3B33A

Crystal structure of the pas domain of nitrogen regulation protein nr(ii) from vibrio parahaemolyticus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
TSLPSAILNNMVTATLILDDGLAIRYANPAAELLFSQSAKRIVEQSLSQLIQHASLDLALLTQPLQSGQSITDSDVTFVVDGRPLMLEVTVSPITWQRQLMLLVEMRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein
publication title X-ray structure of PAS domain of nitrogen regulation protein NR(II) from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Transferase
total genus 24
structure length 109
sequence length 109
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3b33A00
2VV7A 1OT6A 3MQQA 1D7EA 4WLAA 4HJ4A 1XJ3A 4HNBA 4LRZE 4HP4A 1OTBA 2HV1A 1DP6A 1N9OA 3A0RA 1XFQA 1F98A 3F1NB 2YKHA 3IS2A 4JGRA 4I39A 4YWZA 5TBMB 3UB8A 3UMDA 4F3LB 1P97A 5J7EA 3NOUC 5HD3A 5G4YA 5F68A 1S4SA 4R70A 2OOLA 3D72A 3UB6A 1TS7A 2PD7A 3OLOA 2J80A 3VE4A 1S1ZA 4H6JA 2V1AA 3F1PB 4HH2A 2W27A 2R78A 4BBVA 4MN5A 2Z6DA 1TS8A 5HSQA 3EEHA 5DKKA 2JHEA 3E4PA 4EESA 3BY9A 2L1MA 1T1CA 4KQDA 4HI4A 2W0NA 3CAXA 4NXBA 2A24A 5HWVA 1VB6A 4EW7A 4HJ6A 4HOIA 3MFXA 1D06A 3H7WB 4L9FA 4B9OA 2VLGA 3CLOA 5F6AA 2QWSA 3VOLA 5HWWA 3FG8A 2PR6A 3PHYA 2WKQA 1V9ZA 4LRXC 4EETB 2QHKA 5I5LA 3LIBA 4L9GA 2K7SA 4I5SA 3LUQA 4K08A 3K3CA 1LSXA 4R38A 5A8BA 3BY8A 4I3JA 4BBTA 3SW1A 2PD8A 1S67L 4KUKA 2VEAA 3H82B 3NOPC 4E04A 2PR5A 2H28A 4I3IA 2KDKA 3F1PA 4HHDA 1LL8A 3MJQA 3KX0X 2PHYA 2L4RA 4HP9A 4XT2B 3ICYA 2OWJA 1XJ6A 4WUJA 1GSXA 3UB9A 4PKYG 1OJ5A 1BYWA 4WL9A 1P0ZA 2VV6A 3F1OB 3NOTC 4GHIA 2QJ5A 1S4RA 1XJ2A 3E4QA 3FC7A 2PDRA 1GSWA 4MN6A 3MXQA 4PKYA 5IS1A 4HJ3A 2WKRA 5J3WA 1DP8A 1N9NA 3A0SA 4I3AA 3VE3A 4EXOA 3LIEA 3H82A 3IS2B 5AVFA 4WF0A 4JGPA 3C8CA 4WN5A 2I9VA 4M4XA 4HY8A 1F9IA 3MQOA 2WKPA 5DKLA 3T50A 3HJKA 3LYXA 3F1NA 1Y28A 4KUOA 4R3AA 5TBMA 4XT2A 4F3LA 1DRMA 3NHQA 1OTIA 5HDDA 4EEPA 1XFNA 1X0OA 3BWLA 3B33A 4EQ1A 1T1AA 1OT9A 3PYPA 1UWNX 4NXFA 3F1OA 1T19A 1T1BA 2ZBBA 2ZOIA 3ULFA 5J4EA 2OWHA 2L0WA 3GECA 4HQAA 1S66L 4L9EA 2JN7A 4I38A 4DJ3A 5HD5A 2BASA 2PYPA 3C2WA 2QJ7A 2V1BA 3LICA 5KIZA 5AVEA 5HDSA 2P7JA 4NXGA 4JGQA 5F5YA 5G4ZA 4NXEA 2ZOHA 4GS9B 2Z6CA 4RQ9A 3H7WA 1EW0A 3MR0A 5HWTA 1KOUA 4BBUA 1MZUA 5HDCA 4LLOB 3LIAA 3K3DA 1UGUA 3HJIA 1TS0A 1OTEA 2PYRA 4EERA 1UWPX 3LIFA 1LSWA 3G6OA 1XJ4A 5IU1A 3UE6A 1G28A 2INWA 4LRYC 2YKFA 5DJTA 1TS6A 1OTAA 3UMEA 1NWZA 1GSVA 2QKPA 5F69A 2EA9A 1ODVA 1S1YA 5EFWA 2D01A 3ZQ5A 2V9AA 4LPZA 1T18A 1OJGA 2D02A 3E4OA 1JNUA 1N9LA 4H6JB 4GHIB 4EEUA 2B02A 2VV8A 5HZHA 1OTDA 4JGOA 2GJ3A 3LI8A 4GS9A 1LSVA 2CMNA 2V0WA 3H9WA 3GDIA 3CWFA 3RH8B 1LT0A 4GW9A 1WA9A 3P7NA 3RTYA 5DJUA 2KX6A 3LIDA 4GCZA 3IBRA 4HIAA 4R6LA 1V9YA 2V0UA 3EWKA 2M1CA 3A0VA 1DP9A 4HH3A 3NJAA 2A24B 3LI9A 3UB7A 4DJ2A
chains in the Genus database with same CATH superfamily
2VV7A 2XFSA 1OT6A 3G35A 3MQQA 1D7EA 1FR1A 2VK3A 1JWPA 3VSKA 4LRZE 1YM1A 3N8SA 2X01A 1OTBA 1N9OA 4N9KA 2X02A 2Y4AA 2JKRM 3HVFA 2JC7A 4P6ZM 4B88A 1XA7A 1DY6A 4JGRA 4U0XA 3UE0A 2Y2JA 4CLCA 5KSCA 3UB8A 5EOOA 1A0KA 3N8LA 5J7EA 1GCEA 4H8RA 2J8YA 3IH8A 4QY6A 3IH9A 4QPRA 2XROA 1YLZA 4S2JA 3R4KA 1JTGA 2PD7A 3PR6A 5DVAA 3AGEA 1GHPA 1W5DA 4QJGA 5DF7A 1S1ZA 3CG5A 3LR0A 5F1GA 4WZ4A 2W3HA 2J3WA 2DRWA 4BBVA 1LLBA 5HSQA 4DMZA 5FA7A 3LR3A 4KZAA 4WZ5A 3KSIA 5E2FA 5M1AA 1ONGA 4IUKA 4X53A 5DKKA 1SKOB 5TR7A 3E4PA 2H0YA 1XKZA 4EESA 1KDWA 3KSHA 3LFVA 4UQIS 3VP0A 4GZBA 4EBPA 3CAXA 4NXBA 1CI8A 1HTZA 1VB6A 3BYDA 4HJ6A 3A3FA 4HOIA 3G30A 4KZ3A 3H7WB 2OLVA 4OPZA 2P74A 4ETZA 4L9FA 3EGXC 1KGGA 4PM7A 4U0TA 3FG8A 1XXMA 3OCNA 5A92A 2XFTA 4CQHA 1CF0A 3LEQA 2QHKA 5I5LA 3HCYA 3K3CA 1FSWA 2QYBA 4R38A 1EWZA 1LHYA 4I3JA 3DTMA 3Q1FA 3NOPC 2G2WA 4OP5A 2PR5A 2ZM0A 2KDKA 4RYEA 4Z9QA 3VMAA 1ZKJA 3IWQA 3BQAA 2J9OA 3PBRA 4DKIA 1H8ZA 3HLFA 1SKOA 5EVIB 1MKIA 4HP9A 2HZ5A 3ICYA 2E8IA 1K56A 1E25A 3CMZA 4XUZA 2OWJA 3S4XA 2XH9A 1XJ6A 2VZWA 2JKTI 5L10A 2OAQ1 1OJ5A 1BYWA 3JYIA 1JWVA 3ITAA 1TDGA 4WL9A 4PPRA 2VV6A 3F1OB 3OPPA 3OPLA 5HFOA 4X6TA 3FC7A 3CJMA 2Z2MB 5CECA 3LGOA 3GRJA 3QP1A 4LFUA 3T4SA 5FAOA 3HLCA 4FCFA 1SDNA 1JTDA 2Q9NA 2HP5A 4LCMA 4WEKA 1PZOA 2XGNA 5FAPA 1PNEA 2Y8HA 5U47A 4FSFA 4I3AA 4F94A 4EXOA 1NZUA 2HGVA 4E3NA 3JVVA 4R23A 3C8CA 4CLCE 3M2JA 4EWFA 5CGSA 3OPRA 4HY8A 1ZG6A 2WKPA 5CHJA 4DE3A 5DKLA 1RGYA 2VA0A 3LYXA 4KZBA 4PM6A 4ESPA 3F1NA 2O9CA 1Y28A 2ACGA 5DF9A 4KUOA 3KYZA 1CK3A 3KSFA 1DRMA 3NHQA 2Y2PA 3NBLA 4UQIM 4DE0A 4JXSA 4OQGA 1PIOA 1T1AA 2P04A 3V50A 4GN2A 4R3JA 1OT9A 4DXBA 3OC2A 3PYPA 1UWNX 4S2PA 3F1OA 4R1GA 1VHMA 4BD1A 2WGIA 4Y2FA 2LB5A 4JXVA 1YT4A 2OWHA 3GECA 2LB9A 3VSLA 1S66L 1E3UD 4EU0A 2JN7A 4O8GA 5KSHA 4DJ3A 2G7UA 2OAP1 3B3XA 2BLSA 5EVEA 4NXGA 4JLFA 4KZ6A 1YAXA 1XGJA 1FILA 2Z6CA 3UPNA 1EW0A 5FI2A 3WRTA 2NUTC 5K5BA 2PRFA 3IQAA 4GDBA 1I5QA 4PM9A 1MZUA 3ZVWA 3LIAA 2WGVA 1BLPA 2XSSA 3FPWA 2Z2LB 2WGWA 1VQQA 4X1LA 2PYRA 4GKUA 1MY8A 1XJ4A 5IU1A 5L8MA 1G28A 2BTFP 3MKFA 4FD8A 4PM5A 5DFXA 4Q0JA 4LRYC 2GZAA 2YKFA 5DJTA 1HLUP 1XP4A 3W2ZA 4ARZA 1TS6A 4C6YA 4OKPA 2OSUA 3KYQA 4S2MA 2EWWA 1XPBA 1N4OA 5F69A 1ODVA 2D01A 1ES5A 2Y2GA 4IVIA 4P0MA 2Y2KA 2PU2A 2WAFA 2WKHA 4Y13A 4YOFA 3EGDC 5CTNA 1K57A 4HBTA 2D02A 1NRFA 4H6JB 5FL3A 4GHIB 2B02A 1GHIA 3PBQA 3IF6C 3IT9A 4P6ZS 2HDUA 4BJPA 4BQMA 4DF6A 1K6SA 3L7HA 5CHUA 3VFHA 5FASA 1LSVA 4OOYA 2V0WA 3H9WA 3BFEA 1P9RA 1PFLA 3HBRA 1LT0A 2V20A 3N7WA 4GW9A 3P7NA 4LV3A 4BL2A 5DJUA 3HUNA 4K0WA 1K57C 4GCZA 3SS3A 4IBXA 2JE5A 4E3KA 3G4PA 4DJ2A 3C7UA 2O9AA 3MFDA 4FUWA 4M3KA 3UB5P 1KDSA 2HV1A 1DP6A 3O3VA 3IHBA 2Y2NA 4S2NA 4KG6A 3SS4A 2PBYA 2ZC4B 3FKWA 5F83A 5TBMB 3UMDA 2B18A 4F3LB 1KVLA 2VGLS 2Y91A 4MN7A 4B4XA 3MXRA 1J3WA 1NRJA 3G32A 5F68A 1DJBA 5E43A 1S4SA 3V67A 5CERA 3D72A 3UB6A 3ZGAB 1K54C 4HBUA 4KQQA 1W63Q 3O86A 5AJGA 1PI4A 3VE4A 4ETXA 4H6JA 4C75A 3F1PB 4HH2A 2Y2HA 1K0KA 4MN5A 1PYYA 3E0YA 3QHYA 2XK1A 3EEHA 1H8YA 4LV2A 2WZZA 3S7OA 4X69A 3BY9A 1W8QA 2XF3A 3Q82A 1VETA 2EX6A 1PWDA 5HX9A 4OP8A 2W0NA 1L2SA 3SH9A 2KOIA 3G31A 3MFXA 4XUXA 5I94A 3MKEA 4RX3A 4KG5A 5EOEA 4B9OA 5CHMA 5C5KA 2VLGA 1K4FA 2EFXA 3W4QA 3B42A 4S2IA 2O99A 2QWSA 3VOLA 5HWWA 1BLSA 2ZQDA 3CPTA 2RCXA 4N92A 2EX9A 1V9ZA 2Y79A 4WMCA 1Y54A 3LUQA 3L9KA 4O01A 1S0WA 3BY8A 1IYPA 4BBTA 1S67L 3TRCA 4ZRRA 3EEAA 3G2ZA 3TOIA 2HDQA 4E04A 4WM9A 1YKDA 2DMWA 3F1PA 4KZ5A 1Q2QA 1LL8A 3MJQA 3KX0X 3IX3A 5IT5A 4CJNA 4O0PA 4E3OA 5LBRA 3BLSA 3T1SA 1ONHA 4RA7A 2ZL1A 5FQKA 4FH4A 3E2LA 4X68A 1WE4A 1K55A 5EM1A 3OPHA 3ZG8B 1BTLA 1YMSA 1PI5A 2DCFA 1ESUA 2XD5A 2JCHA 1CQAA 1P0ZA 3NOTC 3IXGA 2VKSA 2B5RA 5TGFA 5HW3A 4CLCC 3MZDA 3C5AA 4OH0A 4MN6A 3M2KA 3QNCA 3C38A 3MXQA 1LL5A 1MWRA 3UDFA 4PKYA 4R4SA 3UPPA 4JF6A 4OQ0A 3Q81A 3DBAA 4HJ3A 2JKTM 2V8CA 4E3MA 2VGLM 2ZQCA 2ZQ8A 3VP4A 4BLMA 2UWXA 3WS2A 3VE3A 1ES2A 3IS2B 5AVFA 4WF0A 4DXCA 2QMIA 4K0XA 1SZVA 2C6WB 1MPLA 5HPFA 4DDYA 1RCJA 4WN5A 4M4XA 4WZ5C 4E3IA 1IOUA 3MQOA 3JPUA 1ZHHB 3BFCA 3ZCZA 1PZPA 1JVJA 3MZEA 5J8XA 3VV4A 4JF4A 3DTEA 1YPRA 1O7EA 5HDDA 1SKFA 1NXYA 2HPBA 3ZG9B 4EEPA 2O0YA 3BFDA 1XA1A 3G34A 3O87A 3V39A 4NETA 3BWLA 4XXRA 5GLDA 3MXSA 4EQ1A 4ZTKA 3MQ0A 4R4RA 4IJGA 1W7FA 3P09A 1T1BA 2VJWA 3BRMA 4K91A 2ZOIA 4KG2A 4EUVA 3I7JA 3C4OA 5FAQA 2L0WA 2ZC7A 3SS5A 1KE3A 2RL3A 4Z1WA 1AXBA 4E6XA 3HUOA 3T4LA 2BASA 2PYPA 5KIZA 5HDSA 4DN0A 3PBOA 4JPMA 1LI9A 4G3VA 4NXEA 1XGIA 3ZHHA 5AQ7A 4CLCD 2W3DA 2ZOHA 4C3QA 1C3BA 3H7WA 4WYYA 3VP1A 4DE2A 1L0FA 4MBKA 3MR0A 2P08A 3HLDA 3G2YA 5E2GA 1ERMA 3FPVA 3MBZA 2FH5A 4PMAA 1UGUA 4LV0A 4RX2A 2FFFB 1IYSA 1EI5A 1ZC2A 4MCWA 1FCNA 1OTEA 4EERA 4BD0A 1LSWA 4MEZA 4OLGA 1L0DA 1KE4A 3PXPA 3MMHA 3DWZA 4WBGA 2HDSA 4IBRA 3S1YA 3IWIA 1SCWA 3JVUA 3T4TA 3W8KA 2HJEA 1M6KA 1MWUA 2XRNA 2ZLYA 3CHWP 3UMEA 4LENA 3D9YA 4OPRA 2R9WA 3S7PA 2EA9A 2EXBA 3TJZC 4N9LA 3ZQ5A 2V9AA 3WRZA 1CJFA 4LPZA 1T18A 4IHQA 3MS6A 4BENA 3UY6A 4UHUA 1IKIA 2PU4A 5EVIA 4G3WA 1JNUA 1N9LA 4ZDXA 1G5UA 2Y2MA 4JKTA 5HL1A 1K38A 1M40A 4YINA 4Y0UA 3Q7ZA 4E6WA 4QHCA 1ACFA 4B4ZA 3PBNA 4PAUA 3O88A 3BECA 3IBRA 2JKFA 1H0MA 4QY5A 2M1CA 3TG9A 4HH3A 1NLYA 3BM6A 2ZMVA 4JXGA 2OV5A 2W3EA 2I72A 5F1FA 3SOIA 2ZM2A 1MBLA 1XJ3A 4Q0HA 1FCOA 4GOGA 3A0RA 1XFQA 3TE8A 1ZG4A 4KENB 4WEJA 2W1RA 3RJUA 5CX7A 3UE1A 3PAEA 4YWZA 3TW8A 2UV0E 1K56D 4EV4A 3NOUC 5HD3A 2JKGA 1BUEA 4R70A 2OOLA 1LL9A 2Q0OA 3BFFA 3NECA 2HP9A 1IYQA 2J80A 2Y59A 3LR4A 3ZVTA 2IWDA 2WADA 3PBSA 5IHVA 1PW1A 2V1AA 4D60A 3UDIA 2HP6A 5HAQA 2W27A 3C4PA 1ZTUA 2Z6DA 3OZHA 1TS8A 5CEBA 2Y2LA 4BWIA 2ZQ7A 2EXAA 2K2NA 5TFQA 1ES4A 2KLIA 3GTCA 2WAEA 3T4OA 2Y55A 2DNSA 1NYYA 4L0LA 1T1CA 4OLDA 1J9MA 2R9XA 3FKVA 5G18A 3VP2A 5HWVA 4RVAA 4EW7A 1D06A 3VOZA 3T4QA 5CEDA 4EQIA 4ZJ1A 2W3FA 1F5MA 3LCEA 4ZJ2A 3CLOA 1HVBA 5F6AA 2Y2OA 2V1ZA 2V8FA 5FSRA 2PR6A 3TSGA 3Q7VB 1FIKA 4LRXC 4EETB 3UPOA 1AWIA 3NI9A 3LIBA 1H3QA 2NUPC 1LSXA 2WYXA 5KZHA 2GNXA 3EQUA 5GHZA 4OONA 2VEAA 5DFYA 5FI6A 4OQIA 4I3IA 4JXWA 4HHDA 3MF0A 3GSGA 2XD1A 1CI9A 5AQBA 5EPHA 3T12B 3IX8A 3HUMA 2P9VB 2L4RA 3OBFA 3BQ8A 1TF1A 3ZNTA 4MLLA 3MSHA 3Q07A 2CC1A 4XT2B 2GX5A 4MNRA 2H10A 1MC0A 4KZ7A 3UDXA 3T1XA 1GA9A 3LO7A 4D2OA 1S6RA 4WUJA 3UB9A 3BJNA 3AGDA 5TJJA 3K2NA 4GHIA 4O7DA 1NJ4A 4QWOA 4S2NC 1K4EA 2WZXA 1S4RA 2X71A 5HARA 1KVMA 2B95A 2VGKA 5FQJA 2Y2IA 3S7QA 1GSWA 4X25A 1ESIA 3DTIA 1BT5A 2QPNA 2M7VA 4PM8A 3QP4A 5CGWA 1IYOA 1L0EA 4Y7PA 3QP2A 1E4DA 5JYOA 1BLCA 1DP8A 1N9NA 1YMXA 1K6RA 2GDNA 5M18A 1ERQA 5KMWA 2XEPA 4YFMA 4CLCB 2ZC6B 3A3EA 2I9VA 4X1MA 2ZQ9A 1W8YA 1D1JA 3SZTA 3T50A 3HJKA 1GA0A 4Y5FA 3O5YA 3FWLA 3LEZA 5EUAA 1F2KA 3P98A 3V3RA 3C7VA 5TBMA 1STZA 4XT2A 5E2HA 4F3LA 1CEFA 4HESA 1OTIA 5DF8A 3RXWA 4UEYA 1RGZA 3C30A 3NIAA 1FOFA 4LCLA 2IWCA 5EV0A 3R7WB 4N1XA 2ZC3B 3NY4A 3GR2A 2A2LA 3NDEA 3ZYTA 2XLNA 1TEMA 4DE1A 5FQMA 1IKGA 1G6AA 4L9EA 4ZJ3A 2J3TC 3QP6A 3W4PA 2ZMFA 4I38A 1YSPA 3QNBA 2M7UA 4CPKA 1WYBA 5HD5A 3C2WA 2WUQA 5EE8A 1VEUB 3LICA 1NYMA 2ZC5B 4JGQA 5F5YA 5G4ZA 3BLMA 2J9PA 1TD5A 3D4FA 2VX8A 1FCMA 3M6BA 1WYCA 1YLWA 3E2KA 4DRTA 1W63M 1BZAA 5L07A 4S2OA 1KOUA 4UA6A 4X56A 5FEGA 2W3GA 4OQHA 1K55C 3N4IA 3K3DA 3HJIA 2H0TA 4P6BA 1OMEA 3KO6A 4X55A 5MC7A 1UWPX 2EFUA 4Y17A 3LIFA 3G6OA 3CUEA 3IF5A 5FDHA 2INWA 3BFGA 1BULA 1YQSA 4OOLA 5GL9A 4Q0IA 4KZ4A 3R7WA 5EECA 1NWZA 2HF6A 2WKIA 3MZFA 3P01A 1S1YA 3V3SA 4HEFA 1DJCA 3HLBA 3CUEC 1NY0A 4UA7A 4MMNA 2HJ9C 4EEUA 4QD4A 2K31A 2MJ6A 1VEUA 5FQIA 4GJ4A 5HZHA 4UA9A 4JGOA 3DWKA 2GJ3A 3QP8A 3A3IA 4WMCD 3ZNYA 2WK0A 2CMNA 4GNUA 2JKRI 3CWFA 2J3TD 2JBFA 3RH8B 3GVBA 1L3LA 4G3KA 1WA9A 5DTSA 4B93A 1V9YA 2V0UA 5FI7A 3A0VA 1DP9A 4KZ8A 3NJAA 2A24B 5CXWA 2FZ0A 3NCKA 1IEMA 1H5XA 1E3UA 3WS5A 4WLAA 4ZAMA 4HJ4A 4HNBA 4HP4A 4MBHA 4IEDA 4NEED 4QU3A 1F98A 3F1NB 1H8MA 2YKHA 3IS2A 3HLEA 4I39A 1ES3A 4LV1A 3ZFZA 5HPIA 1P97A 4R3BA 4GDNA 3LR5A 5G4YA 4S2LA 2ZMAA 1I2SA 3PBTA 5AQ9A 1N9BA 5FQ9A 5GLCA 1TS7A 2EX8A 3OLOA 5EVLA 5HL6A 3N6IA 3SH7A 3T4JA 2FFYA 4AFIA 3ISGA 4DDSA 3ZDJA 2R78A 3OCLA 2ZD8A 3ZG5A 3U2AA 3N8RA 1PW8A 1Y4OA 4P85A 4KQRA 3DTKA 3FZCA 2XA7S 5F82A 2JHEA 3IHAA 4YNRA 2L1MA 4OVDA 4BL3A 3A3DA 1FR6A 4IUHA 4MBFA 4KQDA 4HI4A 2A24A 3M6HA 2PAVP 1TVFA 1EROA 3UE3A 3IXBA 3UNWA 3WS4A 3A3JA 3RXXA 5A93A 4UAAA 3DW0A 4Y15A 3PHYA 1K25A 2WKQA 4GLQA 2WGWB 5DTTA 4ZBEA 2G2UA 5GLAA 4L9GA 2K7SA 4I5SA 5CGXA 2PT7A 4K08A 1MXOA 1KGFA 1Z6FA 1O07A 5A8BA 5EVIC 1MWSA 4FOFA 3SW1A 2PD8A 4KUKA 4P87A 4ARZB 3H82B 3IF6B 4II7A 2H28A 5A90A 5D3OA 4Y0TA 2E8JA 1W79A 1XX2A 4LGWA 2PHYA 4Y3IA 4BMWA 3EQVA 1YLYA 5FEFA 2IWBA 1KE0A 5GHXA 3GMWA 2AVXA 3BEBA 3VFFA 1RP5A 4OPQA 3SH8A 3S7NA 1PWGA 3ZG0A 3LY4A 5AQAA 5FQQA 1LI0A 4MDZA 1GSXA 1NZOA 3T1RA 4E3JA 2C5WB 4PKYG 3WS0A 2J7VA 1NLZA 3U4LP 4NK3A 2QJ5A 3CITA 1XJ2A 3RFBA 1BLHA 3E4QA 2VGJA 2PDRA 3NULA 3VOYA 2ZM8A 2H5SA 3EOIA 3OOVA 3IBJA 4EUZA 5IS1A 3QP5A 4NKPA 2XQZA 5GLBA 2WKRA 4OPYA 1I2WA 1P9WA 5J3WA 3S22A 3FV7A 4N1HA 5DTKA 3A0SA 5L2FA 3E98A 1MKMA 3LIEA 3H82A 4R0QA 2BG1A 3IF6A 1OPXA 4JGPA 3GQZA 3NDGA 4Y0OA 3IXDA 4JF5A 1F9IA 1PWCA 3CI6A 4GD8A 5EVID 5CRFA 4R3AA 5GHYA 2WKEA 5CTMA 2XA7M 2W1TB 5EM0A 1TDLA 1G6OA 3ZG7B 3D3OA 3GV9A 1XFNA 1X0OA 3LY3A 1PRQA 3B33A 3HLWA 1IELA 3IWOA 3KSGA 2XDMA 1YSQA 4NXFA 3V5MA 1U60A 1T19A 2V2FF 1FQGA 4QB8A 1YLPA 2ZBBA 3IX4A 1VETB 4EBLA 3UO9A 4ID4A 3ULFA 5J4EA 4HQAA 3HLGA 4U3TA 4KZ9A 4JBFA 4S2KA 5FDSA 4GB7A 5L09A 1K54A 3FYZA 2QJ7A 2V1BA 5AVEA 2P7JA 1ALQA 1KGEA 2PBDP 5HAIA 5BOHA 3CPTB 1HD8A 4GS9B 1QMFA 3UN7A 4RQ9A 5HAPA 3WS1A 1HZOA 5HWTA 4BBUA 5HDCA 4LLOB 3VP3A 2A49A 3BW6A 3Q7VA 2XR0A 1TS0A 2W1TA 3PTEA 2ZJ9A 1MWTA 1DJAA 4E3LA 1SHVA 3UE6A 4ME4A 4WELA 1IFQA 1YLTA 1OTAA 3T4KA 1G68A 2ZL1B 1GSVA 2A3UA 1GHMA 5A91A 2QKPA 3CZDA 3NC8A 4PHTA 5EFWA 4Q8IA 1FSYA 1Q2PA 5E2EA 1L0GA 3AGFA 4FH2A 2EWVA 3T1QB 4GD6A 4A5RA 2O9BA 4OOMA 2P9VA 1OJGA 1SDEA 1Z09A 2OLUA 4IVKA 3B47A 2IA2A 4EBNA 4NG2A 3E4OA 1CEGA 3HREA 2VV8A 3PAGA 3HL9A 1VM1A 1OTDA 5JYPA 4KQOA 2Q9MA 3LI8A 5M19A 3ITBA 1QMEA 4GS9A 4FTXA 1BSGA 2ZQAA 1YLJA 3GDIA 5FATA 2QZ6A 2EX2A 3RTYA 2KX6A 3LIDA 4HIAA 3IXHA 4R6LA 3EWKA 3W4OA 3KYEA 2HDRA 1JWZA 3DAVA 3LI9A 3UB7A 2Y2QA 3WWXA
chains in the Genus database with same CATH topology
2VV7A 1OT6A 3MQQA 1D7EA 4WLAA 4HJ4A 1XJ3A 4HNBA 4LRZE 4HP4A 1OTBA 2HV1A 4Q0HA 1DP6A 1N9OA 4NEED 2JKRM 3A0RA 1XFQA 3TE8A 1F98A 3F1NB 4P6ZM 1H8MA 4WEJA 2YKHA 3IS2A 4JGRA 4I39A 2W1RA 5CX7A 4CLCA 4YWZA 3TW8A 5TBMB 3UB8A 3UMDA 5HPIA 2B18A 4F3LB 1P97A 5J7EA 2VGLS 4MN7A 3NOUC 5HD3A 3LR5A 1NRJA 5F68A 5G4YA 4QPRA 2XROA 1S4SA 4R70A 2OOLA 3V67A 3PBTA 3D72A 3UB6A 3R4KA 1TS7A 2PD7A 3OLOA 3PR6A 5HL6A 2J80A 1W63Q 3LR4A 3T4JA 5AJGA 4AFIA 3VE4A 3PBSA 1S1ZA 3LR0A 4ETXA 4H6JA 2V1AA 2W3HA 3F1PB 2J3WA 4HH2A 2W27A 2R78A 3OCLA 4BBVA 3U2AA 4MN5A 1ZTUA 2Z6DA 1TS8A 3E0YA 5HSQA 4DMZA 3EEHA 4BWIA 3LR3A 2K2NA 3KSIA 4IUKA 2KLIA 5DKKA 2XA7S 2JHEA 3E4PA 3T4OA 3S7OA 4EESA 4YNRA 3BY9A 2L1MA 3KSHA 3LFVA 4UQIS 4L0LA 1T1CA 4IUHA 4KQDA 4HI4A 2W0NA 3CAXA 4NXBA 2A24A 5HWVA 1VB6A 4EW7A 4HJ6A 2KOIA 4HOIA 3MFXA 1D06A 3UE3A 3H7WB 3T4QA 4ETZA 2W3FA 4L9FA 4B9OA 1F5MA 5C5KA 3EGXC 2VLGA 3CLOA 3B42A 5F6AA 2O99A 2QWSA 3VOLA 5HWWA 3FG8A 2PR6A 3PHYA 3OCNA 2WKQA 4CQHA 1V9ZA 4LRXC 4EETB 4GLQA 2QHKA 2Y79A 5I5LA 3HCYA 3LIBA 4L9GA 2K7SA 4I5SA 1H3QA 2PT7A 3LUQA 4K08A 2NUPC 3K3CA 1LSXA 2QYBA 4R38A 5A8BA 4O01A 3BY8A 2GNXA 4I3JA 4BBTA 4FOFA 3SW1A 2PD8A 1S67L 3EQUA 4KUKA 3TRCA 4ARZB 4ZRRA 2VEAA 3H82B 3EEAA 3NOPC 5DFYA 4II7A 4E04A 2PR5A 2H28A 4I3IA 2KDKA 1YKDA 2DMWA 3F1PA 4HHDA 3MF0A 1LL8A 3MJQA 3KX0X 3BQAA 2PHYA 4Y3IA 3PBRA 4BMWA 5IT5A 3EQVA 4O0PA 2L4RA 3OBFA 5LBRA 3BQ8A 1TF1A 4HP9A 4XT2B 3ICYA 2GX5A 3S7NA 1MC0A 2OWJA 1XJ6A 4MDZA 4WUJA 1GSXA 3UB9A 2VZWA 2JKTI 2OAQ1 4PKYG 1OJ5A 1BYWA 1NLZA 3BJNA 5TJJA 3K2NA 4WL9A 1P0ZA 2VV6A 3F1OB 3NOTC 4GHIA 2QJ5A 3CITA 1S4RA 1XJ2A 3RFBA 2VKSA 3E4QA 3FC7A 3S7QA 2PDRA 4CLCC 1GSWA 4MN6A 3OOVA 3EOIA 3C38A 3MXQA 4PKYA 3IBJA 2M7VA 3T4SA 5IS1A 3DBAA 4NKPA 4HJ3A 2JKTM 2VGLM 4WEKA 2WKRA 1P9WA 5J3WA 2Y8HA 1DP8A 1N9NA 3A0SA 4FSFA 3E98A 4I3AA 3VE3A 1MKMA 4EXOA 3LIEA 2HGVA 3H82A 3IS2B 4WF0A 5AVFA 3JVVA 1OPXA 4JGPA 4CLCB 3C8CA 4CLCE 5HPFA 4WN5A 2I9VA 4M4XA 4HY8A 1IOUA 1F9IA 3MQOA 1ZHHB 2WKPA 5DKLA 3T50A 3HJKA 2VA0A 3LYXA 4Y5FA 3O5YA 3F1NA 3CI6A 2O9CA 1Y28A 5DF9A 4KUOA 4R3AA 3KYZA 3VV4A 2XA7M 2W1TB 5TBMA 1STZA 4XT2A 4F3LA 3KSFA 1DRMA 3NHQA 1G6OA 1OTIA 4UQIM 3D3OA 5HDDA 4EEPA 1XFNA 1X0OA 2O0YA 4UEYA 3C30A 3BWLA 3B33A 4EQ1A 1T1AA 2P04A 1OT9A 3R7WB 3MQ0A 3OC2A 3KSGA 3PYPA 1YSQA 1UWNX 4IJGA 4NXFA 3F1OA 1T19A 1VHMA 1T1BA 2VJWA 2ZBBA 2ZOIA 4EUVA 2A2LA 3ULFA 4Y2FA 2LB5A 3ZYTA 5J4EA 2OWHA 2L0WA 3GECA 4HQAA 2LB9A 1S66L 4L9EA 2J3TC 4Z1WA 4EU0A 2JN7A 2ZMFA 4I38A 1YSPA 4O8GA 2M7UA 4DJ3A 5KSHA 3T4LA 2G7UA 5HD5A 2BASA 2OAP1 2PYPA 3C2WA 2QJ7A 2V1BA 3LICA 5KIZA 5AVEA 5HDSA 2P7JA 4DN0A 3PBOA 4NXGA 4JGQA 5F5YA 1YAXA 4G3VA 5G4ZA 4NXEA 4CLCD 2W3DA 2ZOHA 1TD5A 4GS9B 2Z6CA 2VX8A 4RQ9A 3H7WA 1EW0A 1W63M 2NUTC 5K5BA 3MR0A 2P08A 5HWTA 1KOUA 4BBUA 1MZUA 5HDCA 4LLOB 3FPVA 3LIAA 2FH5A 2W3GA 2XSSA 3BW6A 3FPWA 3K3DA 1UGUA 3HJIA 1TS0A 3KO6A 4MCWA 2W1TA 1OTEA 2PYRA 4EERA 5MC7A 1UWPX 3LIFA 1LSWA 3G6OA 3CUEA 1XJ4A 3PXPA 5IU1A 1G28A 3MMHA 5L8MA 3UE6A 4ME4A 2INWA 4WELA 5DFXA 3JVUA 4Q0JA 4LRYC 3T4TA 4OOLA 2GZAA 2YKFA 5DJTA 3W2ZA 2HJEA 4ARZA 1IFQA 2XRNA 4Q0IA 1TS6A 1OTAA 3T4KA 3R7WA 3UMEA 1NWZA 1GSVA 2HF6A 3KYQA 2EWWA 2QKPA 5F69A 3S7PA 2EA9A 1ODVA 4PHTA 3P01A 1S1YA 3TJZC 5EFWA 2D01A 3ZQ5A 2EWVA 2V9AA 4LPZA 1T18A 2O9BA 4IHQA 4OOMA 4YOFA 3EGDC 1OJGA 3CUEC 3B47A 2IA2A 2D02A 4G3WA 3E4OA 1JNUA 1N9LA 4H6JB 4MMNA 5FL3A 2HJ9C 4GHIB 2B02A 4EEUA 2K31A 2VV8A 2MJ6A 3PBQA 4GJ4A 5HZHA 1OTDA 4P6ZS 4BJPA 4JGOA 2GJ3A 4KQOA 3LI8A 4GS9A 1LSVA 2CMNA 2V0WA 3H9WA 3GDIA 2JKRI 3PBNA 3CWFA 2J3TD 1P9RA 4PAUA 3RH8B 1LT0A 4GW9A 4G3KA 1WA9A 3P7NA 3RTYA 5DJUA 2KX6A 3LIDA 4GCZA 3IBRA 4HIAA 4B93A 4R6LA 1V9YA 2V0UA 3EWKA 2M1CA 3A0VA 1DP9A 4HH3A 1NLYA 2A24B 3NJAA 2FZ0A 2ZMVA 2W3EA 3LI9A 3UB7A 4DJ2A 2O9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VV7 A;  1OT6 A;  3MQQ A;  1D7E A;  4WLA A;  4HJ4 A;  1XJ3 A;  4HNB A;  4LRZ E;  4HP4 A;  1OTB A;  2HV1 A;  1DP6 A;  1N9O A;  3A0R A;  1XFQ A;  1F98 A;  3F1N B;  2YKH A;  3IS2 A;  4JGR A;  4I39 A;  4YWZ A;  5TBM B;  3UB8 A;  3UMD A;  4F3L B;  1P97 A;  5J7E A;  3NOU C;  5HD3 A;  5G4Y A;  5F68 A;  1S4S A;  4R70 A;  2OOL A;  3D72 A;  3UB6 A;  1TS7 A;  2PD7 A;  3OLO A;  2J80 A;  3VE4 A;  1S1Z A;  4H6J A;  2V1A A;  3F1P B;  4HH2 A;  2W27 A;  2R78 A;  4BBV A;  4MN5 A;  2Z6D A;  1TS8 A;  5HSQ A;  3EEH A;  5DKK A;  2JHE A;  3E4P A;  4EES A;  3BY9 A;  2L1M A;  1T1C A;  4KQD A;  4HI4 A;  2W0N A;  3CAX A;  4NXB A;  2A24 A;  5HWV A;  1VB6 A;  4EW7 A;  4HJ6 A;  4HOI A;  3MFX A;  1D06 A;  3H7W B;  4L9F A;  4B9O A;  2VLG A;  3CLO A;  5F6A A;  2QWS A;  3VOL A;  5HWW A;  3FG8 A;  2PR6 A;  3PHY A;  2WKQ A;  1V9Z A;  4LRX C;  4EET B;  2QHK A;  5I5L A;  3LIB A;  4L9G A;  2K7S A;  4I5S A;  3LUQ A;  4K08 A;  3K3C A;  1LSX A;  4R38 A;  5A8B A;  3BY8 A;  4I3J A;  4BBT A;  3SW1 A;  2PD8 A;  1S67 L;  4KUK A;  2VEA A;  3H82 B;  3NOP C;  4E04 A;  2PR5 A;  2H28 A;  4I3I A;  2KDK A;  3F1P A;  4HHD A;  1LL8 A;  3MJQ A;  3KX0 X;  2PHY A;  2L4R A;  4HP9 A;  4XT2 B;  3ICY A;  2OWJ A;  1XJ6 A;  4WUJ A;  1GSX A;  3UB9 A;  4PKY G;  1OJ5 A;  1BYW A;  4WL9 A;  1P0Z A;  2VV6 A;  3F1O B;  3NOT C;  4GHI A;  2QJ5 A;  1S4R A;  1XJ2 A;  3E4Q A;  3FC7 A;  2PDR A;  1GSW A;  4MN6 A;  3MXQ A;  4PKY A;  5IS1 A;  4HJ3 A;  2WKR A;  5J3W A;  1DP8 A;  1N9N A;  3A0S A;  4I3A A;  3VE3 A;  4EXO A;  3LIE A;  3H82 A;  3IS2 B;  5AVF A;  4WF0 A;  4JGP A;  3C8C A;  4WN5 A;  2I9V A;  4M4X A;  4HY8 A;  1F9I A;  3MQO A;  2WKP A;  5DKL A;  3T50 A;  3HJK A;  3LYX A;  3F1N A;  1Y28 A;  4KUO A;  4R3A A;  5TBM A;  4XT2 A;  4F3L A;  1DRM A;  3NHQ A;  1OTI A;  5HDD A;  4EEP A;  1XFN A;  1X0O A;  3BWL A;  3B33 A;  4EQ1 A;  1T1A A;  1OT9 A;  3PYP A;  1UWN X;  4NXF A;  3F1O A;  1T19 A;  1T1B A;  2ZBB A;  2ZOI A;  3ULF A;  5J4E A;  2OWH A;  2L0W A;  3GEC A;  4HQA A;  1S66 L;  4L9E A;  2JN7 A;  4I38 A;  4DJ3 A;  5HD5 A;  2BAS A;  2PYP A;  3C2W A;  2QJ7 A;  2V1B A;  3LIC A;  5KIZ A;  5AVE A;  5HDS A;  2P7J A;  4NXG A;  4JGQ A;  5F5Y A;  5G4Z A;  4NXE A;  2ZOH A;  4GS9 B;  2Z6C A;  4RQ9 A;  3H7W A;  1EW0 A;  3MR0 A;  5HWT A;  1KOU A;  4BBU A;  1MZU A;  5HDC A;  4LLO B;  3LIA A;  3K3D A;  1UGU A;  3HJI A;  1TS0 A;  1OTE A;  2PYR A;  4EER A;  1UWP X;  3LIF A;  1LSW A;  3G6O A;  1XJ4 A;  5IU1 A;  3UE6 A;  1G28 A;  2INW A;  4LRY C;  2YKF A;  5DJT A;  1TS6 A;  1OTA A;  3UME A;  1NWZ A;  1GSV A;  2QKP A;  5F69 A;  2EA9 A;  1ODV A;  1S1Y A;  5EFW A;  2D01 A;  3ZQ5 A;  2V9A A;  4LPZ A;  1T18 A;  1OJG A;  2D02 A;  3E4O A;  1JNU A;  1N9L A;  4H6J B;  4GHI B;  4EEU A;  2B02 A;  2VV8 A;  5HZH A;  1OTD A;  4JGO A;  2GJ3 A;  3LI8 A;  4GS9 A;  1LSV A;  2CMN A;  2V0W A;  3H9W A;  3GDI A;  3CWF A;  3RH8 B;  1LT0 A;  4GW9 A;  1WA9 A;  3P7N A;  3RTY A;  5DJU A;  2KX6 A;  3LID A;  4GCZ A;  3IBR A;  4HIA A;  4R6L A;  1V9Y A;  2V0U A;  3EWK A;  2M1C A;  3A0V A;  1DP9 A;  4HH3 A;  3NJA A;  2A24 B;  3LI9 A;  3UB7 A;  4DJ2 A; 
#chains in the Genus database with same CATH topology
 2VV7 A;  2XFS A;  1OT6 A;  3G35 A;  3MQQ A;  1D7E A;  1FR1 A;  2VK3 A;  1JWP A;  3VSK A;  4LRZ E;  1YM1 A;  3N8S A;  2X01 A;  1OTB A;  1N9O A;  4N9K A;  2X02 A;  2Y4A A;  2JKR M;  3HVF A;  2JC7 A;  4P6Z M;  4B88 A;  1XA7 A;  1DY6 A;  4JGR A;  4U0X A;  3UE0 A;  2Y2J A;  4CLC A;  5KSC A;  3UB8 A;  5EOO A;  1A0K A;  3N8L A;  5J7E A;  1GCE A;  4H8R A;  2J8Y A;  3IH8 A;  4QY6 A;  3IH9 A;  4QPR A;  2XRO A;  1YLZ A;  4S2J A;  3R4K A;  1JTG A;  2PD7 A;  3PR6 A;  5DVA A;  3AGE A;  1GHP A;  1W5D A;  4QJG A;  5DF7 A;  1S1Z A;  3CG5 A;  3LR0 A;  5F1G A;  4WZ4 A;  2W3H A;  2J3W A;  2DRW A;  4BBV A;  1LLB A;  5HSQ A;  4DMZ A;  5FA7 A;  3LR3 A;  4KZA A;  4WZ5 A;  3KSI A;  5E2F A;  5M1A A;  1ONG A;  4IUK A;  4X53 A;  5DKK A;  1SKO B;  5TR7 A;  3E4P A;  2H0Y A;  1XKZ A;  4EES A;  1KDW A;  3KSH A;  3LFV A;  4UQI S;  3VP0 A;  4GZB A;  4EBP A;  3CAX A;  4NXB A;  1CI8 A;  1HTZ A;  1VB6 A;  3BYD A;  4HJ6 A;  3A3F A;  4HOI A;  3G30 A;  4KZ3 A;  3H7W B;  2OLV A;  4OPZ A;  2P74 A;  4ETZ A;  4L9F A;  3EGX C;  1KGG A;  4PM7 A;  4U0T A;  3FG8 A;  1XXM A;  3OCN A;  5A92 A;  2XFT A;  4CQH A;  1CF0 A;  3LEQ A;  2QHK A;  5I5L A;  3HCY A;  3K3C A;  1FSW A;  2QYB A;  4R38 A;  1EWZ A;  1LHY A;  4I3J A;  3DTM A;  3Q1F A;  3NOP C;  2G2W A;  4OP5 A;  2PR5 A;  2ZM0 A;  2KDK A;  4RYE A;  4Z9Q A;  3VMA A;  1ZKJ A;  3IWQ A;  3BQA A;  2J9O A;  3PBR A;  4DKI A;  1H8Z A;  3HLF A;  1SKO A;  5EVI B;  1MKI A;  4HP9 A;  2HZ5 A;  3ICY A;  2E8I A;  1K56 A;  1E25 A;  3CMZ A;  4XUZ A;  2OWJ A;  3S4X A;  2XH9 A;  1XJ6 A;  2VZW A;  2JKT I;  5L10 A;  2OAQ 1;  1OJ5 A;  1BYW A;  3JYI A;  1JWV A;  3ITA A;  1TDG A;  4WL9 A;  4PPR A;  2VV6 A;  3F1O B;  3OPP A;  3OPL A;  5HFO A;  4X6T A;  3FC7 A;  3CJM A;  2Z2M B;  5CEC A;  3LGO A;  3GRJ A;  3QP1 A;  4LFU A;  3T4S A;  5FAO A;  3HLC A;  4FCF A;  1SDN A;  1JTD A;  2Q9N A;  2HP5 A;  4LCM A;  4WEK A;  1PZO A;  2XGN A;  5FAP A;  1PNE A;  2Y8H A;  5U47 A;  4FSF A;  4I3A A;  4F94 A;  4EXO A;  1NZU A;  2HGV A;  4E3N A;  3JVV A;  4R23 A;  3C8C A;  4CLC E;  3M2J A;  4EWF A;  5CGS A;  3OPR A;  4HY8 A;  1ZG6 A;  2WKP A;  5CHJ A;  4DE3 A;  5DKL A;  1RGY A;  2VA0 A;  3LYX A;  4KZB A;  4PM6 A;  4ESP A;  3F1N A;  2O9C A;  1Y28 A;  2ACG A;  5DF9 A;  4KUO A;  3KYZ A;  1CK3 A;  3KSF A;  1DRM A;  3NHQ A;  2Y2P A;  3NBL A;  4UQI M;  4DE0 A;  4JXS A;  4OQG A;  1PIO A;  1T1A A;  2P04 A;  3V50 A;  4GN2 A;  4R3J A;  1OT9 A;  4DXB A;  3OC2 A;  3PYP A;  1UWN X;  4S2P A;  3F1O A;  4R1G A;  1VHM A;  4BD1 A;  2WGI A;  4Y2F A;  2LB5 A;  4JXV A;  1YT4 A;  2OWH A;  3GEC A;  2LB9 A;  3VSL A;  1S66 L;  1E3U D;  4EU0 A;  2JN7 A;  4O8G A;  5KSH A;  4DJ3 A;  2G7U A;  2OAP 1;  3B3X A;  2BLS A;  5EVE A;  4NXG A;  4JLF A;  4KZ6 A;  1YAX A;  1XGJ A;  1FIL A;  2Z6C A;  3UPN A;  1EW0 A;  5FI2 A;  3WRT A;  2NUT C;  5K5B A;  2PRF A;  3IQA A;  4GDB A;  1I5Q A;  4PM9 A;  1MZU A;  3ZVW A;  3LIA A;  2WGV A;  1BLP A;  2XSS A;  3FPW A;  2Z2L B;  2WGW A;  1VQQ A;  4X1L A;  2PYR A;  4GKU A;  1MY8 A;  1XJ4 A;  5IU1 A;  5L8M A;  1G28 A;  2BTF P;  3MKF A;  4FD8 A;  4PM5 A;  5DFX A;  4Q0J A;  4LRY C;  2GZA A;  2YKF A;  5DJT A;  1HLU P;  1XP4 A;  3W2Z A;  4ARZ A;  1TS6 A;  4C6Y A;  4OKP A;  2OSU A;  3KYQ A;  4S2M A;  2EWW A;  1XPB A;  1N4O A;  5F69 A;  1ODV A;  2D01 A;  1ES5 A;  2Y2G A;  4IVI A;  4P0M A;  2Y2K A;  2PU2 A;  2WAF A;  2WKH A;  4Y13 A;  4YOF A;  3EGD C;  5CTN A;  1K57 A;  4HBT A;  2D02 A;  1NRF A;  4H6J B;  5FL3 A;  4GHI B;  2B02 A;  1GHI A;  3PBQ A;  3IF6 C;  3IT9 A;  4P6Z S;  2HDU A;  4BJP A;  4BQM A;  4DF6 A;  1K6S A;  3L7H A;  5CHU A;  3VFH A;  5FAS A;  1LSV A;  4OOY A;  2V0W A;  3H9W A;  3BFE A;  1P9R A;  1PFL A;  3HBR A;  1LT0 A;  2V20 A;  3N7W A;  4GW9 A;  3P7N A;  4LV3 A;  4BL2 A;  5DJU A;  3HUN A;  4K0W A;  1K57 C;  4GCZ A;  3SS3 A;  4IBX A;  2JE5 A;  4E3K A;  3G4P A;  4DJ2 A;  3C7U A;  2O9A A;  3MFD A;  4FUW A;  4M3K A;  3UB5 P;  1KDS A;  2HV1 A;  1DP6 A;  3O3V A;  3IHB A;  2Y2N A;  4S2N A;  4KG6 A;  3SS4 A;  2PBY A;  2ZC4 B;  3FKW A;  5F83 A;  5TBM B;  3UMD A;  2B18 A;  4F3L B;  1KVL A;  2VGL S;  2Y91 A;  4MN7 A;  4B4X A;  3MXR A;  1J3W A;  1NRJ A;  3G32 A;  5F68 A;  1DJB A;  5E43 A;  1S4S A;  3V67 A;  5CER A;  3D72 A;  3UB6 A;  3ZGA B;  1K54 C;  4HBU A;  4KQQ A;  1W63 Q;  3O86 A;  5AJG A;  1PI4 A;  3VE4 A;  4ETX A;  4H6J A;  4C75 A;  3F1P B;  4HH2 A;  2Y2H A;  1K0K A;  4MN5 A;  1PYY A;  3E0Y A;  3QHY A;  2XK1 A;  3EEH A;  1H8Y A;  4LV2 A;  2WZZ A;  3S7O A;  4X69 A;  3BY9 A;  1W8Q A;  2XF3 A;  3Q82 A;  1VET A;  2EX6 A;  1PWD A;  5HX9 A;  4OP8 A;  2W0N A;  1L2S A;  3SH9 A;  2KOI A;  3G31 A;  3MFX A;  4XUX A;  5I94 A;  3MKE A;  4RX3 A;  4KG5 A;  5EOE A;  4B9O A;  5CHM A;  5C5K A;  2VLG A;  1K4F A;  2EFX A;  3W4Q A;  3B42 A;  4S2I A;  2O99 A;  2QWS A;  3VOL A;  5HWW A;  1BLS A;  2ZQD A;  3CPT A;  2RCX A;  4N92 A;  2EX9 A;  1V9Z A;  2Y79 A;  4WMC A;  1Y54 A;  3LUQ A;  3L9K A;  4O01 A;  1S0W A;  3BY8 A;  1IYP A;  4BBT A;  1S67 L;  3TRC A;  4ZRR A;  3EEA A;  3G2Z A;  3TOI A;  2HDQ A;  4E04 A;  4WM9 A;  1YKD A;  2DMW A;  3F1P A;  4KZ5 A;  1Q2Q A;  1LL8 A;  3MJQ A;  3KX0 X;  3IX3 A;  5IT5 A;  4CJN A;  4O0P A;  4E3O A;  5LBR A;  3BLS A;  3T1S A;  1ONH A;  4RA7 A;  2ZL1 A;  5FQK A;  4FH4 A;  3E2L A;  4X68 A;  1WE4 A;  1K55 A;  5EM1 A;  3OPH A;  3ZG8 B;  1BTL A;  1YMS A;  1PI5 A;  2DCF A;  1ESU A;  2XD5 A;  2JCH A;  1CQA A;  1P0Z A;  3NOT C;  3IXG A;  2VKS A;  2B5R A;  5TGF A;  5HW3 A;  4CLC C;  3MZD A;  3C5A A;  4OH0 A;  4MN6 A;  3M2K A;  3QNC A;  3C38 A;  3MXQ A;  1LL5 A;  1MWR A;  3UDF A;  4PKY A;  4R4S A;  3UPP A;  4JF6 A;  4OQ0 A;  3Q81 A;  3DBA A;  4HJ3 A;  2JKT M;  2V8C A;  4E3M A;  2VGL M;  2ZQC A;  2ZQ8 A;  3VP4 A;  4BLM A;  2UWX A;  3WS2 A;  3VE3 A;  1ES2 A;  3IS2 B;  5AVF A;  4WF0 A;  4DXC A;  2QMI A;  4K0X A;  1SZV A;  2C6W B;  1MPL A;  5HPF A;  4DDY A;  1RCJ A;  4WN5 A;  4M4X A;  4WZ5 C;  4E3I A;  1IOU A;  3MQO A;  3JPU A;  1ZHH B;  3BFC A;  3ZCZ A;  1PZP A;  1JVJ A;  3MZE A;  5J8X A;  3VV4 A;  4JF4 A;  3DTE A;  1YPR A;  1O7E A;  5HDD A;  1SKF A;  1NXY A;  2HPB A;  3ZG9 B;  4EEP A;  2O0Y A;  3BFD A;  1XA1 A;  3G34 A;  3O87 A;  3V39 A;  4NET A;  3BWL A;  4XXR A;  5GLD A;  3MXS A;  4EQ1 A;  4ZTK A;  3MQ0 A;  4R4R A;  4IJG A;  1W7F A;  3P09 A;  1T1B A;  2VJW A;  3BRM A;  4K91 A;  2ZOI A;  4KG2 A;  4EUV A;  3I7J A;  3C4O A;  5FAQ A;  2L0W A;  2ZC7 A;  3SS5 A;  1KE3 A;  2RL3 A;  4Z1W A;  1AXB A;  4E6X A;  3HUO A;  3T4L A;  2BAS A;  2PYP A;  5KIZ A;  5HDS A;  4DN0 A;  3PBO A;  4JPM A;  1LI9 A;  4G3V A;  4NXE A;  1XGI A;  3ZHH A;  5AQ7 A;  4CLC D;  2W3D A;  2ZOH A;  4C3Q A;  1C3B A;  3H7W A;  4WYY A;  3VP1 A;  4DE2 A;  1L0F A;  4MBK A;  3MR0 A;  2P08 A;  3HLD A;  3G2Y A;  5E2G A;  1ERM A;  3FPV A;  3MBZ A;  2FH5 A;  4PMA A;  1UGU A;  4LV0 A;  4RX2 A;  2FFF B;  1IYS A;  1EI5 A;  1ZC2 A;  4MCW A;  1FCN A;  1OTE A;  4EER A;  4BD0 A;  1LSW A;  4MEZ A;  4OLG A;  1L0D A;  1KE4 A;  3PXP A;  3MMH A;  3DWZ A;  4WBG A;  2HDS A;  4IBR A;  3S1Y A;  3IWI A;  1SCW A;  3JVU A;  3T4T A;  3W8K A;  2HJE A;  1M6K A;  1MWU A;  2XRN A;  2ZLY A;  3CHW P;  3UME A;  4LEN A;  3D9Y A;  4OPR A;  2R9W A;  3S7P A;  2EA9 A;  2EXB A;  3TJZ C;  4N9L A;  3ZQ5 A;  2V9A A;  3WRZ A;  1CJF A;  4LPZ A;  1T18 A;  4IHQ A;  3MS6 A;  4BEN A;  3UY6 A;  4UHU A;  1IKI A;  2PU4 A;  5EVI A;  4G3W A;  1JNU A;  1N9L A;  4ZDX A;  1G5U A;  2Y2M A;  4JKT A;  5HL1 A;  1K38 A;  1M40 A;  4YIN A;  4Y0U A;  3Q7Z A;  4E6W A;  4QHC A;  1ACF A;  4B4Z A;  3PBN A;  4PAU A;  3O88 A;  3BEC A;  3IBR A;  2JKF A;  1H0M A;  4QY5 A;  2M1C A;  3TG9 A;  4HH3 A;  1NLY A;  3BM6 A;  2ZMV A;  4JXG A;  2OV5 A;  2W3E A;  2I72 A;  5F1F A;  3SOI A;  2ZM2 A;  1MBL A;  1XJ3 A;  4Q0H A;  1FCO A;  4GOG A;  3A0R A;  1XFQ A;  3TE8 A;  1ZG4 A;  4KEN B;  4WEJ A;  2W1R A;  3RJU A;  5CX7 A;  3UE1 A;  3PAE A;  4YWZ A;  3TW8 A;  2UV0 E;  1K56 D;  4EV4 A;  3NOU C;  5HD3 A;  2JKG A;  1BUE A;  4R70 A;  2OOL A;  1LL9 A;  2Q0O A;  3BFF A;  3NEC A;  2HP9 A;  1IYQ A;  2J80 A;  2Y59 A;  3LR4 A;  3ZVT A;  2IWD A;  2WAD A;  3PBS A;  5IHV A;  1PW1 A;  2V1A A;  4D60 A;  3UDI A;  2HP6 A;  5HAQ A;  2W27 A;  3C4P A;  1ZTU A;  2Z6D A;  3OZH A;  1TS8 A;  5CEB A;  2Y2L A;  4BWI A;  2ZQ7 A;  2EXA A;  2K2N A;  5TFQ A;  1ES4 A;  2KLI A;  3GTC A;  2WAE A;  3T4O A;  2Y55 A;  2DNS A;  1NYY A;  4L0L A;  1T1C A;  4OLD A;  1J9M A;  2R9X A;  3FKV A;  5G18 A;  3VP2 A;  5HWV A;  4RVA A;  4EW7 A;  1D06 A;  3VOZ A;  3T4Q A;  5CED A;  4EQI A;  4ZJ1 A;  2W3F A;  1F5M A;  3LCE A;  4ZJ2 A;  3CLO A;  1HVB A;  5F6A A;  2Y2O A;  2V1Z A;  2V8F A;  5FSR A;  2PR6 A;  3TSG A;  3Q7V B;  1FIK A;  4LRX C;  4EET B;  3UPO A;  1AWI A;  3NI9 A;  3LIB A;  1H3Q A;  2NUP C;  1LSX A;  2WYX A;  5KZH A;  2GNX A;  3EQU A;  5GHZ A;  4OON A;  2VEA A;  5DFY A;  5FI6 A;  4OQI A;  4I3I A;  4JXW A;  4HHD A;  3MF0 A;  3GSG A;  2XD1 A;  1CI9 A;  5AQB A;  5EPH A;  3T12 B;  3IX8 A;  3HUM A;  2P9V B;  2L4R A;  3OBF A;  3BQ8 A;  1TF1 A;  3ZNT A;  4MLL A;  3MSH A;  3Q07 A;  2CC1 A;  4XT2 B;  2GX5 A;  4MNR A;  2H10 A;  1MC0 A;  4KZ7 A;  3UDX A;  3T1X A;  1GA9 A;  3LO7 A;  4D2O A;  1S6R A;  4WUJ A;  3UB9 A;  3BJN A;  3AGD A;  5TJJ A;  3K2N A;  4GHI A;  4O7D A;  1NJ4 A;  4QWO A;  4S2N C;  1K4E A;  2WZX A;  1S4R A;  2X71 A;  5HAR A;  1KVM A;  2B95 A;  2VGK A;  5FQJ A;  2Y2I A;  3S7Q A;  1GSW A;  4X25 A;  1ESI A;  3DTI A;  1BT5 A;  2QPN A;  2M7V A;  4PM8 A;  3QP4 A;  5CGW A;  1IYO A;  1L0E A;  4Y7P A;  3QP2 A;  1E4D A;  5JYO A;  1BLC A;  1DP8 A;  1N9N A;  1YMX A;  1K6R A;  2GDN A;  5M18 A;  1ERQ A;  5KMW A;  2XEP A;  4YFM A;  4CLC B;  2ZC6 B;  3A3E A;  2I9V A;  4X1M A;  2ZQ9 A;  1W8Y A;  1D1J A;  3SZT A;  3T50 A;  3HJK A;  1GA0 A;  4Y5F A;  3O5Y A;  3FWL A;  3LEZ A;  5EUA A;  1F2K A;  3P98 A;  3V3R A;  3C7V A;  5TBM A;  1STZ A;  4XT2 A;  5E2H A;  4F3L A;  1CEF A;  4HES A;  1OTI A;  5DF8 A;  3RXW A;  4UEY A;  1RGZ A;  3C30 A;  3NIA A;  1FOF A;  4LCL A;  2IWC A;  5EV0 A;  3R7W B;  4N1X A;  2ZC3 B;  3NY4 A;  3GR2 A;  2A2L A;  3NDE A;  3ZYT A;  2XLN A;  1TEM A;  4DE1 A;  5FQM A;  1IKG A;  1G6A A;  4L9E A;  4ZJ3 A;  2J3T C;  3QP6 A;  3W4P A;  2ZMF A;  4I38 A;  1YSP A;  3QNB A;  2M7U A;  4CPK A;  1WYB A;  5HD5 A;  3C2W A;  2WUQ A;  5EE8 A;  1VEU B;  3LIC A;  1NYM A;  2ZC5 B;  4JGQ A;  5F5Y A;  5G4Z A;  3BLM A;  2J9P A;  1TD5 A;  3D4F A;  2VX8 A;  1FCM A;  3M6B A;  1WYC A;  1YLW A;  3E2K A;  4DRT A;  1W63 M;  1BZA A;  5L07 A;  4S2O A;  1KOU A;  4UA6 A;  4X56 A;  5FEG A;  2W3G A;  4OQH A;  1K55 C;  3N4I A;  3K3D A;  3HJI A;  2H0T A;  4P6B A;  1OME A;  3KO6 A;  4X55 A;  5MC7 A;  1UWP X;  2EFU A;  4Y17 A;  3LIF A;  3G6O A;  3CUE A;  3IF5 A;  5FDH A;  2INW A;  3BFG A;  1BUL A;  1YQS A;  4OOL A;  5GL9 A;  4Q0I A;  4KZ4 A;  3R7W A;  5EEC A;  1NWZ A;  2HF6 A;  2WKI A;  3MZF A;  3P01 A;  1S1Y A;  3V3S A;  4HEF A;  1DJC A;  3HLB A;  3CUE C;  1NY0 A;  4UA7 A;  4MMN A;  2HJ9 C;  4EEU A;  4QD4 A;  2K31 A;  2MJ6 A;  1VEU A;  5FQI A;  4GJ4 A;  5HZH A;  4UA9 A;  4JGO A;  3DWK A;  2GJ3 A;  3QP8 A;  3A3I A;  4WMC D;  3ZNY A;  2WK0 A;  2CMN A;  4GNU A;  2JKR I;  3CWF A;  2J3T D;  2JBF A;  3RH8 B;  3GVB A;  1L3L A;  4G3K A;  1WA9 A;  5DTS A;  4B93 A;  1V9Y A;  2V0U A;  5FI7 A;  3A0V A;  1DP9 A;  4KZ8 A;  3NJA A;  2A24 B;  5CXW A;  2FZ0 A;  3NCK A;  1IEM A;  1H5X A;  1E3U A;  3WS5 A;  4WLA A;  4ZAM A;  4HJ4 A;  4HNB A;  4HP4 A;  4MBH A;  4IED A;  4NEE D;  4QU3 A;  1F98 A;  3F1N B;  1H8M A;  2YKH A;  3IS2 A;  3HLE A;  4I39 A;  1ES3 A;  4LV1 A;  3ZFZ A;  5HPI A;  1P97 A;  4R3B A;  4GDN A;  3LR5 A;  5G4Y A;  4S2L A;  2ZMA A;  1I2S A;  3PBT A;  5AQ9 A;  1N9B A;  5FQ9 A;  5GLC A;  1TS7 A;  2EX8 A;  3OLO A;  5EVL A;  5HL6 A;  3N6I A;  3SH7 A;  3T4J A;  2FFY A;  4AFI A;  3ISG A;  4DDS A;  3ZDJ A;  2R78 A;  3OCL A;  2ZD8 A;  3ZG5 A;  3U2A A;  3N8R A;  1PW8 A;  1Y4O A;  4P85 A;  4KQR A;  3DTK A;  3FZC A;  2XA7 S;  5F82 A;  2JHE A;  3IHA A;  4YNR A;  2L1M A;  4OVD A;  4BL3 A;  3A3D A;  1FR6 A;  4IUH A;  4MBF A;  4KQD A;  4HI4 A;  2A24 A;  3M6H A;  2PAV P;  1TVF A;  1ERO A;  3UE3 A;  3IXB A;  3UNW A;  3WS4 A;  3A3J A;  3RXX A;  5A93 A;  4UAA A;  3DW0 A;  4Y15 A;  3PHY A;  1K25 A;  2WKQ A;  4GLQ A;  2WGW B;  5DTT A;  4ZBE A;  2G2U A;  5GLA A;  4L9G A;  2K7S A;  4I5S A;  5CGX A;  2PT7 A;  4K08 A;  1MXO A;  1KGF A;  1Z6F A;  1O07 A;  5A8B A;  5EVI C;  1MWS A;  4FOF A;  3SW1 A;  2PD8 A;  4KUK A;  4P87 A;  4ARZ B;  3H82 B;  3IF6 B;  4II7 A;  2H28 A;  5A90 A;  5D3O A;  4Y0T A;  2E8J A;  1W79 A;  1XX2 A;  4LGW A;  2PHY A;  4Y3I A;  4BMW A;  3EQV A;  1YLY A;  5FEF A;  2IWB A;  1KE0 A;  5GHX A;  3GMW A;  2AVX A;  3BEB A;  3VFF A;  1RP5 A;  4OPQ A;  3SH8 A;  3S7N A;  1PWG A;  3ZG0 A;  3LY4 A;  5AQA A;  5FQQ A;  1LI0 A;  4MDZ A;  1GSX A;  1NZO A;  3T1R A;  4E3J A;  2C5W B;  4PKY G;  3WS0 A;  2J7V A;  1NLZ A;  3U4L P;  4NK3 A;  2QJ5 A;  3CIT A;  1XJ2 A;  3RFB A;  1BLH A;  3E4Q A;  2VGJ A;  2PDR A;  3NUL A;  3VOY A;  2ZM8 A;  2H5S A;  3EOI A;  3OOV A;  3IBJ A;  4EUZ A;  5IS1 A;  3QP5 A;  4NKP A;  2XQZ A;  5GLB A;  2WKR A;  4OPY A;  1I2W A;  1P9W A;  5J3W A;  3S22 A;  3FV7 A;  4N1H A;  5DTK A;  3A0S A;  5L2F A;  3E98 A;  1MKM A;  3LIE A;  3H82 A;  4R0Q A;  2BG1 A;  3IF6 A;  1OPX A;  4JGP A;  3GQZ A;  3NDG A;  4Y0O A;  3IXD A;  4JF5 A;  1F9I A;  1PWC A;  3CI6 A;  4GD8 A;  5EVI D;  5CRF A;  4R3A A;  5GHY A;  2WKE A;  5CTM A;  2XA7 M;  2W1T B;  5EM0 A;  1TDL A;  1G6O A;  3ZG7 B;  3D3O A;  3GV9 A;  1XFN A;  1X0O A;  3LY3 A;  1PRQ A;  3B33 A;  3HLW A;  1IEL A;  3IWO A;  3KSG A;  2XDM A;  1YSQ A;  4NXF A;  3V5M A;  1U60 A;  1T19 A;  2V2F F;  1FQG A;  4QB8 A;  1YLP A;  2ZBB A;  3IX4 A;  1VET B;  4EBL A;  3UO9 A;  4ID4 A;  3ULF A;  5J4E A;  4HQA A;  3HLG A;  4U3T A;  4KZ9 A;  4JBF A;  4S2K A;  5FDS A;  4GB7 A;  5L09 A;  1K54 A;  3FYZ A;  2QJ7 A;  2V1B A;  5AVE A;  2P7J A;  1ALQ A;  1KGE A;  2PBD P;  5HAI A;  5BOH A;  3CPT B;  1HD8 A;  4GS9 B;  1QMF A;  3UN7 A;  4RQ9 A;  5HAP A;  3WS1 A;  1HZO A;  5HWT A;  4BBU A;  5HDC A;  4LLO B;  3VP3 A;  2A49 A;  3BW6 A;  3Q7V A;  2XR0 A;  1TS0 A;  2W1T A;  3PTE A;  2ZJ9 A;  1MWT A;  1DJA A;  4E3L A;  1SHV A;  3UE6 A;  4ME4 A;  4WEL A;  1IFQ A;  1YLT A;  1OTA A;  3T4K A;  1G68 A;  2ZL1 B;  1GSV A;  2A3U A;  1GHM A;  5A91 A;  2QKP A;  3CZD A;  3NC8 A;  4PHT A;  5EFW A;  4Q8I A;  1FSY A;  1Q2P A;  5E2E A;  1L0G A;  3AGF A;  4FH2 A;  2EWV A;  3T1Q B;  4GD6 A;  4A5R A;  2O9B A;  4OOM A;  2P9V A;  1OJG A;  1SDE A;  1Z09 A;  2OLU A;  4IVK A;  3B47 A;  2IA2 A;  4EBN A;  4NG2 A;  3E4O A;  1CEG A;  3HRE A;  2VV8 A;  3PAG A;  3HL9 A;  1VM1 A;  1OTD A;  5JYP A;  4KQO A;  2Q9M A;  3LI8 A;  5M19 A;  3ITB A;  1QME A;  4GS9 A;  4FTX A;  1BSG A;  2ZQA A;  1YLJ A;  3GDI A;  5FAT A;  2QZ6 A;  2EX2 A;  3RTY A;  2KX6 A;  3LID A;  4HIA A;  3IXH A;  4R6L A;  3EWK A;  3W4O A;  3KYE A;  2HDR A;  1JWZ A;  3DAV A;  3LI9 A;  3UB7 A;  2Y2Q A;  3WWX A; 
#chains in the Genus database with same CATH homology
 2VV7 A;  1OT6 A;  3MQQ A;  1D7E A;  4WLA A;  4HJ4 A;  1XJ3 A;  4HNB A;  4LRZ E;  4HP4 A;  1OTB A;  2HV1 A;  4Q0H A;  1DP6 A;  1N9O A;  4NEE D;  2JKR M;  3A0R A;  1XFQ A;  3TE8 A;  1F98 A;  3F1N B;  4P6Z M;  1H8M A;  4WEJ A;  2YKH A;  3IS2 A;  4JGR A;  4I39 A;  2W1R A;  5CX7 A;  4CLC A;  4YWZ A;  3TW8 A;  5TBM B;  3UB8 A;  3UMD A;  5HPI A;  2B18 A;  4F3L B;  1P97 A;  5J7E A;  2VGL S;  4MN7 A;  3NOU C;  5HD3 A;  3LR5 A;  1NRJ A;  5F68 A;  5G4Y A;  4QPR A;  2XRO A;  1S4S A;  4R70 A;  2OOL A;  3V67 A;  3PBT A;  3D72 A;  3UB6 A;  3R4K A;  1TS7 A;  2PD7 A;  3OLO A;  3PR6 A;  5HL6 A;  2J80 A;  1W63 Q;  3LR4 A;  3T4J A;  5AJG A;  4AFI A;  3VE4 A;  3PBS A;  1S1Z A;  3LR0 A;  4ETX A;  4H6J A;  2V1A A;  2W3H A;  3F1P B;  2J3W A;  4HH2 A;  2W27 A;  2R78 A;  3OCL A;  4BBV A;  3U2A A;  4MN5 A;  1ZTU A;  2Z6D A;  1TS8 A;  3E0Y A;  5HSQ A;  4DMZ A;  3EEH A;  4BWI A;  3LR3 A;  2K2N A;  3KSI A;  4IUK A;  2KLI A;  5DKK A;  2XA7 S;  2JHE A;  3E4P A;  3T4O A;  3S7O A;  4EES A;  4YNR A;  3BY9 A;  2L1M A;  3KSH A;  3LFV A;  4UQI S;  4L0L A;  1T1C A;  4IUH A;  4KQD A;  4HI4 A;  2W0N A;  3CAX A;  4NXB A;  2A24 A;  5HWV A;  1VB6 A;  4EW7 A;  4HJ6 A;  2KOI A;  4HOI A;  3MFX A;  1D06 A;  3UE3 A;  3H7W B;  3T4Q A;  4ETZ A;  2W3F A;  4L9F A;  4B9O A;  1F5M A;  5C5K A;  3EGX C;  2VLG A;  3CLO A;  3B42 A;  5F6A A;  2O99 A;  2QWS A;  3VOL A;  5HWW A;  3FG8 A;  2PR6 A;  3PHY A;  3OCN A;  2WKQ A;  4CQH A;  1V9Z A;  4LRX C;  4EET B;  4GLQ A;  2QHK A;  2Y79 A;  5I5L A;  3HCY A;  3LIB A;  4L9G A;  2K7S A;  4I5S A;  1H3Q A;  2PT7 A;  3LUQ A;  4K08 A;  2NUP C;  3K3C A;  1LSX A;  2QYB A;  4R38 A;  5A8B A;  4O01 A;  3BY8 A;  2GNX A;  4I3J A;  4BBT A;  4FOF A;  3SW1 A;  2PD8 A;  1S67 L;  3EQU A;  4KUK A;  3TRC A;  4ARZ B;  4ZRR A;  2VEA A;  3H82 B;  3EEA A;  3NOP C;  5DFY A;  4II7 A;  4E04 A;  2PR5 A;  2H28 A;  4I3I A;  2KDK A;  1YKD A;  2DMW A;  3F1P A;  4HHD A;  3MF0 A;  1LL8 A;  3MJQ A;  3KX0 X;  3BQA A;  2PHY A;  4Y3I A;  3PBR A;  4BMW A;  5IT5 A;  3EQV A;  4O0P A;  2L4R A;  3OBF A;  5LBR A;  3BQ8 A;  1TF1 A;  4HP9 A;  4XT2 B;  3ICY A;  2GX5 A;  3S7N A;  1MC0 A;  2OWJ A;  1XJ6 A;  4MDZ A;  4WUJ A;  1GSX A;  3UB9 A;  2VZW A;  2JKT I;  2OAQ 1;  4PKY G;  1OJ5 A;  1BYW A;  1NLZ A;  3BJN A;  5TJJ A;  3K2N A;  4WL9 A;  1P0Z A;  2VV6 A;  3F1O B;  3NOT C;  4GHI A;  2QJ5 A;  3CIT A;  1S4R A;  1XJ2 A;  3RFB A;  2VKS A;  3E4Q A;  3FC7 A;  3S7Q A;  2PDR A;  4CLC C;  1GSW A;  4MN6 A;  3OOV A;  3EOI A;  3C38 A;  3MXQ A;  4PKY A;  3IBJ A;  2M7V A;  3T4S A;  5IS1 A;  3DBA A;  4NKP A;  4HJ3 A;  2JKT M;  2VGL M;  4WEK A;  2WKR A;  1P9W A;  5J3W A;  2Y8H A;  1DP8 A;  1N9N A;  3A0S A;  4FSF A;  3E98 A;  4I3A A;  3VE3 A;  1MKM A;  4EXO A;  3LIE A;  2HGV A;  3H82 A;  3IS2 B;  4WF0 A;  5AVF A;  3JVV A;  1OPX A;  4JGP A;  4CLC B;  3C8C A;  4CLC E;  5HPF A;  4WN5 A;  2I9V A;  4M4X A;  4HY8 A;  1IOU A;  1F9I A;  3MQO A;  1ZHH B;  2WKP A;  5DKL A;  3T50 A;  3HJK A;  2VA0 A;  3LYX A;  4Y5F A;  3O5Y A;  3F1N A;  3CI6 A;  2O9C A;  1Y28 A;  5DF9 A;  4KUO A;  4R3A A;  3KYZ A;  3VV4 A;  2XA7 M;  2W1T B;  5TBM A;  1STZ A;  4XT2 A;  4F3L A;  3KSF A;  1DRM A;  3NHQ A;  1G6O A;  1OTI A;  4UQI M;  3D3O A;  5HDD A;  4EEP A;  1XFN A;  1X0O A;  2O0Y A;  4UEY A;  3C30 A;  3BWL A;  3B33 A;  4EQ1 A;  1T1A A;  2P04 A;  1OT9 A;  3R7W B;  3MQ0 A;  3OC2 A;  3KSG A;  3PYP A;  1YSQ A;  1UWN X;  4IJG A;  4NXF A;  3F1O A;  1T19 A;  1VHM A;  1T1B A;  2VJW A;  2ZBB A;  2ZOI A;  4EUV A;  2A2L A;  3ULF A;  4Y2F A;  2LB5 A;  3ZYT A;  5J4E A;  2OWH A;  2L0W A;  3GEC A;  4HQA A;  2LB9 A;  1S66 L;  4L9E A;  2J3T C;  4Z1W A;  4EU0 A;  2JN7 A;  2ZMF A;  4I38 A;  1YSP A;  4O8G A;  2M7U A;  4DJ3 A;  5KSH A;  3T4L A;  2G7U A;  5HD5 A;  2BAS A;  2OAP 1;  2PYP A;  3C2W A;  2QJ7 A;  2V1B A;  3LIC A;  5KIZ A;  5AVE A;  5HDS A;  2P7J A;  4DN0 A;  3PBO A;  4NXG A;  4JGQ A;  5F5Y A;  1YAX A;  4G3V A;  5G4Z A;  4NXE A;  4CLC D;  2W3D A;  2ZOH A;  1TD5 A;  4GS9 B;  2Z6C A;  2VX8 A;  4RQ9 A;  3H7W A;  1EW0 A;  1W63 M;  2NUT C;  5K5B A;  3MR0 A;  2P08 A;  5HWT A;  1KOU A;  4BBU A;  1MZU A;  5HDC A;  4LLO B;  3FPV A;  3LIA A;  2FH5 A;  2W3G A;  2XSS A;  3BW6 A;  3FPW A;  3K3D A;  1UGU A;  3HJI A;  1TS0 A;  3KO6 A;  4MCW A;  2W1T A;  1OTE A;  2PYR A;  4EER A;  5MC7 A;  1UWP X;  3LIF A;  1LSW A;  3G6O A;  3CUE A;  1XJ4 A;  3PXP A;  5IU1 A;  1G28 A;  3MMH A;  5L8M A;  3UE6 A;  4ME4 A;  2INW A;  4WEL A;  5DFX A;  3JVU A;  4Q0J A;  4LRY C;  3T4T A;  4OOL A;  2GZA A;  2YKF A;  5DJT A;  3W2Z A;  2HJE A;  4ARZ A;  1IFQ A;  2XRN A;  4Q0I A;  1TS6 A;  1OTA A;  3T4K A;  3R7W A;  3UME A;  1NWZ A;  1GSV A;  2HF6 A;  3KYQ A;  2EWW A;  2QKP A;  5F69 A;  3S7P A;  2EA9 A;  1ODV A;  4PHT A;  3P01 A;  1S1Y A;  3TJZ C;  5EFW A;  2D01 A;  3ZQ5 A;  2EWV A;  2V9A A;  4LPZ A;  1T18 A;  2O9B A;  4IHQ A;  4OOM A;  4YOF A;  3EGD C;  1OJG A;  3CUE C;  3B47 A;  2IA2 A;  2D02 A;  4G3W A;  3E4O A;  1JNU A;  1N9L A;  4H6J B;  4MMN A;  5FL3 A;  2HJ9 C;  4GHI B;  2B02 A;  4EEU A;  2K31 A;  2VV8 A;  2MJ6 A;  3PBQ A;  4GJ4 A;  5HZH A;  1OTD A;  4P6Z S;  4BJP A;  4JGO A;  2GJ3 A;  4KQO A;  3LI8 A;  4GS9 A;  1LSV A;  2CMN A;  2V0W A;  3H9W A;  3GDI A;  2JKR I;  3PBN A;  3CWF A;  2J3T D;  1P9R A;  4PAU A;  3RH8 B;  1LT0 A;  4GW9 A;  4G3K A;  1WA9 A;  3P7N A;  3RTY A;  5DJU A;  2KX6 A;  3LID A;  4GCZ A;  3IBR A;  4HIA A;  4B93 A;  4R6L A;  1V9Y A;  2V0U A;  3EWK A;  2M1C A;  3A0V A;  1DP9 A;  4HH3 A;  1NLY A;  2A24 B;  3NJA A;  2FZ0 A;  2ZMV A;  2W3E A;  3LI9 A;  3UB7 A;  4DJ2 A;  2O9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...