3B3DA

B.subtilis ytbe
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
280
structure length
280
Chain Sequence
MTTHLQAKATLHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNEAGVGEGIREGIEEAGISREDLFITSKVWNADLGYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKEAWRALETLYKEGRIKAIGVSNFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQGQLLDHPVLADIAQTYNKSVAQIILRWDLQHGIITIPKSTKEHRIKENASVFDFELTQDDMNRIDALNENLRVGPDPDNFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical analyses of YvgN and YtbE from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords Putative morphine dehydrogenase
total genus 100
structure length 280
sequence length 280
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3b3dA00
4L1XA 4LBRA 2PDQA 4GACA 5JH1A 4ASTA 2IKJA 2ACRA 3O0KA 3H7UA 2ALRA 1IHIA 3H4GA 3LN3A 4IJCA 5LIWX 3EB3A 5C7HA 2IKGA 4QXIA 2FVLA 4YVVA 1RALA 4JTDA 4XAPA 1T40A 1ZGDA 2FZ9A 1ZSXA 2VDGA 1A80A 2HE8A 2NVCA 4LAUA 2F2KA 1PYFA 3GHTA 3CMFA 5M2FX 2BGQA 3CV6A 1PZ1A 4IJRA 1VP5A 3LD5A 3BV7A 3D3FA 3UGRA 2FZBA 2IPJA 3LZ5A 4ZFCA 3NTYA 2I17A 3O3RA 4PRRA 2QXWA 4GQ0A 3V0TA 2PDXA 2R9RA 3R58A 1X98A 3G5EA 4DZ5A 3F7JA 1RY8A 4GABA 5LIUX 1YE4A 1XF0A 5AZ0A 3GUGA 1FRBA 4XK2A 1MZRA 1ZQ5A 4LB3A 3WCZA 3LNMA 3UG8A 1T41A 3BCJA 1C9WA 1PZ0A 3VXGA 4JQ3A 4XVEA 4MHBA 5LIKX 3CV7A 4JQ2A 3V0SA 3LQLA 4LAZA 2PDBA 3RX2A 2PD5A 4WDWA 4YVXA 4XZLX 3BURA 4PUWA 3LUTA 1PWLA 4FZIA 1EL3A 2PDIA 1EKOA 3LEPA 3GHSA 4QX4A 1MRQA 1S2AA 4HMNA 4JIRA 4WDUA 4XVDA 2J8TA 2HEJA 3R8GA 2HDJA 3ONCA 1Q13A 4JQ1A 4DBSA 3WBWA 1QWKA 4FA3A 4WDXA 3N6QA 1X97A 1AH4A 3R94A 3R43A 1HW6A 1AH3A 2PDUA 3B3DA 3Q65A 2IPWA 5AZ1A 2IKHA 3R8HA 3V0UA 4YVPA 3LENA 1ZUAX 1RY0A 4XO6A 3ERPA 1J96A 3Q67A 2FZDA 1MI3A 4EXAA 3T42A 3COTA 1Z9AA 2PDKA 1US0A 2NVDA 2WZTA 3DOPA 4PRTA 1S1RA 2FGBA 1YE6A 4PR4A 1UR3M 3N2TA 4JTCA 1PWMA 3GHRA 2IQ0A 4Q3MA 1EXBA 3P2VA 4JQAA 2WZMA 3EAUA 3LBOA 3C3UA 4PUUA 3UZXA 5LIYX 2IQDA 3GHUA 4JTQA 4ICCX 3UP8A 2PDCA 1JEZA 2PDNA 3UFYA 2PDFA 1XJBA 2BP1A 1SM9A 2AGTA 3WBXA 4HBKA 1VBJA 4PMJA 4JTRA 4NKCA 2PDJA 2CLPA 2HV5A 3G1RA 1EF3A 3CASA 2F38A 4GIEA 3CAQA 2DV0A 4RPQA 2PZNA 4XZIA 2PEVA 4JQ4A 1XGDA 3UZYA 3ONBA 2PDPA 4G5DA 1R38A 2FZ8A 1IEIA 1X96A 3RX3A 1LQAA 4AUBA 4XZHA 2PD9A 4LBSA 3MC5A 1YNQA 1AFSA 4QR6A 1AZ2A 4QBXA 4FAMA 3CAVA 3UZWA 4WGHA 3FX4A 4XZMX 2IPGA 2PDHA 4WDTA 3RX4A 2ACQA 4OTKA 3H7RA 1AH0A 4DBUA 4GCAA 3R6IA 2I16A 4YS1A 3UWEA 1LWIA 3M64A 2HE5A 2R24A 1Q5MA 1K8CA 1ADSA 1OG6A 4IGSA 3UZZA 1YNPA 3V36A 1AZ1A 3QKZA 4H8NA 4JIHA 3LZ3A 4F40A 5JH2A 2INEA 2A79A 3DN5A 4Q7BA 2C91A 4WRHA 4GQGA 5LIXX 4H7CA 4LB4A 4WEVX 2IS7A 2PFHA 2HVOA 2IPFA 2BGSA 2IKIA 3V35A 2PDWA 3R7MA 5HNUA 5KETA 1S2CA 1Z89A 1GVEA 3KRBA 1QRQA 4XZNX 2ISFA 2PDYA 2DUZA 2PDLA 2ACUA 2DUXA 3WG6A 3UYIA 2PF8A 1Z3NA 4EXBA 3FJNA 3WBYA 3M0IA 2INZA 4YU1A 2PDMA 5HA7A 4FALA 3EB4A 2P5NA 3MB9A 2PDGA 4R9OA 3U2CA 4DBWA 4JIIX 2ACSA 3M4HA 5DANA 2HVNA 4XO7A 5HNTA 1Z8AA 4L1WA 1HQTA 3LQGA 3S3GA 3BUVA 1M9HA 4JTAA 1S1PA 4I5XA 4GA8A
chains in the Genus database with same CATH superfamily
3TUUA 4O14A 4UOZA 2HBVA 1P6WA 3I6EA 3ICJA 3EDEA 2IKJA 1SW0A 2AKMA 2D2OA 1R9YA 3ARWA 3P8JA 1X6LA 2J74A 1P0BA 4DB7A 4X0NA 1XIMA 5A2CA 1J01A 4CGTA 4UFJA 1XG3A 1GTHA 4REQA 4IMEA 3WQ8A 1VRDA 4N02A 5F2LA 4GY1A 3MSGA 3T55A 2ZDRA 1A80A 4O0KA 3DC0A 2OJPA 4L4LA 3GHTA 4LUIA 1NTHA 1R7OA 2G0WA 1C7TA 5GVJA 4Q32A 1TPUA 1NDYA 4UQEA 3UJSA 4ADSA 2FZBA 3HF3A 4H9TA 3DYPA 1ZP3A 1YW1A 1I60A 2X7WA 4F66A 1NSJA 4GUHA 2ZXDA 5A8QA 4BKNA 4NL1A 1ZAHA 3PG9A 4CVWA 3S2MA 2Q09A 4GKLA 3O3RA 2DFAA 3WL1A 1RJPA 5DT5A 1OFAA 4V15A 3CYVA 1T0OA 3W2MA 4QG6A 4OFCA 3SJ3A 3WK3A 2WSYA 1PVNA 4Q4QA 1WBJA 3GUGA 4UFKA 1MNSA 1S5TA 3NQCA 1MZRA 1J2BA 3VD3A 2CXEA 1XSJA 5EMMA 1I0DA 1JPKA 4NQ1A 4Z2IA 1OK4A 1B3WA 2ZX6A 4DY1A 3CAWA 4C90A 4J1OA 2ESCA 3MHUA 3UG3A 3LSCA 3DC8A 3W9ZA 5LIKX 4OE7A 2GGHA 5FF7A 5BXRA 3OGVA 2OB3A 4GUFA 4WDWA 1G4SA 4XZLX 4PUWA 4LSBA 1M68A 1NF7A 1CPUA 2WNNA 2BOFX 4MOZA 1XBXA 3O6DA 2WMKA 9CGTA 4Q8WA 3SM0A 4QX4A 5CZJA 3PAJA 4WDUA 4F0LA 1H7XA 3VE7A 2NW0A 2INFA 3LY0A 1I2PA 1Q13A 1KKOA 1W1B1 1CW2A 1GVSA 5JBFA 3WX7A 3VDGA 2YDAA 3CIVA 1KM2A 3R12A 3W82A 5FEWA 5D30A 5DF0A 4FXJA 4DPPA 2O7QA 2NX3A 2CHRA 2XFRA 4GNVA 1OC5A 1TCDA 4DO5A 5A3HA 2E5BA 4S39A 1RPXA 1LF1A 1SJDA 2PBOA 3NJ3A 3NPXA 3LCFA 2QAPA 1M01A 4EP8C 1HGYA 1IGSA 1Z9AA 2VZVA 3AZRA 3RXZA 3TQKA 4YCPA 3UWUA 1V02A 1UD8A 4ZBCA 4CD6A 1RJQA 1MXDA 1Q6GA 1V93A 4RXFA 2V5LA 1C3FA 4C6DA 1TTQA 1XGEA 4O4VA 1TJ0A 2ZWYA 2DVXA 5A5WA 2ZZ1A 2G96A 3WN6A 2CCRA 2H9AA 3AISA 3CO4A 3FA5A 3GUWA 3VKJA 1W1YA 1TWDA 5DBTA 2YLAA 2JF7A 1VYSX 4M7TA 3BW2A 4C6JA 1GKRA 3GWQA 1E9LA 3TA6A 4NT0A 3VNYA 2J8GA 3S5NA 3CZLA 4WK9A 1ZLPA 1Z32X 3EPOA 3FGCB 3GM8A 2JGYA 1O6IA 1X1NA 2ZUTA 1ZBKA 2PWHA 4DXVA 4NKCA 5M3WA 3G22A 3DI0A 2V68A 1S5VA 4FXRA 1K9DA 5E70A 1JPMA 3J7HA 1R85A 3GG7A 5DCBA 1SMDA 1IIHA 3DKLA 1YKWA 1J2WA 1IWPA 1TV5A 4O0QA 4IX2A 2TODA 2L5HA 1VBGA 3RPDA 3BLEA 4V2XA 3CHFA 3CAKA 1VBRA 1UZ1A 1GK8A 1HF6A 5JXQA 1BG4A 1Y5XA 3CUXA 1X8FA 1MO0A 1YNQA 3TW9A 3AXIA 2FTYA 4ERIA 4ZXOA 3MHFA 3EWCA 5F4XA 4IMGA 5AHFA 4C6OA 3VIKA 3IPWA 5GNYA 2OG9A 1VLWA 1DEDA 3RX4A 3SO7A 1TREA 3P67A 4UIOA 5MKGA 3N34A 1FXPA 3TN5A 2A5HA 2A3EA 4I6KA 3RFAA 1RPKA 3MMUA 3VGGA 1XYFA 3AMLA 5BXPA 5CJ5A 4Y9OA 1V3IA 4HN8A 4LC8A 2XPKA 4B2DA 4IG2A 4N9CA 3UWWA 3TR2A 1R3YA 4A3YA 2Z26A 3SN4A 3PBMA 3WBEA 2W67A 1QTWA 2VGIA 4K3ZA 3URBA 3SN1A 3G1FA 4Z17A 4AD3A 3ZS4A 3NO1A 2C91A 5BRQA 3EX6A 3HQ1A 5T91A 3IRDA 1J5SA 2GPTA 3TAKA 3HPZA 4IH3A 4UFIA 2GQ9A 4I9MA 1WDRA 2BGSA 3FYYA 4GQQA 1KB3A 3R7MA 2QCNA 5AHLA 3E5PA 5KZMA 3W25A 5CC5A 1M04A 4CCDA 3M0ZA 2IUZA 3DU0A 3OZOA 4B5SA 2XGIA 3KLKA 3UR8A 1NIUA 3CH0A 4Y6GA 3PNZA 3WELA 3B9NA 4GJJA 2ZFAA 1CWYA 5F1VA 2BY0A 2PDGA 2W9MA 1VHNA 3SUWA 5A6AA 5D9PA 2GJNA 3G1YA 2PP0A 4C6PA 3KOZA 1UWSA 3G1XA 1R6WA 4PMXA 5HJXA 2J9XA 3M16A 1RXOB 2OYMA 4NXKA 1KQYA 4QDWA 3AIRA 3EXSA 4GA8A 4HK5A 4D6DA 4RNIA 1RSCA 3GDLA 1GYMA 2GVJA 2NQLA 2J47A 3F4VA 1OYCA 4ZCWA 5HMSA 1Y5VA 1GG0A 3MUCA 2ZX8A 5LIWX 5HBFA 4AVOA 2ZDSA 4AEEA 1HG3A 1CGXA 1TRIA 1SU5A 1RALA 4MKSA 4NZ1A 2HK1A 3S5ZA 1ZGDA 3W0KA 1J0IA 3M43A 5HULA 3CO8A 3CTLA 3GVGA 3AIWA 4B3ZA 1ME8A 1D8CA 3W7NA 1P0NA 2ZZ6A 4R27A 3ZLFA 2BGQA 3NCOA 4GNKB 4HMDA 4DZHA 1IXQA 3V5CA 1W9UA 1E0WA 3UY8A 3LD5A 3BV7A 3VNJA 3TYDA 4DX3A 4IISA 1B3XA 1JULA 3UWYA 4ZFCA 1PL9A 4YTUA 1SO4A 1L6YA 4JTHA 5HDRA 6TIMA 3V7PA 3VC5A 1BD0A 1XRSA 5KZEA 1VZWA 3W7DA 2VZOA 1V0LA 3QYQA 3RM8A 4XWUA 4QFUA 4GRSA 2QT3A 1XDMA 3RIKA 3PJTA 1US2A 3P82A 3TJ4A 3SSJA 1FRBA 4HCDA 3QR3A 3KS5A 4IM4A 2OQYA 5A6BA 5AVHA 4E38A 1UR0A 1LLOA 3CL8A 4AHPA 4MJ4A 1V0KA 2RAGA 3BTNA 4RK8A 1UWIA 4UTLA 3VNIA 3QKEA 1XC4A 2Z1SA 3NXFA 1DJGA 4AB4A 1HJSA 2EGZA 4ALDA 7TAAA 3LUTA 1JDCA 3NL6A 1PWLA 1JCLA 3PSVA 3VGFA 1VS1A 1TX2A 4NASA 3TX9A 3RHGA 3CHEA 2R1PA 3ISIX 5AVNA 2HDJA 3U48A 4OV9A 4PCFA 3NL5A 4JQ1A 4DBSA 2E09A 4GIRA 3UA4A 5LA1A 1GVQA 4Q8VA 7XIMA 2Y7FA 1QW9A 3BAJA 3MP5A 2R8WA 5LNSA 3QBUA 4PUEA 4EACA 5I3KA 3LPGA 3V0UA 3EWYA 4HP5A 1JAKA 1IR1A 2E25A 3MUY1 3VNMA 5K2ZA 3RM4A 3LGEA 4A3UA 3SFWA 1J10A 4LU0A 3T42A 3ABSA 1T8XA 2PU1A 2D69A 1I4NA 3WNNA 1WXYA 1Q4WA 4BEUA 3MP4A 2D73A 5AYBA 4DELA 2FGBA 4IF2A 2YXOA 3N2TA 2DSWA 2EJAA 1XR2A 2Y24A 3GHRA 2G41A 4RDVA 1RVGA 4Z1BA 1FWGC 5C54A 1U30A 5HOSA 1PIFA 3EWXA 4HZ7A 4YTRA 5DRCA 3DKJA 3DECA 3LLDA 3SGUA 2O9TA 2WJDA 4OKDA 4A8IA 3OW1A 3H22A 2WHMA 3I6TA 4A22A 4PL2A 1EF2A 3I6RA 2CLMA 2EKGA 1QCWA 4GI6A 5BOFA 4N2YA 4KEVA 3H24A 2GZXA 4C5ZA 5A6SA 3IUDA 2PDFA 3LHYA 4D6CA 2E9MA 1N8WA 1G5AA 5I78A 3G6LA 5CZTA 4JYFA 1TCMA 1IWBA 2WWDA 4KRTA 3M7SA 4Q4KA 3NDZA 5J5DA 2CLPA 3UJ2A 1E3XA 2AKZA 1DJNA 1S5MA 1W1A1 4HSHA 3M07A 1H11A 4H6EA 2F38A 3QH2A 5JIPA 2PA6A 3QY6A 4RPQA 1QI3A 3W3OA 2YBUA 4AG0A 4FNTA 4XZ9A 3SCTA 1TPB1 2AGKA 5AYZA 3NWRA 1TVPA 2W92A 4OGZA 1R3RA 1J4EA 2VGGA 1JAEA 3CPUA 4CQDA 4K8HA 4D2JA 4XD5A 3U4AA 1MZHA 5K7JA 4W5UA 2PGFA 5K9DA 1QATA 1AH0A 1LG2A 3G0XA 1TR1A 3EX1A 3FEQA 3VM5A 4IMCA 4ROPA 1TJPA 3DYOA 3IIPA 3GH5A 3CV2A 3EWUA 1VB9A 3S6OA 4MMWA 3LTPA 2F6XA 3R2GA 4MAZA 2Y63A 3R0DA 1B4EA 3N4AA 4QQUA 4LNYA 4PRWA 4KF1A 3EOUA 2ZRVA 3TC6A 1DHPA 2WZEA 4AW7A 3IUHA 5EFFA 3T0DA 2WSRA 4NP7A 4F2TA 1UKPA 3T07A 1HTIA 2R82A 1VYPX 4ZQMA 1GOOA 1V3HA 4WJXA 4QEHA 4O18A 3VKDA 2PDWA 1XSKA 5LNVA 1F3WA 5HANA 3KRBA 2PDYA 4JYEA 3ITCA 3WG6A 3P61A 1OQFA 3CL6A 3F5KA 3CMGA 4LVDA 2YCIX 3CK5A 2VVNA 3M0IA 3AXXA 2PDMA 3PZQA 4PBEA 3GYEA 1E1CB 1YLVA 4W4QA 2Z25A 5AY7A 1EHNA 3GH7A 2WMHA 3WFLA 3U2CA 3GG0A 2E9BA 5KTLA 5BZAA 4ACZA 2W62A 3NQGA 3C0LA 5J04A 2A7RA 4GZIA 1LROA 3NM3A 1M9HA 4AVNA 4AAJA 3M5YA 1R8LA 3VILA 2D3NA 4IG2B 4DLFA 3WLSA 4GXWA 2WLYA 1XV8A 5EMUA 5I6SA 3CPGA 4A8RA 4NU7A 3SY1A 4L6HA 3W7QA 3FYPA 1Q66A 1W91A 4GFSA 3KHJA 3LCLA 1E0TA 1OK6A 3E02A 3CTTA 2AQOA 5DMMA 3FW6A 4UZUA 4FMVA 4LTSA 4HVXA 2XWEA 4S1FA 1UD2A 1V77A 1K7FA 3OHMB 3PVFA 4FHAA 4IFKB 4GMEA 2QPXA 3TTEA 2XIOA 3NQ6A 1JL8A 3HU7A 5FJIA 5FJUA 3RK8A 1GZGA 4GJ1A 3ZXWA 3LHUA 3FXGA 4NJIA 1H7WA 1LUCB 4I8DA 2YL8A 4WJEA 3GXTA 5DRIA 4GISA 4C91A 5C7VA 2QIWA 4ZTYA 4C7DA 3T7VA 3WQDA 1E6NA 1YHTA 3CZKA 2B0MA 4E3TA 2TYSA 3BJFA 2NX9A 3SIMA 1VFLA 2OQHA 4GYFA 5G1TA 3V1HA 3RLVA 4LWWA 3D47A 5HR7A 1Q63A 2DUAA 3GX9A 2CLKA 2W61A 4EIVA 1B5TA 1FHVA 5LHEA 4DWSD 3EDKA 2BY2A 3OZYA 3WJWA 4ZO8A 2G95A 2XN1A 3PZVA 1W9VA 4AWUA 4GWEA 1OEPA 4O1CA 2ONEA 2ZTKA 1A3XA 3PZ9A 4HTBA 3WF2A 5K3VA 2JFEX 1VYRA 2HWGA 4MWAB 3O06A 4LX4A 5IFTA 4LGXA 2HISA 4NNAA 7PTDA 3KWXA 3TTSA 2XM1A 1GOKA 1SMAA 3ZOAA 5CC7A 3GC2A 2WJFA 4KW2A 3W29A 4IQLA 3BANA 3LI1A 4GINA 4JFTA 4BFAA 2D20A 4LC6A 1E70M 1E6XM 1QNRA 2GDUA 1SW7A 3NXLA 2WNZA 2MANA 1X97A 4W89A 2YCLA 1R3TA 4JX5A 3QPEA 4GI9A 3VIOA 3GIYA 3PZGA 1YMYA 3WQ5A 1DL3A 1J0HA 6REQA 2DZWA 4AFYA 1E5JA 2WK2A 5IBXC 1A5BA 4V27A 4CD7A 1J96A 2WSKA 2FZDA 1ZS2A 4X9YA 3NQDA 3WQEA 5IDIA 4IOTA 2NLIA 1OYAA 1XBYA 2VGBA 1UR1A 4B5XA 3W37A 1FWIC 4GY0A 1EJWC 1PIGA 2WNQA 3SCQA 1A0CA 1RD5A 5EMJA 4JX6A 3S1WA 3W7CA 5M1TA 3VO0A 1JXJA 4PH6A 1UR3M 4XD4A 1UMLA 4GE8A 5E93A 2X40A 4FOUA 3TV8A 3HGOA 2VFDA 3RILA 4AWTA 4B91A 1EJXC 4IMAA 4I8YA 1OGGA 1E6QM 1QHPA 2VX6A 1LOSA 6TAAA 1V6TA 3HGRA 2DW7A 3WMCA 4Q4PA 4WKHA 3APTA 3OLIA 4ZR8A 1Q65A 5DCDA 4KEUA 4IUGA 2Q8LA 1DHKA 3T8QA 4P8UA 3MDUA 3G1RA 3URQA 4DJFC 2ADAA 4NXSA 2Z1VA 1QPQA 4GIEA 4QSHA 1KGUA 3CAQA 1FX6A 5EYWA 3KDNA 2W5FA 3B8WA 4PBFA 3AS1A 3SN0A 4PEKA 3SR7A 1XKYA 1M5WA 2WM1A 4YYFA 2NXHA 1OCJA 4Y9AA 2CLOA 3H26A 1XLGA 1AFSA 7ENLA 3AYSA 4O1EA 3UZWA 4XZMX 3SEPA 4C6IA 1IT0A 1DTNA 2VRKA 2Z29A 1PDYA 4RZ4A 1C8VA 7TIMA 3H7RA 4NJGA 2NT1A 2NQZA 1OX6A 4HJWA 5F2MA 1S2WA 4QE4A 3WF3A 4B2DD 1WZLA 3SCRA 4JX4A 4PA8A 4KBXA 3RGTA 4K38A 3KZSA 4U10A 4UMBA 3LGDA 1A4LA 3CHDA 1QI5A 3BVJA 1JVNA 3F4NA 3BLIA 4IFRA 3E2VA 1GEQA 2OZTA 1H7OA 4CNSA 4V1YA 3MUIA 2YYTA 1H0IA 2FGZA 4H7CA 2PGRA 4LB4A 4G7EA 4KPLA 1CGWA 1LORA 4QISA 1LCOA 1UD4A 5F2GA 4B16A 1QNQA 1TE6A 3UNDA 5I79A 4TTGA 3TMLA 1RP8A 1ISXA 2BXZA 2PWVA 2Q6ZA 3RU6A 1BTCA 2YR1A 3AC0A 5G4EA 2Z00A 4GO9A 3CWNA 2ZICA 2CWNA 1Z3NA 4EANA 2ZX9A 4F0KA 4NF7A 4V28A 1NARA 4AD2A 4UC5A 4LFYA 3PANA 1UWAA 4O1AA 1TV7A 3B8IA 1FP8A 1M6JA 5BOEA 3BE7A 4MDPA 2OODA 4X60A 4C1NA 4QDPA 1ONXA 5EMKA 3UR7A 3M4HA 4KERA 4AZ7A 4QROA 2C0AA 3QV8A 4WZHA 3PUDA 4LUTA 5ECVA 1HJWA 2DSKA 3UPBA 2FHBA 3L2MA 3T81A 1BTMA 1EXPA 3EEGA 3K1GA 2B7QA 1XLAA 3A4JA 1HFBA 4LW7A 1VFSA 2ZC1A 3U5UA 2QCHA 1GQNA 4AWSA 3GVRA 4JHOA 4PTDA 3H7UA 3GVWA 3S5OA 4AY1A 3FJLA 3UG4A 3EB3A 1SFLA 1WDWA 4LS1A 1MMFA 1EJRC 2VEFA 4GIYA 3Q4DA 4ZXLA 1OBAA 1G1YA 1ZSXA 3O2LA 3C56A 2YL9A 1PYFA 1B1YA 1B3OA 1LG1A 2XYLA 3WLJA 2NUXA 3MMTA 5HAOA 1S5WA 1XLEA 2B4GA 3NZQA 4AXKA 3TTOA 2QJMA 1XUUA 1A0DA 2PBGA 1XRFA 2ZUMA 4DZAA 3WJSA 4GQ0A 3QR1A 4X0VA 4FNSA 2R9RA 3W73A 1QK0A 3M0XA 1ZL1A 4J3SA 4R7JA 4GQBA 4ZL1A 3EX3A 1Q7QA 2V2HA 1QI0A 3VAVA 2BXYA 3VD9A 1RJRA 3GNDA 4H8VA 3I4EA 3GVVA 5J5RA 1O5XA 4E8GA 3H23A 4LB3A 4B3KA 2J7EA 4AZCB 2ABAA 1F6KA 5GQBA 2ISDA 4JQ3A 2OX1A 1HXJA 1M53A 3LB0A 1GQIA 5FKYA 2FZMA 2BVDA 4JQ2A 1TWIA 2ANUA 1EGZA 3AROA 1TX0A 4OZOA 1Q6FA 4LALA 1KGWA 4XKYB 5C0QA 3UWQA 3IK4A 3MO4A 1EDGA 1I2QA 3VC6A 4M1RA 4DUVA 3A9IA 2CKSA 5CLWA 2HEJA 1HIZA 2EXOA 3F4DA 2PUZA 4JFUA 4N0RA 4ICMA 2YDQA 3LTSA 2EF9A 3HMJG 1TMQA 3C2EA 3BLDA 3R43A 2DP3A 1IQ8A 1OGSA 2FHCA 3KBSA 4RV3A 2EAWA 1CCWB 1OM0A 4LH8A 1XLCA 3O6AA 4GUJA 2YCLB 1XCXA 4HNUA 3R8HA 2VDIA 2XWDA 3CV1A 1GT8A 3TMQA 1BGAA 3EMCA 2ISVA 5AC7A 2J9ZA 1MEWA 3VDCA 3DFTA 3S47A 3RF9A 4PFMA 4MTVA 4B5NA 3OVQA 1KLZA 1W3IA 4AD4A 3VGDA 3GXIA 1JF6A 3P84A 1H63A 1XINA 3IJ9A 3L4UA 3W71A 1GOIA 4ERAA 4NZ4A 1D2KA 1Z6KA 1G01A 1HJXA 3N6JA 4MY8A 2PWDA 3M0MA 3N19B 3QQ1A 4UFLA 1UCWA 1QU4A 1W5NA 5LNUA 2DT0A 1DJQA 4PMYA 4PULA 3WD3A 1WKDA 1ML1A 3AU6A 2C6QA 2C3ZA 2XN0A 1QFEA 3LXAA 3WLRA 4GYJA 5LIYX 4N4QA 2J79A 3AHZA 4A05A 5E0KA 1SW3A 4HU8A 3RUBL 1TA3B 2EPMX 2PWGA 1AW1A 2Z2UA 1XIEA 4AD5A 5I24A 4ZQNA 1SM9A 3WBXA 3HQOA 1HKIA 4R33A 3KHDA 4PMDA 2XVLA 5A2BA 4UQDA 2BV9A 5EA9A 4OQVA 3BV4A 3TXZA 4J35A 3GTHA 2PZNA 1W37A 5G1MA 4DIAA 1JJKA 3IV8A 4ZQCA 4HNOA 2Z1WA 4CEXC 2WLZA 3VOFA 5CSRA 7A3HA 2Q01A 3TNBA 3D46A 5HMEA 4LUSB 1NM9A 4MY1A 1C91A 1G0CA 1A50A 2VXNA 5DFAA 1E4IA 3FX4A 5HWMA 2BHYA 2VEGA 2OYLA 4XKYA 4PCPA 4WDTA 4DNMA 3G1SA 2CLHA 2P53A 3G8EA 1F7BA 4GLEA 4Q4MA 3BK0A 1UZ4A 4DBUA 3HGSA 4GCAA 1PTDA 5HJLA 2YLLA 3BZJA 3TW7A 4B4HA 2R91A 2QUVA 1XIGA 1FKXA 5CKSA 1O66A 3KFTA 5FL1A 1OFQA 1WZAA 1GVRA 1A5CA 4ADTA 1R87A 4WX2A 4U33A 4BR1A 1IGWA 4KGJA 5AYYA 5EMYA 3AMKA 3TNOA 2HNEA 4TV5A 1V02E 1ELSA 1V08A 2V69A 5I3JA 4JCLA 3CYJA 2KAUC 2FLIA 2CESA 2HVOA 1K4HA 3QMRA 2E9LA 4W84A 5HNUA 5KETA 1E9YB 3TCEA 1NDVA 4IUOA 3GNOA 3TTYA 5AC5A 1CXKA 4NJJA 1M3UA 2PODA 4I6VA 5I0DA 5REQA 3PAOA 3O9NA 4DQWA 4XQ6A 1NAL1 2P0OA 2RH9A 3WBYA 1Z48A 1W1ZA 3WQWA 4LBUA 4H8HA 4H9MA 1UZDA 4PGLA 3GXDA 4I5RA 4AU0A 2VL4A 2WBGA 2VX7A 4PMQA 3MYOA 2EPNA 1UD3A 3QOKA 1BXNA 2HVNA 3MSDA 3ITTA 3NDOA 1JYXA 5A69A 3DZ1A 4H1ZA 1V8EA 3AIUA 3S9ZA 2OOGA 4JFSA 2Z2BA 3S3GA 5HJYA 1KV5A 1C8YA 1W17A 5IHRA 3L2IA 1TVLA 3BMWA 2C71A 2QJIA 3WEOA 1M65A 3TXVA 1KO0A 1HKJA 3WNPA 3I7RA 4O12A 5HPCA 1SFTA 4YHGA 4JZ5A 3SCPA 5CZ0A 3WDRA 3GAYA 2GOKA 4R5EA 2X1UA 5C7HA 2HRWA 4MF4A 4ML9A 2IKGA 3OBKA 1AG1O 1I6NA 5E0FA 1EIBA 2V3EA 1B3ZA 1PZ3A 3POHA 3A9BA 3S46A 4F4RA 3CUJA 4YLWA 3SZ8A 5M2FX 2QGYA 4AZBA 3AUOA 4IJRA 4NRRA 1VP5A 3H54A 1LBLA 1PO9A 4MKVA 1W3LA 3A3XA 1B3YA 3LHTA 3TVAA 1E6PA 4L6DA 5JU6A 4QP0A 1KBKA 2BY1A 3F1QA 3Q37A 1ME9A 3SCNA 3BAXA 4P61A 4GABA 1FHLA 3MANA 1KXHA 3TYAA 2QPUA 1L6GA 4LPCA 1GTEA 3EOLA 1O60A 4Q8PA 1KBLA 3WCZA 4OBRA 3LNMA 3CZGA 4ROQA 3O1NA 3OA5A 8A3HA 4JTEA 3N12A 2D2HA 3RRXA 4W93A 3BARA 3VABA 1TWZA 3PB0A 2V5CA 2CIPA 3AMCA 7CGTA 2F8QA 2Y70A 1UHVA 4H6KA 1WKYA 4ZSTA 4GUGA 4NJHA 1DJXA 1QO2A 4BF9A 2SFPA 3W74A 3CZ8A 3ZLHA 5G2WA 1EZ2A 3NOYA 2VR2A 4Y96A 3VUSA 1SO5A 2G3MA 2PDIA 3DGBA 4EF9A 5D04C 4PTMA 3LEPA 3DYMA 1R47A 1SZRA 2CPUA 4V33A 1GORA 2JEPA 3LSBA 3WBWA 1QWKA 4LXFA 3RM9A 3GTNA 1SJAA 3BXWA 1HW6A 4NG3A 3ARQA 3NGFA 3UVAA 2X16A 2AMGA 3OEXA 4DI8A 3KOXA 4FB7A 1R86A 1ZUAX 3UJFA 4Y9NA 2QUMA 1VCFA 4E2DA 2QJGA 1ZY9A 2VVSA 1H41A 1B30A 4RUBA 4Q33A 3GW3A 4S38A 1O1HA 3STPA 3R79A 5A8GA 2PWUA 3LPPA 4X63A 3FGCA 3TYBA 1KM0A 5HMDA 2CWXA 3PF3A 4ZOAA 1XLFA 4Q7IA 1E4MM 2ZXQA 1RA0A 3ENLA 3OG3A 4QLLA 4XB3A 4MNJA 1E71M 4IWWA 1JRCA 3W26A 4FF7A 1WKFA 3UCDA 4XSLA 4QE5A 1CDGA 2ZRUA 7ODCA 1C93A 4M3PA 1UKQA 4Q3MA 3DFYA 3M0HA 4HNNA 1P43A 1UB3A 3S83A 1S5NA 4QTGA 3QV7A 3HO8A 4QRNA 1VJSA 3R13A 3SURA 3IVTA 5FJPA 4FLSA 3ALGA 2Q8ZA 2QEZA 3CUHA 5FSEC 1XRVA 1VEMA 3M47A 2TRSA 3D6NA 4BEQA 1QK2A 2VELA 3E5BA 3UYCA 4OT7A 2P50A 4YNGA 3EDDA 4BY3A 4AMCA 3V4BA 1D3HA 1G7VA 1YDOA 1PCWA 4A3QA 3PPGA 5FAJA 5BMXA 4PE8A 3AIQA 3QSTA 4UWMA 4FNQA 3H4XA 1IE7C 3WZ0E 4BI6A 2DPEA 4C1KA 4JQ4A 3TLLA 3L4XA 3LX9A 1ALDA 4JKLA 4FLRA 1IEIA 3RX3A 3KVLA 3WQFA 2QS8A 4HCLA 4P5UA 1UWTA 2I9EA 4XD3A 1ZTVA 3W6LA 1KXTA 5HMFA 1X38A 3KTXA 2GWGA 2WM0A 2FJKA 4BK9A 4G56A 4R34A 3NEHA 3LCXA 2I16A 1HKVA 1NFGA 2IQTA 1DE6A 1WO2A 3MO7A 3EX2A 1DORA 3M64A 1QWGA 3VOHA 2PE4A 2J88A 1JZ8A 1DWAM 2A7NA 3C2VA 3ITLA 3HBLA 4AZIA 5CJMA 3CEUA 3TJLA 2QCLA 3G24A 2Y5EA 4XG1A 4I7UA 3L65A 1PIIA 2I7GA 5A1AA 2XFWA 3S6TA 4ZO7A 1C7SA 3N17A 1LL7A 1J0YA 2ZXBA 4F2UA 1O94A 2B81A 4LUYA 2CFFA 3N9SA 1TIMA 2B7NA 4K6AA 2FMOA 3RCYA 4K39A 3URAA 4IICA 3LCIA 3OYZA 1TQJA 1CZ1A 5L9FA 2NT0A 2DW6A 3DFSA 4GXPA 3AMDA 1WDQA 2Y6ZA 4AIUA 5HQEA 3GR4A 5D2XA 3FVMA 1Q3NA 4JIPA 3W1MA 4TVUA 3SCOA 4IMFA 3GTFA 4PUMA 3PFRA 4A8LA 4IIHA 2VGFA 3RLGA 3PP7A 4PFHA 1DIDA 2F2HA 4RKAA 2YOCA 2E6FA 3QMTA 3L4YA 3W1QA 3MPGA 4IFOA 3G6MA 3W87A 1KFBA 1YBQA 2BWGA 3VNKA 2BG5A 3ZVIA 3UPMA 2HCVA 4LEFA 1PZ2A 1UA3A 2F6KA 4ZENA 2BX7A 3CIWA 3AS3A 2VYOA 2DZAA 2V3DA 3LRLA 1D8WA 2XG9A 3BLOA 3I65A 4Q6JA 3JS3A 4ZTXA 1LOQA 2WHJA 1JFXA 2C1HA 4RZBA 4RLIA 4LBRA 5A6JA 4KWOA 4AWEA 1M7PA 1CNVA 3LV6A 1OVDA 1UMYA 1IF2A 4IIBA 2E4TA 3QV6A 2WMIB 2ICSA 5CAHA 1N55A 1IHIA 2Y85A 2DZXA 4AEFA 3UESA 1PJ9A 2Z7GA 1P1XA 2GVGA 2WQPA 4OUEA 5DELA 1T40A 3NL3A 1ITUA 4WLCA 3VU2A 2VZTA 3PWGA 3RO8A 3FOKA 2VI0A 4C6BA 1OC6A 2HE8A 3V3WA 4J3WA 3PPCA 1T99A 5HK4A 1U5VA 4UR9A 3PZTA 3NR0A 1W31A 2QMKA 2DZPA 2CBVA 5FF2A 4F9JA 4C6QA 3NTYA 3FN9A 2VWTA 3WLMA 1EC9A 4GQRA 1A5AA 5LA2A 3V0TA 1CLVA 2GJXA 3R58A 1BEUA 4KIEA 1LDCA 3DENA 2RDWA 4A2SA 1GYNA 1G4PA 3MVIA 1KFEA 5CPMA 4NNCA 1BQGA 4QJ1A 5E6ZA 3W22A 3F2CA 3MYPA 2GJRA 3VIFA 5FCZA 4DZIA 5CPNA 1VHCA 1Y8BA 4S3DA 1UR8A 1A47A 2RJGA 3APGA 3NQBA 2P3ZA 4JKMA 3ZWSA 5AYXA 3UWZA 5EKYA 3W7OA 1HP5A 3Q94A 1EOMA 4I9JA 1KM6A 2DT2A 1X6UA 3GFZA 3W76A 4Q8OA 1OX4B 3NZ1A 2DIJA 2HZGA 2VC7A 3PB2A 1CB7B 4M82A 3SUSA 1TSIA 2Z1KA 1JPDX 3FYOA 4XUYA 4O52A 5TNVA 2X0SA 2G37A 4GUIA 4D8ZA 2JEQA 4LAOA 3QY7A 2J8TA 5I7GA 1XD1A 4DJDA 5I3IA 2YBTA 3U2ZA 1FWFC 4UCGA 3B04A 1QJWA 1R3SA 5DXXA 3AI0A 1AH3A 1HL9A 4WKAA 1F76A 1LWJA 4YMZA 1FY6A 2IPWA 3ZSTA 2VCCA 1G4TA 3CHVA 3WDJA 4DJDD 3NQFA 4MLRA 4XKMA 2GYIA 3UG5A 1MI3A 3PFMA 4L80A 1VR6A 2VT0A 4MWAD 1MW3A 5C9WA 2NVDA 5DO8A 5HATA 1QUMA 2BOEX 3VKBA 5D38A 2GSEA 4KCWA 4H9UA 1A3HA 4XUGA 4KRUA 1L8NA 1ZAJA 4ZODA 4LAKA 1YE6A 1Q8AA 3EDJA 3GRIA 4S3JA 3PTKA 4OIFA 1HP4A 3DFOA 1IIGA 3I3BA 2WCAA 1CXFA 3JR2A 3EZ4A 3L5AA 1MQQA 4LOCA 4NAEA 4H9YA 2NXIA 4KFPA 4N9EA 3VFLA 3HQNA 3ITVA 4U4MA 1RP9A 1AVAA 3QLDA 3UZXA 2VDHA 3Q45A 3N3TA 3H2CA 5LNRA 1XP3A 3VTRA 4GK8A 1P4CA 3EKLA 3PNUA 2XZ7A 3QZ6A 3SAZA 1CGVA 1PXGA 2Y5JA 1CXEA 3H2OA 4AF0A 3DFPA 2E5CA 2Z6IA 3FDKA 4PMJA 3WD0A 4TOQA 2GL5A 3BAKA 3W75A 3TEVA 2O9RA 1EF3A 4O8RA 3C8NA 4ENLA 2NQJA 4I3GA 1EJUC 3REQB 3MMWA 3H2EA 3S1GA 5C9ZA 3FHQA 3I3EA 1W9PA 3W7PA 5E6YA 4C6CA 3E38A 4QAIA 2PD9A 1KV8A 5K9CA 3EKZA 4QR6A 4DF1A 4JEJA 4M51A 1K4GA 5I3DA 1C9DA 3UVIA 1OIFA 1O1ZA 3UQNA 1QT1A 2XIMA 3MV01 4JIQA 3HFYA 1U1JA 5BRPA 3RAOA 3W1RA 1ICSA 3GU1A 3WK2A 2HE5A 4B3LA 5ABEA 3CB3A 2C79A 2FYMA 3W4RA 2CZFA 4HHPA 3P80A 4AIOA 1ADSA 3W81A 4M8UA 3F5LA 3W88A 2XTKA 3WNOA 1EBHA 4WXZA 3NO5A 2V9DA 3JW7A 1CX9A 1ICPA 1ZNNA 3SY8A 2IW0A 3QOMA 4POCA 1LYXA 1EPVA 4JIHA 4LRSA 3WFZA 2INEA 1E0VA 1NH6A 3A47A 3QXBA 4TMCA 3EYPA 1B3VA 5AYIA 4ZEPA 2BDQA 2GJLA 4RCXA 4WEVX 2C8NA 4KWSA 3MT1A 4GKTA 4HNLA 2DZTA 5FJOA 4D9PA 3KP1A 3KAOA 7REQA 2FDSA 4LUTB 3UBPC 3U4FA 1ZJBA 2P10A 4A6GA 4WUIA 2PF8A 1CIUA 4ZSUA 1ECEA 1KNWA 3M9YA 2XISA 3FJNA 3QHOA 2C7FA 4YU1A 4GGBA 1KW1A 2A3CA 1XISA 3K8KA 3CUIA 1NVMA 1QNSA 2QF7A 3P7YA 3ARSA 5D05A 1U5JA 1Q6RA 4M0XA 4JNMA 4L65A 1J12A 3CU2A 5AECA 2FVKA 1XYMA 3AHYA 5AC4A 1UR9A 3QV9A 3T6CA 2J25A 4ZVJA 1BGGA 4WF7A 3EPMA 3PY2A 1R46A 4Y9MA 2YJQA 3KTCA 3TZFA 1MXGA 2FGLA 3GSMA 1B9ZA 3E0WA 1W8SA 2J62A 1KM3A 4OUIA 1OZMA 3N18A 2D2GA 2PDQA 4GACA 3OO2A 3AQUA 3SY5A 2OZ8A 1SGJA 1JZ3A 4JIEA 4GI8A 4HHMA 5FL0A 3JZUA 2QJHA 1WDDA 3LERA 4GX9A 4K7VA 2Q3RA 4M81A 4QNWA 4HTYA 4QJ5B 1SPQA 1RCXB 1GOWA 3LU2A 4TX9A 4IGMA 2A3AA 2JF6A 3KOFA 3L9CA 1L6SA 1H7NA 2OTDA 1JPHA 1WA3A 3PUOA 4DBEA 1EUNA 2EO7A 3CC1A 1MQRA 4RW3A 1BRLA 2NVCA 3CZJA 2R14A 1ZRQA 3N2OA 3VA8A 1CENA 2WW5A 1XQLA 4QCFA 4KCUA 4YN5A 5A6BD 1V6VA 1VKFA 3PR2A 5AHNA 5IM51 4B4FA 4M19A 3SADA 1ODUA 1VH7A 2QCFA 4EKJA 2BNJA 5H2ZA 3W83A 3IS4A 1G94A 2PP1A 1KRMA 1M41A 1W5MA 4BS0A 3W27A 1LRTA 2CNCA 1H61A 3M41A 2CLFA 5AZ0A 2WSPA 3SUTA 4BF5A 3NGJA 1JRBA 1I1XA 3WUBA 4NYYA 2ZUWA 5A6MA 2VR5A 1H5VA 3BCJA 1XBVA 3AHXA 4EXQA 4UCFA 5A2AA 1A0EA 3H2AA 4ONVA 3TJXA 4GJIA 1E6RA 3NIYA 2J7FA 4XIAA 5REQB 1QOXA 4MY9A 3DI1A 5BXSA 3V0SA 3ITXA 1V3LA 1MEHA 3U7BA 2PU0A 1UP2A 5D9OA 2HXTA 4N7QA 5EPDA 1ITXA 3T0AA 3URNA 4IJBA 2Y5SA 4MPKA 1RUSA 4JFVA 1V7YA 4JIRA 1O5QA 3L66A 3ZT6A 4RDWA 3R8GA 4DXXA 2BLEA 4E8DA 1XXXA 2QYGA 5H1WA 1MUMA 2QR6A 3L2LA 5TIMA 1AH4A 1RBAA 2ZUUA 1L8PA 4UZSA 4D71A 3PM6A 1NWRA 2C0HA 1SZNA 3ABQA 3O05A 5H91A 2XGZA 2JIWA 4YVPA 3OLGA 3GU2A 2W66A 1QPRA 2XVPA 1YADA 1NOFA 2ZZ7A 4EXAA 1HL2A 1FUYA 3TDFA 2C14A 3YPIA 2PURA 4GPNA 5AB3A 4F0SA 4HYWA 3THDA 3HG5A 2XDFA 3KRZA 1V6XA 1K7EA 4PTNA 1GGOA 2VM8A 1S1RA 3EXRA 4QLJA 4ILSA 5I00A 4RNJA 3MTWA 4NI8A 2AL2A 2FTWA 1Q4NX 1LTDA 2NSOA 4DJFA 4DPQA 3NFUA 1VIZA 2QULA 1JQVA 3F03K 1MVYA 3UCQA 4JD4A 4C6NA 4B15A 2WCSA 1AODA 4AVFA 4LUSA 4FNPA 4OOZA 1H7PA 4ZO9A 1GZJA 3OPSA 3ZJ7A 3LRKA 5D9NA 2CBJA 2WMIA 4O13A 2KZHA 1OFRA 3U8GA 1NEYA 4FLQA 1I2RA 4HOWA 2EG7A 2E67A 2V0TA 3ARRA 4LV4A 3S9YA 2FZNA 1E1FA 4MZ1A 3SFKA 3A4XA 1J79A 4B90A 4F0RA 3MKVA 5C71A 4KWUA 4DN1A 2ZRZA 1KBIA 2FZ8A 5DBUA 2FFIA 1PB0A 4HZ8A 4PCTA 4Z0SA 4CD8A 2RJHA 2J7CA 1JZ4A 2E1DA 2W4XA 4WGHA 1WPCA 5HNRA 3OU8A 1DIEA 1CI1A 4JHZA 3UXDA 3WENA 5DMNA 3NQAA 1BF2A 3E1F1 3MDWA 2HVMA 2Y88A 1UBPC 2WC3A 1TTJA 4YS1A 1K8YA 1GHSA 2NQHA 1I8JA 1S3HA 1EDQA 5AOUA 8XIAA 3CB8A 1MW2A 1MFVA 3LMZA 1KGXA 2DZSA 2EEXA 2EQDA 3SQMA 2ZRYA 1QI4A 1VC4A 1AJ0A 3TE9A 1FVPA 4PCSA 4W5ZA 3D0CA 1NWTA 2XVGA 1ONWA 4HYRA 1BVZA 2I9UA 5IXEA 2D3LA 4WRHA 1NQKA 2Y7EA 1EQCA 1IZCA 3GTXA 4S3EA 4R88A 3K5XA 4I5UA 5JUVA 4IP5A 4X22A 2YZ5A 2VFIA 4RE2A 1JI2A 2YDRA 1ZJIA 5DQPA 4XZNX 2WNWA 4WSJA 1NP2A 2DUXA 4JTUA 3E2QA 2PC4A 2VP8A 3LBCA 3TJIA 3WQCA 4HMEA 4LF2A 3VKKA 4GYKA 2BBFA 1VEOA 3LHVA 1JNDA 1ME7A 1ECQA 3NQEA 4H19A 4UTHA 2YL6A 3KS6A 2E5DA 2ZIDA 4Y8FA 3HJEA 3BLFA 4H04A 4M6VA 3EOSA 4DBDA 1PDZA 1JUEA 4R9OA 4O1DA 4Q8NA 4DBWA 1DWFM 1XIFA 2ACSA 3KXQA 3STGA 1XIHA 5HNTA 2V3GA 4IZGA 3ZT7A 3BUVA 2FIQA 1UH2A 5HXMA 1TA3A 4DO7A 3M6DA 5LSMA 3A12A 1JCJA 3NG3A 1XFCA 3UNTA 1BYCA 2ZUVA 1VFUA 3HG3A 5XINA 3QM3A 5D33A 5CSUA 3CWOX 4JTDA 4XAPA 1XCWA 3S1UA 1D7FA 1KRBC 2A4AA 4JS3A 4GOAA 4DO6A 1F3EA 4IT1A 2ATMA 5U4NA 2BODX 3IJ7A 3ABXA 2O0TA 4L64A 1EA9C 4P8VA 3T9PA 3B97A 3VKAA 1D9EA 4FXFA 2QHAA 3AYVA 4HPNA 1IWAA 1W1TA 4H9ZA 1F4AA 1AQMA 3DFNA 3O15A 2PTWA 5T9BG 3S0CA 3LHWA 4NI3A 2X41A 2E77A 3EOOA 4HA0A 1PUDA 1MW1A 2ZA2A 5SWUA 1XYAA 5HR6A 3PZNA 4CCEA 1EPXA 4PSPA 2WVVA 1XG4A 2WVUA 3VUPA 2J77A 3WDHA 4WGXA 1V0MA 4CQ9A 1SJBA 3PBYA 5LIUX 3EXTA 5I3HA 1V6WA 3WDIA 4ZE5A 1F73A 1ZQ5A 3LK6A 1FFQA 1R7AA 2JKAA 2CKRA 1T41A 2QCDA 4AY7A 3DH7A 4K36A 3AJ7A 4L9ZA 1PZ0A 3F4WA 2H6RA 5K9XA 4BCEA 3PG8A 4CVUA 2VO5A 4TQTA 1A5SA 2NLYA 2Z6JA 3BGAA 3CV7A 4IP4A 1PKYA 2UZ9A 3B03A 3BOFA 3HG4A 3F2BA 4CEUC 3CHCA 3CZEA 1V3KA 4UOJA 1R2TA 4K7YA 1W3JA 3N9RA 1RVKA 4FZIA 1EL3A 2J24A 2E6DA 2OEMA 4PBGA 1LUCA 4OOUA 3KX6A 1PX3A 4XTDA 2DJLA 3LCHA 2JQXA 1P6CA 2R1LA 3SSZA 4IP7A 1P7TB 3N6HA 2YFOA 3NQVA 1HJQA 4MDOA 3GXMA 2XH2A 2QPSA 4CQBA 3NQMA 4LY4A 3IIXA 3E0LA 4D72A 2WC4A 4UTTA 2IKHA 2WOQA 3GD6A 1F3TA 5I3FA 1NP0A 5EL1A 5EB8A 1W3KA 2XJ7A 3SGZA 4TX6A 1WYIA 1DQXA 1VD6A 4TIMA 4H6QA 4BA0A 1OIMA 1Z7AA 3BQ5A 3TW6A 1ITCA 1JDAA 4N42A 1FOBA 1H50A 4US5D 4ACYA 4OWGA 3W53A 4CU7A 4PR4A 4JTCA 3OZPA 3C2FA 4TXEA 4HNCA 3TYCA 4F2BA 5AKQA 1NDZA 4JQAA 1JCNA 4C1NB 1MUWA 1YNYA 3GDTA 2DZBA 3ABRA 3KL3A 1Q2SA 3RG6A 4JTQA 1MXSA 2DJXA 4E4PA 2WKLA 1BWVA 1MUCA 1ZP4A 1JXKA 2UY2A 4GXMA 4CD5A 4LVFA 4RX0A 4CN4A 4LCRA 2JALA 4HJFA 2D0GA 2Z2AA 4WHBA 4RPPA 5G2HA 3ZM8A 2Z27A 3L12A 3UEQA 3NSMA 4GIAA 2DH2A 3VM7A 4AYGA 1RD6A 3WY1A 4CU6A 2Z1XA 4E0CA 4W87A 3UZYA 5CG0A 3W7RA 3GG1A 4QLKA 4LBSA 3G1DA 1AD4A 2DSZA 9XIAA 3FA3A 3T05A 3OLEA 6CGTA 2VOMA 2OFJA 4ZE4A 2J4GA 1YRRA 1K6AA 1V03A 2RGLA 5LXEA 4IMDA 3WDPP 3U3HA 3L4WA 2PDHA 3QF0A 4JNYA 1VFFA 4LRTA 2H8ZA 5F7UA 4DJEA 5CCZA 4A3HA 1UQYA 2VFHA 2X1SA 3E96A 5KINA 4LAMA 3P3BA 1FWSA 1J18A 1DBTA 2DSUA 1VEPA 1GHRA 3FFSA 2NSXA 4PUKA 1JDFA 5K4XA 1VF8A 1H2JA 2O9OA 2JK2A 5AHEA 4J7RA 2HBXA 3LZ3A 4CQ8A 1Q7MA 4J3ZA 4K37A 3W7LA 2PSNA 3VX0A 4P7NA 1SFJA 3K8MA 3M6YA 2IS7A 2WVVB 3G77A 1DPMA 1XWYA 2PPGA 4AD0A 2NQ9A 3GXFA 5FF3A 3HPXA 4EOUA 2CHNA 3HM7A 1VPYA 1QASA 1H3GA 4ZQRA 2QAFA 5D4YA 3GDBA 1QVBA 3C5QA 3OIHA 2CBIA 3PZMA 4W8AA 1J0JA 1KM5A 1TO3A 2BY3A 4NZFA 1LZOA 1ZALA 3GK0A 3S2CA 5DCEA 4EAYA 3MZ2A 4S3KA 1PPIA 3W7JA 2CW6A 5A8MA 1OADA 2EPKX 4DWDA 4PMOA 2NWRA 1OX5A 3LBMA 3BJTA 4JNZA 4FOJA 4NIRA 1KLYA 2RDUA 4HZMA 1NQ6A 1R0MA 1XIJA 5AN7A 1W3NA 1H09A 3GNNA 3GW0A 2CXGA 3W7KA 4ASTA 4TUFA 3ELFA 2BSLA 1EEPA 5T9CE 2E6YA 4HD5A 1W54A 3P0WA 4AC1X 1OG0A 3GKAA 3N25A 3LM7A 3SECA 4ZOEA 3VOJA 3DFHA 2GJXB 2QF8A 3CPRA 1MDLA 4C7FA 1XYBA 4MB3A 2QCMA 4NJKA 1MNZA 4PB4A 4CNUA 3UJEA 1AQFA 3VNZA 3VKCA 1V5XA 3MS8A 3F5JA 4IIGA 5CBJA 2X0YA 1HUVA 4JTFA 4F0MA 3IJDA 5A6LA 1GG1A 1L0PA 4DWSB 2ISWA 5DT7A 4ES4A 5C55A 3CEPA 1LWHA 1KQZA 1K70A 1VPXA 3LZ5A 1DTUA 2J7HA 1WQ5A 4PSRA 2YA1A 4RV8A 2Z1BA 1XIIA 3P5ZA 4KEZA 2BXVA 1OC7A 3TP4A 2BMBA 5FOOA 2E7FA 1PTAA 2A3HA 5BRBA 2OXNA 2AMXA 1DP0A 2EPOA 3PBGA 3OVPA 4RZ5A 5D9MA 1D3CA 5JIWA 2D0HA 2PLJA 1OX4A 1WE5A 3N2XA 4DYEA 1FWCC 3P6LA 4H8UA 1XCFA 3P0XA 1F5ZA 2F9RA 5C5YA 2FPTA 1YDYA 1V3JA 1L6WA 3MCOA 4RNHA 1PX4A 1MFUA 2YX0A 1Q8JA 3NUKA 5CXPA 1ISYA 2FHFA 4BWLC 1OFBA 5I5RA 5E9XA 2A6NA 3MSRA 3DEQA 4EAMA 3ID7A 3W7IA 2F61A 3G2GA 4EWND 4LQ1A 4IPNB 3WUEA 4N6EA 4Z2HA 4KMQA 3SRHA 2XIQA 3ZYZA 3OGRA 2DDXA 3KBVA 1L2QA 3ANUA 4Q6XA 1UROA 3S2NA 1W56A 1OT1A 2OOFA 3WK1A 2B31A 5FAGA 2HS8A 4JAWA 5BOOA 1WXZA 1JCTA 1E1CA 2RDXA 1EKOA 1PKMA 3RPTA 1C90A 3WH8A 3RITA 2ASHA 5FJRA 4F8XA 1Q7ZA 4XVDA 1XPYA 1JZ6A 3PBUA 1BWLA 3ONCA 1UR2A 2BTMA 2X8RA 3RLUA 1W9BM 3RCMA 2CLLA 3B8TA 4YCOA 1K7XA 2DSVA 1GONA 3AFBA 5KEZA 1UASA 3LENA 3QSRA 4RE4A 4Z08A 2J7DA 4OVXA 3IVSA 4IPIA 4S3CA 2W27A 3U7VA 1AD1A 5EY5A 1QI2A 4HSOA 5M5DA 1G6CA 3ARVA 3O7UA 3THAA 3AS2A 5D8WA 2YB4A 3PK7A 1JF5A 1J0KA 3AOFA 4JTIA 1P6BA 1C8XA 1GPWA 4Q7NA 3MI2A 1IT7A 1UPMB 5FIPA 4PUJA 3DESA 2V2CA 1PWMA 2WJEA 3ES7A 4QG9A 3NZPA 4GO8A 1NDWA 4PL1A 4WD0A 1PYMA 2ZCGA 5G1YA 2WZMA 4TVDA 3PSWA 1EHAA 3PJWA 5F4WA 3H55A 3GS6A 3UETA 2CERA 4FK9A 2IQDA 4TTUA 1Q6DA 1K6WA 2OWCA 5BROA 5CGQA 3UP8A 4LV9A 4FR1A 4NY2A 1P7TA 2BP1A 2O4MA 1XYCA 1KCKA 3CQHA 1TE1A 3VMOA 4XZWA 3NPWA 3TYZA 2PDJA 4PUDA 3AU2A 2J27A 2PRHA 3VOCA 4K2SA 4WOQA 3KP0A 1TPVA 1XX1A 2I56A 2ZVRA 3N2MA 1S3TC 2WPGA 3N4FA 3CXOA 5IOBA 1E6SM 1E4LA 4D6GA 1RCQA 4DEFA 4AY8A 2I5QA 3WL0A 1X96A 5U7SA 1XGZA 1DVJA 4UBPC 5M17A 2NUYA 1X1OA 4D6HA 2QGHA 3WEMA 1FQ0A 3FIGA 2QQ6A 4W8LA 3GXNA 2WZHA 4IIEA 1DOSA 4P8XA 4I9AA 3N11A 1YXYA 3DG3A 1MQPA 3IACA 1FH9A 5T26A 1V7AA 2QVNA 3E9AA 1PTGA 4IQDA 3OYXA 3ORWA 4NAFA 1U2YA 1VCGA 3KTSA 2P88A 3IARA 3WH5A 3QTPA 1EJTC 5C6MA 1JYWA 4MKNA 3N13A 5LGXA 1GNXA 1SVDA 4WSHA 1I0BA 1W1VA 2QDHA 1O5RA 2C15A 1VCVA 3IJIA 4C1LA 2YIHA 3APYA 3TWBA 1PSCA 1FP9A 4NNBA 2GQ8A 5AHMA 2YPIA 4C6FA 3TAOA 3JVAA 2V67A 4FLOA 3KVJA 4UFMA 1YBQB 1BXCA 2OVLA 1UW9A 1ZB5A 1DJIA 5BYWA 3M0VA 4DF2A 3QYSA 2IKIA 1EA0A 3V35A 3M5VA 2QCDB 4KT2A 2PTZA 4GVIA 1NF0A 4MYXA 3USZA 2ACUA 3WUGA 2KX9A 3HIJA 2BGNE 1F07A 4X2PA 3WLLA 4GH1A 5C2GA 1KRCC 4DRSA 4S2CA 4MFDA 4F79A 4XBKA 2A1YA 4E5TA 1RK5A 2OX4A 2EJ1A 4C60A 1N7KA 3FSTA 4G1KA 4RE0A 3T2QA 3A4WA 3G1HA 4N4PA 5I07A 1BVWA 1GCYA 1O95A 2J7BA 2HPMA 1V6YA 1XLHA 1Y65A 5FSDC 2PLKA 3NPVA 3IVUA 3WLPA 4MB4A 3KCLA 2WV8A 1EP2A 2VNCA 4WR3A 1IEWA 1XLMA 4JICA 1ONRA 1C8QA 1I2NA 1GOQA 5ABFB 2J6VA 1XLKA 4ML4A 3KUMA 4TX8A 1EC8A 1R9ZA 2GVYA 3RJYA 3TFCA 2UY5A 3RU8X 3TA9A 1OWQA 4MB1A 2G4FA 2WAGA 3LG3A 4AZ6A 3NAVA 4YPJA 5I23A 3VK5A 3P93A 4JR5A 1KFKA 2V38A 3P62A 3BMVA 1SO6A 4E2BA 3B9AA 3CMFA 1KCLA 1KRAC 2PS2A 1AMYA 2WJZA 1P0DA 4OJYA 1VFHA 4RR4A 3MSYA 1VFMA 2G3JA 2Y0FA 3UGRA 3NOEA 4M1BA 5JVLA 2CZ5A 2C18A 2W6RA 2OWXA 3FV9A 2WYSA 1UPPA 4HIBA 3GXPA 4Q4SA 1BFNA 1EBGA 7REQB 2JKEA 3OOQA 2ZE0A 5FJTA 2MNRA 2XSAA 3VFCA 2O56A 4HCHA 3AZTA 2E0PA 2Y8UA 5CH9A 1WAWA 3UR2A 1JUBA 3OODA 3DERA 4EWJA 3GB6A 4RDYA 1DV7A 4KGLA 3RPMA 1XSIA 4XK2A 2NVAA 2XIJA 1W9XA 3I7QA 4Z2LA 4FEZA 4OBTA 4US5A 3SRDA 5HQMA 1JCYA 2Y2WA 3CNYA 3OP2A 1W2VA 4PUNA 3U2EA 2Y7GA 4DJDC 1K3UA 4XVEA 4LVGA 1KC7A 3QQWA 2VUYA 3POCA 1OB0A 2EG8A 4BQ4A 1O68A 2QW5A 1CXIA 1ZZMA 3O6YX 2X05A 1UOKA 3GR7A 2FDMA 2WKGA 1WV2A 3LPOA 1WNOA 1XLDA 3UXKA 1UG6A 4NZ3A 4H7VA 3MW7A 2J13A 1WZMA 4DHGA 3TOYA 1KR0A 3AXMA 3N2CA 2VX4A 4BI5A 3R94A 2QLYA 3CUGA 5JQ9A 3VMPA 1F05A 3FCPA 2J66A 3B3DA 3IAPA 1RR2A 1TKKA 3HPFA 2WCGA 1NELA 1EQPA 2XUCA 5TD4A 3HTWA 4IQJA 1M7JA 2C19A 4H9VA 2VRQA 4JN8A 2PDKA 2PC8A 4QHRA 3VINA 3MP3A 3IGXA 3GNPA 1P0KA 3M7WA 2ZX5A 2DT1A 2DVUA 4GI4A 2PCEA 1WDPA 2V2DA 3W85A 2CBUA 1AW2A 1XLBA 1TELA 4G9PA 1B0IA 3AIBA 4AYSA 1XICA 6XIAA 2BVWA 1Q6QA 3FY1A 2OO6A 4EF8A 4LCQA 6A3HA 3BH4A 4MSSA 1HKWA 1XH1A 3ANYA 3L7RA 1TPFA 4ZA0A 1H51A 4DVOA 3R25A 1HJVA 1X6NA 3BLPX 3S2JA 1QAPA 1MDRA 3TROA 3KVMA 5MHBA 5A6KA 2FJUB 4MB5A 2OGYA 1LQ0A 5I02A 2AGTA 4MM1A 1VIWA 4AD1A 3UXLA 4YXGA 2Z4GA 2VFFA 1KFJA 1QHOA 1XUZA 2CZEA 3SCVA 1AL8A 2WPBA 4S2BA 4LY8A 3CMJA 2ZADA 1NJJA 1GVYA 5JBEA 2Y1HA 1UD6A 3B05A 1QNPA 4Z1CA 2V5BA 4J5NA 5DLCA 1HGWA 4C65A 1RH9A 4GH3A 3RO6A 2B7OA 1GJPA 2PDPA 1WCGA 2VEPA 4MNKA 2EG6A 3WLNA 1GW9A 3NO3A 4QM1A 3TN4A 1B57A 3I4KA 2G97A 3K46A 4TR9A 2O7SA 4OBSA 3A64A 3W6YA 3GAKA 3ZO9A 4Y9PA 1E40A 2Y8VA 4QIUA 4N9DA 2AL1A 3LRMA 1V4YA 1AQ0A 1KCXA 1TPH1 2OSXA 5I3GA 1TMLA 4CN1A 2YFNA 1KTCA 4L5ZA 2G3NA 3CUFA 3VDAA 2G8ZA 2QJNA 4INFA 3G1VA 4H8NA 2X1RA 3LXBA 4UTTC 2XHYA 2W79A 1W1PA 3ABZA 4IX0A 3KRUA 3TIMA 1B9BA 3R0KA 4BQ3A 2VD9A 3IUIA 4DYKA 4O16A 3B0UX 3KCJA 1H60A 5XIMA 3ATYA 2BS9A 4R7OA 4U2ZA 4U3AA 3N2BA 1UOZA 3C0SA 4O15A 3WJZA 2PDLA 1TMHA 1KBBA 2YB1A 3WDQA 3QY8A 2GSHA 1KM4A 3GDRA 4FNUA 3WH9A 1K9FA 1VRXA 4UQAA 1JI1A 1J0ZA 4X3ZA 1BSIA 2YDSA 4GZJA 1XPGA 1KA9F 3UT0A 4FALA 3ZT5A 4IL0A 4C6KA 3MB9A 3W1NA 2AAAA 4W86A 4O17A 2YSWA 3C4UA 1TPC1 2VTFA 3ATZA 3TKFA 1TZ7A 3QFEA 1X7IA 1GJUA 2ZVIA 3FKKA 1E51A 1Z8AA 4IGNA 4L1WA 3KBWA 5PTDA 3G3DA 3L23A 5I03A 3W01A 1S1PA 4J40A 3EEZA 1W32A 3A13A 4GVHA 5FD0A 1IXNA 5DY2A 5XIAA 4L4PA 5JH1A 1BPLB 4URIA 1XHGA 3RNDA 1LLZA 5A8OA 3H2NA 1TWSA 2ACRA 4Y90A 4JKKA 4JDBA 5GPRA 2ALRA 4UMAA 1EX5A 4LYKA 1H1YA 4H4IA 2BZNA 4DO4A 1QDSA 1G69A 1S38A 3KLLA 4KIRA 5D32A 4O19A 2GGGA 1ZBVA 1UJQA 1FDYA 1CEOA 1QPKA 1XM3A 4XAGA 1JNEA 3FKRA 3R0UA 2Y62A 2OZ3A 3W7EA 3GFYA 3WBAA 4PYSA 1CLXA 2GDQA 1TV4A 3MMDA 4R3UA 5KSWA 3E0IA 1TPDA 4EPDC 1QNOA 3MHGA 1AW5A 2HJPA 4TVCA 1X7FA 3GG8A 4DJEC 5ABFA 2ZX7A 2X1TA 1X8CA 3FS2A 4GCXA 5FA5A 5GJNA 5I2UA 5HWNA 3I68A 3VGHA 2QXWA 2PDXA 2VHLA 3S9IA 4QAWA 3MU7A 4HU3A 3B06A 3G5EA 1OGBA 2R94A 4GBDA 1HVXA 3SJNA 3CS2A 4KRZA 1YE4A 1G67A 3W24A 2H3DA 3GIPA 2QZRA 1SO3A 1R5YA 2QNEA 3W38A 4JTTA 1PHQA 5D09A 1FCVA 5BU6A 1E0XA 1XDJA 2VC6A 5CEWA 3GDKA 1I75A 4G7EB 4MHBA 4JTLA 1TJ2A 2Y4SA 3B8SA 3S5SA 3EMQA 1WUFA 4WY0F 3WKZA 1IZKA 5A8PA 1F2JA 4CNTA 2PDBA 1LBFA 4H7ZA 4HKPA 1M03A 5BWFA 3NDYA 2R1MA 1QOQA 3ZSSA 1XQKA 2A7PA 4QGCA 3C52A 4MJ2A 4EX4A 1Q2RA 4D6EA 3GHSA 1D7KA 1KCZA 3BSGA 3W1PA 2G5WA 3EWBX 1ISWA 1W6TA 3K1DA 1E4NA 2REQB 4P7LA 3U2OA 4UB9A 3NSNA 3EOEA 2OU4A 4FP1A 4FA3A 4GBUA 1EO7A 4LNCA 1B54A 2ZZ2A 4R9XA 3L4ZA 3BL3A 4BQ2A 3BSHA 2ZOXA 2WWCA 3KOWA 3PBWA 3HV8A 3K4WA 4H00A 3W00A 2P0IA 1JZ5A 3G0UA 4MWAA 1LL6A 1ENUA 4HOXA 5B80A 5HQLA 5KZ6A 3I3DA 1LLWA 1ZAIA 1FA2A 1XKJA 2GK1A 1UC5A 2OLHA 4YIWA 3VOIA 4NILA 3VCCA 4UR8A 3WF1A 3IGUA 3PTDA 2PRLA 4WQ6A 1DQUA 1UD5A 3BGJA 1IXOA 1H5YA 4HYVA 4PB3A 4REQB 2GUUA 3LTYA 2A6LA 3H53A 1EXBA 3P2VA 6REQB 2FH6A 4AZGA 5F4SA 5DXYA 2PZ0A 1GUVA 3WMSA 3BLKA 1K9TA 4I7WA 2Q8XA 2CLEA 2ZZ4A 4CCCA 2MUCA 1DXFA 5HUPA 4AH7A 5B7ZA 4Z2KA 4NYUA 1T5AA 1JEZA 3TSMA 4MG4A 1QO5A 3WD2A 3PUEA 2P1FA 1I2OA 1H1ZA 3SB0A 3G8RA 3ARZA 4X9SA 1ICQA 4N9BA 3VGBA 3PS7A 3PZUA 4G2DA 1X1ZA 5MF5A 1LM1A 4GHRA 1TWWA 5ECUA 4BWLA 1A3WA 1DXEA 4LVAA 3RR1A 3NZRA 1O5KA 3W7HA 2HMCA 2TPSA 3DG7A 3GC4A 4JN7A 5IHSA 3U57A 4MWAE 1PHWA 5BW6A 4NRSA 4G5DA 2V82A 1UZHA 1LQAA 3MUXA 3MC5A 1GVFA 3AJXA 1LT7A 4I9TA 1BVNP 3MY9A 3OJGA 4IL2A 1IYXA 2VQTA 3WLHA 1QW8A 2WXDM 1VBUA 1QBBA 1LL4A 2FTPA 3EWWA 4YTQA 4D1IA 3UERA 4L7ZA 1ZJAA 3IIVA 4DM1A 2H8XA 4A8NA 3HMCA 4XD6A 2YYUA 3UWEA 3L4VA 4S3GA 1XLLA 1V51A 2P8CA 4DNHA 1KFWA 2V63A 3MUZ1 4Q8MA 4A3RA 3B4UA 1K8CA 3A4AA 3L68A 3LLFA 1CTNA 3AICA 4IGSA 3CLMA 3P60A 3C0JA 1FWTA 1YNPA 4LANA 5HUOA 2Z24A 4K1GA 2R6OA 5JH2A 3QPZA 4XBJA 2GQAA 1CECA 3VZZA 3QZAA 2A79A 2G50A 3VGEA 3BDKA 4Q7BA 2QIIA 4Z2GA 3KEHA 5HWJA 3MQTA 1OSEA 3P14A 1XIBA 3UA3A 1U1HA 2XSXA 3ZLGA 1RLDA 1N2VA 3CQIA 3PJUA 4HGXA 3U5YA 1BF6A 1WUEA 5DY3A 4HPHA 2A3BA 3ABOA 4UMCA 1IT8A 1ZJHA 2WSQA 2D2JA 4E6MA 1Q6EA 3ZQ9A 3STEA 2QVHA 4KFOA 2PRMA 2C16A 4QEEA 1CGYA 3BSMA 2YXXA 4UTFA 3SCWA 3REQA 4XAYA 2QCGA 3QW3A 3UY7A 4M5PA 4PEEA 5I09A 1R3WA 2D1ZA 3DHDA 3G1AA 2NV2A 2XZ9A 2NXGA 2ZWZA 1UWQA 1DIKA 1XFBA 2OQLA 5C9XA 4YTSA 4Z1YA 5CJNA 5FEZA 1BSLA 4UNIA 3VOGA 2QKFA 3QQ0A 1K02A 3O0KA 1VENA 4ORIA 3WLIA 2WKJA 1FDZA 3H4GA 1RZMA 4BQ5A 3DBNA 1EEXA 1MWOA 4MZ8A 3H12A 1LP6A 2GUYA 3H7VA 3TC7A 2Z7KA 1CBGA 1W9DM 4Q4RA 1UIOA 4IHCA 2RDTA 3FAXA 3EGJA 2FB3A 4UXDA 3VIPA 2G3FA 3UJRA 2CITA 2YCEA 2JBMA 3QHMA 3AO0A 4M6PA 1PEZA 4IIDA 2VD8A 2OYKA 4D6JA 3B0XA 3L5MA 3W23A 2DU2A 1ZU8A 5CAKA 1AMKA 3V18A 3N14A 4B5WA 4UTUA 3BG3A 5H8MA 4KH2A 4DAFA 3ALFA 4BZYA 1VJZA 2WB5A 1YX1A 1QW7A 3R11A 2BHUA 3KE0A 4DYJA 1E3ZA 3NA8A 4DF0A 4IXHA 1RLCL 4XAFA 1RBLA 4H6RA 3TYEA 3AZSA 1WZKA 4DUWA 3MWCA 3OBAA 3ZVHA 4CQAA 2Z0IA 3UG8A 1J5TA 2FMNA 4C6EA 1W3TA 2PTXA 4J3VA 4O10A 3WIJA 2OKTA 2QDGA 2YL5A 4L4OA 1GVIA 1TPWA 1OF8A 3GO2A 1GJWA 1PCKA 1XYZA 4M6QA 4DJED 5E0CA 2VEIA 4J3TA 4RNFA 3ARYA 1A5OC 1UH4A 4G6CA 2X2YA 2Q3OA 4E3VA 1MRQA 1S2AA 2X7VA 4HMNA 3KBMA 5FF0A 3P74A 2JGQA 2LLEA 1V6UA 2IMRA 1UQZA 3OB8A 1UJPA 4EE9A 2BB0A 2VMFA 5GJPA 1LRNA 1G4EA 3S5YA 1BRLB 1SR0A 3Q65A 1K9EA 3VYLA 4TV6A 3IGSA 1XC6A 4C5YA 6ALDA 4FNRA 4OU1A 4WVXA 1L6FA 3AWNA 4J27A 5HINA 1W5OA 1RQEA 1RY0A 3QW4B 1YYAA 1LQ2A 4XO6A 3ERPA 5BMWA 1JG9A 3JUGA 3VPLA 4A35A 3ITGA 3K13A 4ACZB 1VGAA 4MJMA 2RKXA 2AOSA 4RZ6A 3NYZA 3UCCA 5FEPA 1MEIA 2VOTA 4WXYA 3PN8A 5AFDA 2IQ0A 4PCNA 4J3UA 1ZPTA 2XFFA 3LLXA 1BAGA 1W3HA 4XV0A 2PB1A 4UTKA 4D6FA 1MRAA 3EAUA 1FWNA 3LBOA 3IIZA 1N8FA 2PTDA 1EWDA 1P48A 4M56A 3WF0A 4FO4A 1PE1A 1AJ2A 3GHUA 3WQ6A 2WC7A 4Y2WA 4IPLA 1YQ2A 2PDNA 3T0CA 3VIMA 1YXCA 3B4YA 4KESA 5D8ZA 4D8AA 3ECQA 3EA1A 1JGMA 4HA1A 3T0TA 4UTWA 4K1WA 5EBUA 1POKA 2J6XA 2ISSA 3GQYA 5DX7A 3LI0A 5FF4A 3S2LA 2WZIA 2D24A 3N15A 4QSFA 3L21A 4L9YA 1BWKA 3LOTA 1UKSA 4DWSC 1J6OA 2OSYA 2OR2A 3NVTA 2FVMA 3K30A 3ONBA 3ITYA 1R38A 1LOLA 3OQEA 5D02A 1W5PA 3P5YA 4XZHA 5TQLA 3DFQA 2FPYA 1HKKA 1UKTA 1TZ9A 4QBXA 3CAVA 4C6MA 1DWGM 3MZNA 3C86A 1EO5A 1KKRA 4QCEA 6ENLA 2OT0A 3KW3A 1BKHA 1GWJA 4AF0B 2V30A 1WOAA 3B0PA 3IAQA 3W02A 2ZBTA 2HSAA 4W85A 4CUCA 3ZJ8A 4PMUA 4P2VA 1RK6A 4Z1DA 3O07A 3TOPA 4D8LA 4HPGA 2OGJA 4Q22A 3VIJA 1MSSA 4GG9A 5BU9A 3A5FA 1N8IA 1RCOB 3R8RA 1AL7A 3B0VC 4HK6A 2VC9A 4MAVA 3K4AA 3M5XA 5D2WA 5BWAA 4KCVA 4NX0A 4KQNA 3M0LA 4GQGA 2AQVA 1C29A 3ZJ6A 3E49A 5JBDA 1EIXA 2OMAA 3UU0A 3NVDA 5E9AA 3BW4A 4NVTA 1V3MA 1GOXA 1S2CA 1IR2A 5E09A 3S8HA 4ATLA 1REQA 1I9CB 1B4KA 1OFDA 2J8FA 1TUFA 2XVNA 4JPGA 2W0UA 1LJYA 3WLTA 1I1WA 2GVLA 3N29A 2VEKA 2GGIA 3AIEA 2INZA 3TZNA 3GNXA 3CQJA 5HA7A 1J8VA 1E72M 3TQPA 3WYZA 5E5CA 2GFTA 4JL2A 3FLUA 4P7RA 1YXDA 3FJ4A 1ZBWA 1SZEA 1R3QA 2FFCA 2EPLX 4ZOCA 4FX6M 1W2PA 1R9XA 2WMJA 1XYLA 3VDHA 3VCNA 1HL8A 2NZLA 2XSBA 3W07A 3E3HA 1QXLA 3VD5A 4HHHA 2BOGX 1VPQA 3PJXA 1DWIM 1EUAA 5EU9A 3E2RA 2POTA 1UKOA 1EOKA 1XW8A 3FXYA 1UP3A 3GH4A 4PMZA 1G9HA 1S2TA 3T0BA 3DBPA 3KDOA 4LEQA 2J75A 2QCCA 4GX8A 4AIEA 2ZC8A 1M7XA 4O54A 3EX4A 1O4UA 3L0GA 1TRDA 3HQPA 1W8GA 3THCA 1RQBA 1M7OA 3CV6A 2DZUA 3RMEA 3WMLA 2OKOA 3TFXA 3D3FA 1U5HA 5ABHA 3OHIA 2IPJA 4ZB2A 3VZXA 3VZYA 1CXLA 1F3XA 4AHOA 4W9TA 1A5UA 1GYLA 3HN3A 4UR7A 3M0YA 5ENLA 1EB3A 1VFTA 4O1FA 4F0HA 3MWAA 2I17A 2UY4A 3BJSA 5KITA 3LCWA 4B9YA 4AZCA 1XRTA 1XH0A 1OF6A 1X98A 2VURA 3CJPA 2WQDA 3BCFA 4GGHA 5HPOA 4E4UA 1TVNA 3NPUA 3MV11 4U3CA 3SCUA 2X42A 2V5DA 2AQWA 4GYPA 3R5EA 3DIPA 2H9AB 1ADOA 3IJQA 3W2KA 5F2IA 3EBVA 2PTYA 3EDFA 3GR8A 1C9WA 2DORA 2HXUA 4UTJA 3VXGA 3FA4A 5D2YA 2ODOA 4JDYA 1JQXA 4W7VA 3O16A 1JFHA 3OLDA 2GVEA 3E12A 4QG8A 1W0MA 2E1WA 3I7SA 2PD5A 2XH0A 4YVXA 3F4CA 4EPEC 1JD9A 2QV5A 4JGDA 2PLMA 1JZ7A 3CT7A 3U6WA 3ARTA 3W70A 2X30A 5DMYA 1TZZA 2OEKA 3MVTA 3UZJA 1B90A 1AK5A 2CC0A 4O11A 3N73A 1F61A 3TN6A 1BKSA 1GKPA 3MI6A 3AAMA 3FK4A 1BG9A 3N6QA 3TYUA 1Q85A 2WVTA 1NWSA 3W86A 3SUUA 4UTMA 3U9IA 3LNPA 1E56A 4NUWA 1F6PA 5IFPA 1UWUA 2JE8A 3H6OA 3HV9A 4M80A 4MYAA 2VZSA 2NUWA 4I7VA 1BQCA 5GNZA 3CGTA 3VX1A 4I90A 4W7UA 1K03A 3KWSA 4O1BA 3NEVA 5HNNA 4O8AA 3BW3A 2DVTA 1A4MA 1XH2A 3GDMA 1CXHA 3VI2A 1H49A 3DDMA 3LCGA 5FEXA 2HK0A 5LXXA 4J9JA 4J3XA 4DXKA 1Q6CA 4MNMA 3C2OA 4YL2A 2POZA 4DJFD 2PMQA 3PC0A 1PBGA 2ALDA 2ABBA 1D3GA 3T44A 3HGJA 2CU0A 3W2UA 3UFYA 1DWHM 1XJBA 1JUKA 2E40A 3VNLA 3OVGA 2GK1B 1AA1B 1TJRA 4JTRA 2HV5A 5TAOA 4IPPA 4D1JA 5LGZA 1ZHAA 5FESA 3JZEA 2DV0A 3PPHA 9XIMA 3PULA 2UV8G 1YIXA 5C9UA 4AISA 2TMDA 4TMBA 3WNLA 2UY3A 1KTNA 2ZZ3A 3AIVA 4A4AA 2CHOA 3TWAA 4R7WA 2YZRA 4UQCA 1KFCA 4DAIA 1IEVA 4QQ3A 5MKGB 4HMCA 4FX7A 1AZ2A 4L4MA 4B5UA 4FAMA 3NYDA 2IPGA 4FXSA 4F9DA 1GQKA 3R89A 4AQLA 3WD1A 3BGGA 4S3AA 4XBSA 1JR1A 3UZ5A 1JD7A 5IRPA 4NZ5A 2E8ZA 4JTKA 3LS9A 3HURA 2XIIA 4LVBA 2J7GA 3T8LA 3NL2A 1XBZA 4JY8A 1P5BA 3PZIA 5CPTA 1BHGA 2Y7DA 4HNVA 2ZRWA 1W1IE 1PS9A 4GC3A 1K8XA 4CU8A 3VD4A 3STCA 4F40A 3ANVA 4R53A 3CIXA 3RCNA 4JEQA 4OECA 1YTDA 3L0NA 1YDNA 1FDJA 3OGSA 3MCNA 5FI8A 2YA2A 5EGRA 2ZUNA 2G4JA 3BAYA 2PFHA 1ZCOA 1V79A 1Z89A 2O92A 3BOLA 1HO4A 1QRQA 3QR0A 3W7MA 2ISFA 2H90A 3B9DA 1F6YA 5IDZA 2P3EA 3UYIA 3EB2A 3S1VA 2F84A 1TIWA 3OTRA 2D0FA 4IIFA 1QBAA 4NHVA 1Y5WA 4QDMA 1DYSA 3USBA 3IANA 3UXIA 1UA7A 4BI7A 2RHGA 3VE9A 5AC6A 4G1NA 2GGJA 1SFSA 4J2MA 2A3LA 3W7GA 3W1TA 4NAEB 4JIIX 4QNEA 4S3BA 4JN6A 2HPIA 3N04A 1OD8A 2V5KA 1DKWA 3M46A 4CKQA 1REQB 3LQGA 5LKYA 6XIMA 2CYGA 2DEPA 1HKMA 1FWHC 2OLAA 1VBHA 1HZYA 3Q58A 4C7GA 2B7PA 4EVZA 1NWUA 3MJMA 4IQEA 2WHKA 4AIBA 1ITQA 2X09A 1WX0A 1OYBA 3WNKA 1EJSC 1ISZA 3GIQA 3DHFA 4ZB0A 5T8GA 3BG5A 2J78A 3K4DA 5CQ1A 2GQ3A 2VC5A 3C61A 1HJUA 3CQKA 4RXGA 2FVLA 4GZEA 4LS2A 2ON3A 3R4IA 3BAIA 4L1GA 3KM8A 5BXTA 3WO8A 2QUUA 3VMNA 3E0FA 3T1GA 1U83A 4D6IA 2X0HA 1YEYA 3KOYA 3MBFA 3FVDA 4Z0JA 3VDBA 1EWEA 5G2IA 3HZ3A 3GFXA 5I77A 4AX7A 3B8VA 4NZJA 5JMUA 3B9OA 3BPWA 1XLIA 2E8YA 3UXAA 1WBHA 3RN6A 3XIMA 1HVQA 1F4HA 2VUNA 1A5MC 5CC6A 4WY0A 5LA0A 1SJCA 1JCXA 4PMRA 2BVYA 1DJWA 3AXKA 3HFTA 2ZRXA 3PPFA 2PP3A 2ZKMX 3TSDA 3SW6A 1XF0A 3A22A 4S23A 4O28A 1FWDC 2GJPA 4X61A 3IRSA 4QITA 4MLJA 4O50A 3WJXA 2V6AA 1U22A 3LPFA 4NSBA 1IZJA 3E6EA 3SI9A 3UF9A 1XDLA 1OCNA 4G8TA 2VKZG 5CGTA 2ZXAA 1NOUA 3T2OA 2E3ZA 4W8BA 5CZSA 4MVAA 4XAZA 3QC3A 5D2VA 3LXCA 3WSUA 1G7UA 3W84A 3LQLA 5A95A 4LAZA 3JU2A 1SR9A 3CWHA 5CZKA 1DQWA 2EKCA 2H3BA 4XTIA 4H2HA 4ZQPA 4DLMA 3ZR6A 4JYDA 4H41A 1HN1A 3BZGA 1H1NA 1XD0A 4JTJA 1TB3A 1J9YA 2OCZA 1C92A 4WDXA 1S2UA 3QC0A 2VWSA 3MI3A 4ZZ9A 2ZA1A 5BNKA 4HU4A 3DUGA 1H0GA 2PDUA 1IV8A 2QCEA 1E43A 4UOQA 3KVKA 2V8ZA 5D2TA 1CGTA 3NNTA 3PWAA 3V1PA 3IK2A 1JZ2A 3E2SA 1SYTA 4L61A 3G18A 1OFOA 4XSMA 3L67A 1B2YA 1SZFA 3Q2DA 1QMLA 3T4CA 1US0A 1Y0EA 2IXVA 2WZTA 1OT2A 1TYGA 4LS0A 1NFBA 1EP3A 4B5VA 5C2CA 5TF0A 3EA2A 3ME3A 4S3FA 3WH7A 4J28A 3G3MA 3V75A 1N82A 3AYRA 4AXNA 3B0YA 3P81A 3PTMA 4CNOA 5LZLA 4P7OA 1PV8A 1TV2A 3I10A 4ECLA 4HA3A 3VNDA 5H6HA 4CLMA 3WEZA 4O4WA 2NWSA 3M1ZA 4MPQA 3NQ8A 1FXQA 1T96A 1GZ1A 1T6MA 4ZQOA 2DQXA 1MYRA 3B8UA 4WJ8A 2Q71A 1VBJA 1HT6A 4NZCA 1EZWA 1I45A 3GC5A 1VAHA 1PKNA 2BASA 3FAWA 3XINA 1FBAA 4E2VA 3WQOA 3QTGA 1WP6A 3GKFA 2PWFA 2YXGA 1AUSL 4Q8TA 1OZQA 4H9XA 4HNTA 1KWKA 3WQ4A 2X1IA 3WJYA 4O0ZA 4UNLA 1Z44A 4AUBA 1UP0A 3N9KA 1OINA 3S6DA 1A5KC 5G5IA 2XH4A 4UQ9A 3A6OA 4K68A 3BLLA 4KFNA 1EGVA 4Q8QA 4JTGA 3DCPA 5LHFA 2ACQA 4OTKA 3CQ0A 3WD4A 2DY3A 1IXPA 3BCDA 4LYQA 3KBNA 3L5LA 4HQVA 2I57A 3WLQA 3W2NA 1EH9A 2RGMA 1FWJC 2PF0A 2ZE3A 4KWWA 3V36A 3HA1A 2XN2A 1J6PA 2W91A 1OABA 5C70A 4AC7C 1Z69A 1GEHA 4KCTA 3DN5A 2XINA 4GYPC 3CL7A 4PTXA 1MW0A 1EDTA 4Q4OA 1KFLA 3C6CA 4GZ7A 1UUMA 3ZMRA 4YWIA 2E28A 1KR1A 4HZ6A 3WF4A 1FH8A 4E2OA 1FHDA 2WANA 1GVEA 2F6UA 2UWFA 2V81A 4CN6A 8RUCA 2VFGA 4ORMA 4F48A 1L2UA 1JGIA 4ZB5A 1EJ7L 1XI3A 2Q02A 5DEZA 3N1AA 4EXBA 4OV4A 3CBWA 4HK7A 2WO5A 1NY1A 2P76A 2CZDA 4KS0A 3QHNA 3S4TA 1Q45A 2DIKA 5E1QA 2QV4A 2P5NA 1FH7A 3CM4A 2GOUA 1ESWA 4H3DA 1FCBA 4RL3A 2C1IA 2FH8A 1Z41A 4JFWA 1TTIA 4AEOA 2TAAA 1NOWA 2XFYA 1KD0A 2D22A 3AHVA 1JDDA 3ZFHA 1Y7VA 4HB7A 1FHUA 2OO0A 3RJXA 4ATWA 5M03A 3IJ8A 4ZGYA 4V1XA 3W1LA 2XIBA 2ZUSA 4JTAA 1NU5A 3Q67A 1F8MA 4HSNA 1E9ZB 1Q6LA 3ITOA 3PTQA 4F3HA 4UTWC 5B7YA 3WH6A 1CT5A 1UH3A 1BXBA 1EP1A 5CPQA 4E4FA 1EX1A 1A5NC 4DWSA 1OD0A 3B8DA 4IJCA 2YW4A 1EGMA 2DGAA 3TSBA 4QXIA 3G0SA 1SQ7A 5BCAA 2UBPC 4IPJA 1GW1A 4G7FA 3CLWA 2FZ9A 4GC4A 1POJA 4W88A 2EHHA 3GLCA 1SZGA 2O9PA 2VQUA 4WKFA 3QN3A