  4DE3 A;  2ZQ8 A;  1XXM A;  4HH2 A;  4R3A A;  1TS6 A;  3AGE A;  2EXA A;  4EES A;  3B42 A;  2OLU A;  2OSU A;  2DRW A;  2NUP C;  4L9F A;  1ZG6 A;  3S22 A;  2K31 A;  4PHT A;  5GLA A;  2JKT M;  1JNU A;  1XP4 A;  4PM6 A;  4NXF A;  2Z6D A;  1F2K A;  3IF6 B;  4XT2 A;  2ZJ9 A;  3CG5 A;  3SS5 A;  1K6S A;  3OCN A;  3UMD A;  2ZQ7 A;  3E4Q A;  3IT9 A;  1VQQ A;  4Y0O A;  3SH9 A;  1IKI A;  2CMN A;  4U0T A;  5HWV A;  3K3D A;  2XEP A;  2VV7 A;  3IX4 A;  5HAP A;  4HIA A;  4FD8 A;  4JF6 A;  4MBH A;  1XGJ A;  1ZC2 A;  4N92 A;  4WEK A;  2JCH A;  2W3G A;  2Y2G A;  2CC1 A;  1OME A;  4GW9 A;  4MEZ A;  2X02 A;  3PTE A;  4MCW A;  1H8M A;  2V1Z A;  3D9Y A;  5TR7 A;  1LSV A;  4FOF A;  5A91 A;  2H28 A;  4E3K A;  4PAU A;  2Y2Q A;  3NCK A;  3CIT A;  2VK3 A;  3PHY A;  2QHK A;  2P74 A;  3H7W A;  1W8Y A;  3NOT C;  2VV6 A;  4OPQ A;  3F1O B;  1T18 A;  2JN7 A;  3PBQ A;  4A5R A;  2ZM0 A;  3Q7Z A;  4RA7 A;  1STZ A;  3SS3 A;  3H82 B;  1TVF A;  3MZF A;  3IXG A;  3C8C A;  4LRY C;  4Y0U A;  3FWL A;  4EWF A;  4ETX A;  1PWC A;  5HDS A;  3HLF A;  1P0Z A;  3A3D A;  2O0Y A;  2J7V A;  4BLM A;  3G4P A;  1BYW A;  2P7J A;  3CHW P;  5A93 A;  1JWP A;  2PYP A;  4Q0J A;  3PXP A;  5TBM A;  1OTE A;  1IEL A;  4I3A A;  4IUH A;  2J3W A;  3W4Q A;  3OPH A;  2WAD A;  3TE8 A;  5FAT A;  2OAQ 1;  1BT5 A;  1SKO A;  2IWD A;  4MLL A;  5F6A A;  4BJP A;  4Y17 A;  2V0W A;  4EQI A;  2X01 A;  4DJ2 A;  4JGO A;  3CJM A;  1YM1 A;  3IWQ A;  1AXB A;  4OQG A;  5F68 A;  3A3J A;  2VGK A;  4X53 A;  4E6X A;  3FPV A;  1L2S A;  3NY4 A;  1GCE A;  5GLD A;  3BJN A;  5HPF A;  3OCL A;  4FCF A;  3W4P A;  1F98 A;  5FQI A;  2L1M A;  2HDR A;  1NWZ A;  3LR0 A;  4GHI B;  4JF4 A;  3B33 A;  3LY4 A;  3JYI A;  1LSX A;  3GR2 A;  4LRX C;  1S6R A;  4K0W A;  3R4K A;  5L2F A;  1YLZ A;  4LV3 A;  1TEM A;  3S7P A;  3W2Z A;  2WUQ A;  3AGF A;  2L4R A;  4BWI A;  5FSR A;  1Q2P A;  3QNB A;  4UA9 A;  1ONG A;  1DP6 A;  4O01 A;  3E98 A;  2OAP 1;  2W3F A;  3R7W A;  2J8Y A;  2XA7 M;  4R0Q A;  4PM8 A;  3MF0 A;  1M6K A;  3E4O A;  3CAX A;  2A49 A;  5DF9 A;  5CGW A;  3DTM A;  1NLY A;  4P87 A;  4E3I A;  3BY8 A;  1VHM A;  5F83 A;  5E2H A;  1J3W A;  1FSY A;  5CTM A;  4E3J A;  3FKW A;  4S2M A;  2XF3 A;  5J3W A;  2Y2K A;  2Y2J A;  1TDL A;  1PZO A;  3MXR A;  2WKH A;  5HZH A;  4HP9 A;  2LB5 A;  3NOU C;  3D72 A;  4B4Z A;  4F3L B;  2IWC A;  3UPN A;  2W3H A;  3CWF A;  1CEG A;  3R7W B;  2XDM A;  3VOL A;  1W8Q A;  4BQM A;  1VEU B;  4Z9Q A;  2GZA A;  5DJT A;  4KZ9 A;  4R3B A;  2XGN A;  4KQO A;  3T1S A;  2IWB A;  1L3L A;  4KZ4 A;  2P04 A;  3T4S A;  3HLD A;  1NZO A;  4ZAM A;  3RXX A;  3T4K A;  4HJ6 A;  4DN0 A;  2OWH A;  3T50 A;  4BD1 A;  1S4S A;  3CUE C;  2B95 A;  5EVI A;  3MXS A;  1W63 M;  2GNX A;  2G2W A;  4LCM A;  4PM5 A;  4LPZ A;  3TW8 A;  3IH9 A;  4OPY A;  3CUE A;  4HJ3 A;  4WEL A;  2PBY A;  5HL6 A;  2FFY A;  4GS9 A;  2WAF A;  3LIC A;  4ARZ A;  1HZO A;  2KX6 A;  3CZD A;  3DTK A;  1I2W A;  2R78 A;  4XT2 B;  1XKZ A;  5FI7 A;  5E2G A;  3TG9 A;  1D1J A;  4ID4 A;  4OOY A;  4OOM A;  1L0F A;  4ZJ2 A;  4QJG A;  2PDR A;  3OPP A;  5L10 A; 
#chains in the Genus database with same CATH homology
 3LIB A;  3U2A A;  3KSI A;  1LSW A;  2XA7 S;  5HD5 A;  2IA2 A;  4HOI A;  4NXB A;  5HPI A;  4WEJ A;  4KUK A;  3MQQ A;  2FH5 A;  1S1Y A;  2PYR A;  4Z1W A;  4Q0H A;  3O5Y A;  2W0N A;  1N9N A;  3KSF A;  5HD3 A;  2A24 B;  2XRO A;  1IOU A;  1TD5 A;  3H82 A;  2VJW A;  5F69 A;  2MJ6 A;  1N9O A;  4UQI M;  1W63 Q;  3LR3 A;  3BW6 A;  3K3C A;  4I39 A;  4JGP A;  3LR5 A;  1OPX A;  4ZRR A;  5F5Y A;  3KX0 X;  3RH8 B;  3F1O A;  3E0Y A;  4EQ1 A;  4I5S A;  3MMH A;  2GJ3 A;  5CX7 A;  4PKY G;  3LIE A;  1MC0 A;  2JHE A;  3RFB A;  3C38 A;  2VV8 A;  4EXO A;  1GSX A;  3EGD C;  3PR6 A;  5G4Y A;  2VGL S;  3LI9 A;  4HI4 A;  3NJA A;  3JVU A;  1MZU A;  5HSQ A;  3UE6 A;  4QPR A;  2O9A A;  4WF0 A;  3ULF A;  1UWN X;  2V1A A;  3T4L A;  4R70 A;  3A0S A;  2O99 A;  4B9O A;  2W3D A;  4MN5 A;  5AJG A;  3HJK A;  4G3K A;  1OTI A;  2HF6 A;  2VZW A;  4GHI A;  1UGU A;  2JKT I;  1P9W A;  1YAX A;  4G3V A;  4CLC C;  2B02 A;  1X0O A;  3LIF A;  4L9E A;  3EOI A;  5C5K A;  5KSH A;  2YKH A;  2NUT C;  3KSG A;  4MMN A;  2V1B A;  4HHD A;  4L9G A;  2VEA A;  4EW7 A;  4JGR A;  3F1N B;  1D7E A;  5IU1 A;  4MN7 A;  2K7S A;  2P08 A;  1N9L A;  4OOL A;  4GCZ A;  5AVF A;  4EER A;  3FG8 A;  2Y8H A;  1P97 A;  4K08 A;  2D01 A;  3OLO A;  1S4R A;  3VE3 A;  5FL3 A;  4DJ3 A;  3MQO A;  1T1A A;  2D02 A;  1OT6 A;  2HV1 A;  2I9V A;  3KYZ A;  3NHQ A;  4BMW A;  4LRZ E;  2KLI A;  5TBM B;  3UE3 A;  2EWV A;  4HY8 A;  2PT7 A;  1OTD A;  4HH2 A;  4R3A A;  3B47 A;  1TS6 A;  2G7U A;  2A2L A;  3T4Q A;  1G28 A;  4EES A;  3B42 A;  4CLC E;  2VX8 A;  3MR0 A;  3OC2 A;  2NUP C;  4CLC A;  2JKR M;  4L9F A;  2WKQ A;  1YSP A;  2K31 A;  4PHT A;  2Z6C A;  2KDK A;  2JKT M;  1JNU A;  1XJ2 A;  3LFV A;  3HCY A;  5HDC A;  4NXF A;  1XJ6 A;  2Z6D A;  4CLC B;  2QJ5 A;  2HJ9 C;  2ZMV A;  4L0L A;  3KSH A;  4XT2 A;  3OCN A;  3H9W A;  3UMD A;  4Y5F A;  3E4Q A;  1S67 L;  1XFQ A;  4H6J A;  2J3T C;  2J3T D;  2CMN A;  4ME4 A;  3UB6 A;  5HWV A;  3K3D A;  3V67 A;  4NEE D;  2VV7 A;  2INW A;  2OWJ A;  4ETZ A;  5KIZ A;  3EWK A;  3ICY A;  4HQA A;  4Q0I A;  4HIA A;  2VA0 A;  3MJQ A;  4Y3I A;  3GEC A;  2PD7 A;  4WEK A;  4EET B;  1EW0 A;  2W3G A;  1UWP X;  5L8M A;  1ZHH B;  1LT0 A;  3F1N A;  4GW9 A;  4UQI S;  4WUJ A;  3S7N A;  3T4J A;  3LI8 A;  3EQU A;  3ZYT A;  3T4O A;  1ODV A;  2WKR A;  4MCW A;  1H8M A;  4B93 A;  2W3E A;  4FSF A;  5K5B A;  2ZOH A;  1LSV A;  4FOF A;  3D3O A;  2H28 A;  3VE4 A;  4HJ4 A;  4PAU A;  3E4P A;  3CIT A;  3PHY A;  4NXG A;  3OBF A;  2QHK A;  3H7W A;  1S66 L;  3NOT C;  2OOL A;  3SW1 A;  2VV6 A;  3F1O B;  1T18 A;  1XFN A;  4WLA A;  2JN7 A;  3PBQ A;  2O9B A;  3S7O A;  1F5M A;  3PBS A;  4HP4 A;  1STZ A;  3HJI A;  4EEP A;  1OJG A;  2PR6 A;  1VB6 A;  3H82 B;  4F3L A;  5J4E A;  3C8C A;  3CI6 A;  4LRY C;  3JVV A;  3PYP A;  1YSQ A;  4CLC D;  4ETX A;  5DKL A;  1TS8 A;  5HDS A;  1P0Z A;  3C30 A;  2O0Y A;  5IT5 A;  1YKD A;  2LB9 A;  4P6Z S;  3FC7 A;  2W1T A;  1BYW A;  2P7J A;  4R6L A;  3UB8 A;  3C2W A;  2A24 A;  2PYP A;  4Q0J A;  2J80 A;  3PXP A;  1OTE A;  5TBM A;  4I3A A;  4IUH A;  2J3W A;  2W1T B;  4II7 A;  5DFX A;  3EGX C;  1WA9 A;  1T1B A;  1XJ4 A;  4PKY A;  3TE8 A;  4R38 A;  2OAQ 1;  3DBA A;  3H7W B;  3A0V A;  5F6A A;  3BQA A;  4BJP A;  4HNB A;  3BQ8 A;  2V0W A;  4DJ2 A;  1DP8 A;  4JGO A;  4O0P A;  3UME A;  3RTY A;  4LLO B;  5F68 A;  4I38 A;  2KOI A;  4BBV A;  5DJU A;  1IFQ A;  3FPV A;  3MXQ A;  2V0U A;  1GSW A;  5HWT A;  2QYB A;  2PR5 A;  2ZOI A;  3BJN A;  5HPF A;  3OCL A;  1F98 A;  2L1M A;  3LUQ A;  1NWZ A;  3LR0 A;  4GHI B;  3B33 A;  1DP9 A;  2JKR I;  5MC7 A;  1F9I A;  3UB9 A;  4IUK A;  1LSX A;  4CQH A;  5DFY A;  5A8B A;  1MKM A;  2YKF A;  4LRX C;  3R4K A;  4M4X A;  1V9Y A;  1OT9 A;  3IBJ A;  4IJG A;  1DRM A;  3W2Z A;  2W1R A;  3S7P A;  2DMW A;  2V9A A;  4MDZ A;  1OTB A;  5LBR A;  2L4R A;  2ZBB A;  3ZQ5 A;  1T1C A;  4G3W A;  4Y2F A;  4BWI A;  4WN5 A;  4BBT A;  5I5L A;  2ZMF A;  2VLG A;  3BY9 A;  1DP6 A;  4I3J A;  4O01 A;  2M7V A;  1TS7 A;  3E98 A;  2PD8 A;  2OAP 1;  2W3F A;  3PBR A;  3R7W A;  2FZ0 A;  2XA7 M;  2K2N A;  2VGL M;  1NLZ A;  3G6O A;  3MF0 A;  3MFX A;  3E4O A;  3CAX A;  5DF9 A;  1ZTU A;  1GSV A;  3S7Q A;  1NLY A;  3GDI A;  3BY8 A;  4O8G A;  1VHM A;  5AVE A;  4YOF A;  3LR4 A;  1G6O A;  2WKP A;  4KUO A;  1T19 A;  3FPW A;  3CLO A;  4YWZ A;  5J3W A;  4BBU A;  5HWW A;  1TS0 A;  1OJ5 A;  3NOP C;  3EEH A;  3LID A;  5G4Z A;  5HZH A;  4HP9 A;  1XJ3 A;  1KOU A;  2LB5 A;  3NOU C;  4ARZ B;  4WL9 A;  4GJ4 A;  4IHQ A;  3D72 A;  5EFW A;  4F3L B;  2W3H A;  2PHY A;  3CWF A;  3IS2 B;  4JGQ A;  2M7U A;  1OTA A;  3R7W B;  2HJE A;  2XRN A;  4AFI A;  1S1Z A;  4KQD A;  3VOL A;  2EWW A;  4RQ9 A;  3LIA A;  2GZA A;  4I3I A;  5TJJ A;  1D06 A;  5DJT A;  3PBT A;  3OOV A;  4KQO A;  1V9Z A;  2Y79 A;  3F1P A;  4GLQ A;  3EEA A;  3IBR A;  4E04 A;  3K2N A;  4P6Z M;  2P04 A;  4MN6 A;  3PBO A;  3T4S A;  4GS9 B;  3PBN A;  3T4K A;  4HJ6 A;  2HGV A;  2GX5 A;  4DN0 A;  2EA9 A;  2OWH A;  3T50 A;  1S4S A;  3CUE C;  2QJ7 A;  3BWL A;  2O9C A;  1P9R A;  4UEY A;  1W63 M;  2GNX A;  5J7E A;  4LPZ A;  3TW8 A;  3P7N A;  3CUE A;  4HJ3 A;  4WEL A;  5DKK A;  3MQ0 A;  3IS2 A;  2QKP A;  5HL6 A;  4GS9 A;  3UB7 A;  3LIC A;  2B18 A;  4ARZ A;  3A0R A;  5HDD A;  2QWS A;  4H6J B;  4NXE A;  3T4T A;  1NRJ A;  3F1P B;  1Y28 A;  4HH3 A;  4YNR A;  1H3Q A;  2KX6 A;  4EEU A;  2VKS A;  3TRC A;  4NKP A;  3KYQ A;  2R78 A;  4XT2 B;  3VV4 A;  1TF1 A;  3EQV A;  4DMZ A;  2W27 A;  4EUV A;  3TJZ C;  3P01 A;  3KO6 A;  2L0W A;  1LL8 A;  4OOM A;  2BAS A;  4EU0 A;  2PDR A;  5IS1 A;  2XSS A;  3LYX A;  2M1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...