3B3DA

B.subtilis ytbe
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
280
structure length
280
Chain Sequence
b'MTTHLQAKATLHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNEAGVGEGIREGIEEAGISREDLFITSKVWNADLGYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKEAWRALETLYKEGRIKAIGVSNFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQGQLLDHPVLADIAQTYNKSVAQIILRWDLQHGIITIPKSTKEHRIKENASVFDFELTQDDMNRIDALNENLRVGPDPDNFDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative morphine dehydrogenase
molecule tags Oxidoreductase
source organism Bacillus subtilis
publication title Structural and biochemical analyses of YvgN and YtbE from Bacillus subtilis
pubmed doi rcsb
total genus 100
structure length 280
sequence length 280
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3b3dA00
4FAMA 1S2AA 4XO7A 3H7UA 3CAVA 2PDGA 2ACSA 4IJCA 4GQ0A 2FVLA 2INZA 1ZUAX 1LWIA 4R9OA 4L1WA 4XVEA 2R9RA 4JTQA 1VP5A 3RX2A 4Q7BA 4JTCA 4GQGA 3S3GA 5HNTA 3BUVA 3LEPA 2IKGA 4Q3MA 4QBXA 2ACRA 2BGSA 3O0KA 4YU1A 1HW6A 3WBWA 4PUUA 3LUTA 3LENA 2PDJA 2FZDA 4IJRA 3UG8A 4FALA 4ZFCA 2PDPA 3LBOA 2IPWA 1RALA 4JQ3A 1PZ0A 2PDCA 4XZMX 4FA3A 2IS7A 2WZTA 1IHIA 1MZRA 4XO6A 4GACA 4WGHA 4PUWA 2PDBA 3T42A 2QXWA 4XVDA 3FJNA 3M0IA 1JEZA 4FZIA 3UWEA 3DOPA 1Q5MA 2IPGA 1EXBA 4F40A 4IGSA 4YVVA 2I16A 3GHTA 3GHSA 2HVOA 2PDFA 2HV5A 5HNUA 2IQDA 5LIWX 4YS1A 4NKCA 3N6QA 4OTKA 4WRHA 3RX4A 2PDMA 1XF0A 1AH3A 2P5NA 3UZWA 1R38A 4WDXA 4JIRA 4HMNA 2PDNA 1C9WA 5M2FX 3UGRA 3R7MA 3FX4A 3GHRA 2VDGA 2PDLA 1US0A 1X97A 3R6IA 3CV7A 3WBXA 1GVEA 3Q65A 4PMJA 4WDWA 1EKOA 3ONCA 3C3UA 2PDWA 2C91A 4JTAA 2PEVA 5LIKX 3V0UA 4DBUA 3F7JA 1ZSXA 4LBSA 4EXAA 3WBYA 2DUXA 1YE6A 4AUBA 1S1PA 4JTRA 3LD5A 4WDTA 3R8HA 4LAUA 3GHUA 2IPFA 2IQ0A 1EL3A 3R94A 2CLPA 2PD9A 3UFYA 4JIHA 2NVCA 3H7RA 3V36A 3R58A 4XAPA 3EAUA 2ACUA 2F38A 3UZYA 2F2KA 5LIYX 3WG6A 1XGDA 3LZ3A 2PDHA 1YE4A 1M9HA 2BP1A 2PF8A 4XZNX 3LN3A 3LQLA 2ALRA 3R8GA 4DBWA 5AZ1A 3UZZA 2FGBA 1AZ1A 2HVNA 1AFSA 2IKJA 2INEA 2R24A 1QRQA 4JQ1A 4JQ2A 4G5DA 2PDQA 4H7CA 1S2CA 4H8NA 4JTDA 1SM9A 1Z8AA 3CAQA 1PWLA 2PFHA 4PRTA 3GUGA 1T40A 3UYIA 1FRBA 4XZIA 5DANA 1X98A 3MB9A 1RY0A 3VXGA 2ACQA 1ZGDA 2DUZA 2HDJA 1UR3M 3BCJA 4LBRA 4JQ4A 1PWMA 1K8CA 2FZBA 3CASA 4LAZA 3ERPA 2I17A 4PRRA 1J96A 1ADSA 3UZXA 3WCZA 3CMFA 1YNQA 4PR4A 2HE8A 3EB3A 2AGTA 3RX3A 4DBSA 5JH2A 1Z9AA 3B3DA 3MC5A 4WEVX 4GABA 2FZ9A 1A80A 4RPQA 3Q67A 4XZLX 3BV7A 2A79A 1IEIA 1QWKA 1Z3NA 3QKZA 1PZ1A 1MI3A 4GIEA 3V0SA 1AH4A 1PYFA 4LB4A 3BURA 3DN5A 3EB4A 3V35A 4JIIX 3D3FA 3P2VA 3LQGA 5LIUX 2PDXA 3CV6A 4XZHA 3LNMA 1RY8A 3NTYA 2PDIA 4L1XA 4I5XA 4QR6A 5HA7A 2DV0A 2IKHA 3COTA 4QX4A 1Q13A 1EF3A 4ASTA 2PDKA 3UP8A 1OG6A 3R43A 1S1RA 1X96A 2BGQA 5LIXX 5JH1A 4ICCX 4EXBA 2IPJA 2HE5A 2J8TA 3ONBA 4YVXA 3M4HA 3N2TA 2WZMA 2ISFA 4YVPA 1Z89A 1VBJA 4JQAA 4MHBA 4QXIA 1LQAA 3G5EA 2PZNA 2NVDA 4WDUA 3KRBA 4HBKA 4DZ5A 3V0TA 1XJBA 5C7HA 1AZ2A 4LB3A 1AH0A 2PDUA 2FZ8A 4XK2A 5AZ0A 3G1RA 1YNPA 1MRQA 1ZQ5A 2PDYA 2IKIA 1T41A 3LZ5A 3H4GA 5KETA 2PD5A 4GA8A 1HQTA 4GCAA 2HEJA 3U2CA 3M64A 3O3RA
chains in the Genus database with same CATH superfamily
1HKWA 1MWOA 2X1SA 3BZJA 2WAGA 2BVWA 3UXDA 1PKNA 1C92A 2XTKA 1JNDA 1OGSA 1LROA 3PUOA 3RX2A 2POZA 1R47A 1WZAA 2VJXA 1R46A 3AISA 2Y5EA 1D8WA 1Q65A 4BHYA 2ACRA 3EMZA 4J2PA 2CBVA 3N73A 3CT2A 1RCQA 3C56A 5U7SA 3WKZA 2VC7A 3HFYA 4ML9A 3SCOA 2FHBA 2QIWA 1VJIA 3NXLA 4PRWA 3CQHA 2C13A 2QV5A 1SFTA 3A4JA 4ZO8A 3EPMA 3K1DA 3FGCA 4J3ZA 5E09A 3GO2A 5CC3A 2Q01A 4AD1A 1H11A 5CZ0A 1YX1A 3BG3A 3UXIA 2QZRA 2YCEA 1DWAM 1LG1A 2WNZA 1DIDA 3U2ZA 3WLPA 3NZGA 3R0KA 4JQ3A 4S3AA 2VO5A 4E2BA 4FNTA 3A13A 4OVXA 1R86A 1IWBA 2ZWYA 4DF2A 3N4FA 3IIPA 1CXLA 1XDJA 3OZOA 2FTYA 3DOPA 4PC8A 2V63A 3U48A 2GJXA 2DFAA 4UZUA 4Q8TA 2Z2AA 3PBYA 2RHGA 4AD2A 3TFCA 4YN5A 2HV5A 3DC8A 3NQDA 3DFOA 3UXLA 3ISIX 3E12A 2BOGX 4F0SA 3B97A 3GIQA 3ZVIA 4HCHA 2OZ3A 4BF5A 4ZTXA 1BTCA 3GU2A 4R27A 3I4EA 1QNRA 1XINA 4OTKA 4AZGA 1NF0A 3S5SA 3M5YA 4AZ7A 3T2OA 4QLJA 3SB0A 5CGTA 1KFJA 1RCOB 3ZS4A 3UWUA 2GFTA 2VD9A 4DZIA 1QAPA 4R5EA 2A3AA 3AU2A 3AMGA 4DYJA 1E6NA 3E2RA 1AK5A 4AXNA 1TRDA 4RX0A 5DMNA 4Q32A 1BKHA 3CV7A 2EG8A 3EX4A 1DXEA 4RPPA 2XVKA 2DVUA 3W7EA 3WFAA 4HA0A 1QI2A 3QEZA 1AODA 3H12A 2G8ZA 3CZ8A 4MWAB 4OQVA 3W7QA 1E4MM 3BLEA 3G18A 1O5RA 4PBEA 4GBUA 1N8FA 2W0UA 3DX5A 4CLMA 3SBFA 4EPBC 1B54A 2CWNA 3RLHA 3PUDA 2G5WA 3FA4A 3GIYA 3BLPX 4JOMA 3MT1A 4GXWA 1IEXA 1BYCA 3DESA 5JMUA 5I3KA 3PWAA 4QG9A 2WVVB 4S3BA 4DO5A 4E8CA 5E9XA 3TQ0A 2OG9A 3LZ3A 1JDDA 3RN6A 3JW7A 3FJ6A 3RPTA 5HAOA 2A7RA 1ZLPA 4RR4A 2OEJA 2UZ9A 2WMGA 5F2LA 3KP0A 1MXGA 2AQWA 1MUWA 2P3EA 1X39A 4GYFA 3V5FA 1BSIA 4PB4A 4CD7A 4ES4A 3ZOAA 5CXPA 2O92A 1S2CA 2YPIA 3G0XA 1PKLA 1PX3A 5A5WA 3EDFA 3RGTA 3E5PA 2ZUUA 1UZDA 2D20A 4CD6A 3VNDA 5LSMA 3P93A 2PU1A 1A5KC 1XYLA 2H8XA 2QJMA 3CYVA 4LGXA 4H19A 1X1NA 3CEPA 1VEOA 4RUBA 3BICA 2Z1WA 3S1GA 3HG5A 1PUDA 4ZO9A 2X2GA 4OUEA 1AMKA 4IWWA 5LA1A 2C15A 2HE8A 2AGTA 3D47A 1N2VA 4ILSA 3L21A 3ABQA 3KE0A 3CS2A 4GD0A 4LNCA 3TMLA 1KXTA 1GQKA 1NDVA 2YXOA 4Q4MA 1W1YA 4XZLX 2VURA 1HFBA 2VXNA 3BOXA 2NXIA 2C14A 5A8MA 3DFYA 3BQ6A 2YFNA 2ZCGA 3CPRA 1PCKA 1UPMB 2ISVA 4INFA 3FJLA 1OWQA 3VINA 3TTOA 4EKJA 3V0SA 1EJXC 4TUFA 4I8YA 3NL2A 3UVAA 1L8PA 4B5VA 1JYWA 2UY5A 4H6QA 4MG4A 4M19A 4AIEA 4UQ9A 2QEZA 4IMDA 2BHYA 5HANA 1Q4NX 2GVLA 3K4AA 4HHHA 3KBJA 1DJNA 1VD6A 1J5TA 4L6OA 4CNUA 2ZUMA 4NYUA 3EB2A 3EPOA 3RYSA 1H7NA 4X0NA 1NFPA 3O6DA 3QY6A 3BW4A 3MV11 1ZTVA 4QR6A 4E4FA 3C2FA 3ICJA 1RCXB 4ZSTA 3KL3A 1KR0A 2CLFA 4JFTA 3R43A 1V5XA 4LCSA 1V3JA 4UFHA 3T9PA 3W82A 1EJWC 1CECA 1PIIA 2GSEA 4RZ6A 3LCIA 1ENUA 3TW6A 4QJ4B 2YOCA 4MSSA 1M53A 2VOTA 3GZAA 4GCXA 4PULA 3HG2A 5I07A 4B5UA 1H7PA 3BJTA 1UKOA 1XLFA 4U5IA 4WX2A 1IIGA 1DWJM 1QJWA 2E28A 3KRBA 4I5UA 1AW2A 4G1KA 4JX4A 4DZ5A 4WY0A 3WQ6A 4Y9MA 4M82A 4P8XA 4PEKA 1I6NA 4A6GA 4HU0A 4Z2HA 2PWHA 3M0XA 4LUTB 4Q8VA 3VNLA 1GZGA 1Q66A 2OYLA 4ZL1A 3STCA 1BWKA 2E5CA 1W5MA 4IUOA 4PBGA 4C1NB 2DY3A 3FYYA 4HMDA 4O8RA 3NL5A 1XPGA 4YYFA 2Q02A 3U7VA 1UKQA 4W86A 1EA9C 4UTLA 2W61A 4MTVA 3S9ZA 3KP1A 2O9TA 4GK8A 4MWAC 3W6YA 3F2BA 3G1HA 4FNQA 4B90A 3LB0A 1CTNA 1K70A 2H3DA 3VGFA 4Q3MA 4E2DA 1OX6A 4UTMA 3MMDA 4X2PA 3WF1A 1A53A 3T7VA 3LUTA 4FXFA 4NZ5A 2XSXA 2XFYA 3M1ZA 3NDZA 2EAWA 3FDKA 1K1DA 4I6KA 1XSJA 1IT0A 1JPHA 3WMCA 1OSEA 4O18A 4C5ZA 1WP6A 2VGBA 4F2TA 3SQSA 3T44A 1WDDA 5T9CE 3NGFA 4HNVA 4HPHA 3N11A 4ZQNA 1QNPA 3RRXA 3T42A 1K9EA 4DO6A 1GPWA 2J9YA 3IK2A 1WXZA 5EYWA 3CWNA 2QT3A 1J4EA 3AC0A 1B3ZA 2CZEA 3PY2A 2X8RA 3C0JA 1W8SA 2Z2BA 2J7DA 3TU9A 4CQ9A 3HPAA 5BRQA 2HVOA 5C5YA 4IMCA 2PDFA 2G4JA 4CNSA 4FI4A 4MB3A 3I7RA 3E0VA 1SW0A 3HG3A 2Z27A 5FF7A 2VZTA 2GK1A 1OIMA 2GJXB 1O4UA 3T55A 3P6LA 1QNOA 2WM1A 2GGEA 4AD3A 3BJSA 4E8DA 3PSWA 4NRSA 5FIPA 5KMYA 3M46A 3P3BA 2VHLA 1JF6A 5D2WA 2VWTA 4JHOA 2VC6A 4LF1A 4GVIA 2OB3A 3SJNA 3GTNA 2Y1HA 3EOUA 2ZUSA 2FH8A 2Y7DA 3TTQA 1JRBA 2IQTA 4FF7A 4W89A 4NT0A 4H04A 2WSYA 1QNSA 4OV9A 3G6MA 1EUAA 3WUEA 3WBYA 3R0UA 3VOFA 3TYBA 2A3BA 4JPGA 1N55A 5HMDA 1US3A 3FHAA 4KFPA 1GOOA 3T05A 3VUSA 1NOWA 3R94A 3VZZA 2GUUA 3RLVA 1VBUA 3TXVA 1AG1O 3MYOA 3R58A 4XD5A 3QSTA 5D30A 4IICA 2IW0A 3GC2A 3TVAA 1M1BA 3GVQA 2HCVA 5GJNA 4PN2A 3AXXA 3EA3A 1UD2A 2WQDA 2YFOA 5LIYX 2HZGA 2D73A 4ZOEA 3WG6A 1XH1A 3WQFA 3VFCA 1GOIA 2CERA 1U30A 2BP1A 1J5SA 4DM2A 1W9VA 5AVNA 3TJ4A 1EYEA 4DQWA 3E2QA 3OYXA 3DG6A 3UZZA 3J7HA 3UA4A 1KCXA 3CYJA 2HPIA 2VQUA 4G7FA 2R24A 4BCEA 1GONA 3RCNA 3KS5A 2FZMA 1SM9A 4X9YA 5DXXA 1P48A 4Y8EA 1SQ7A 1C29A 1WO2A 1B2YA 2CZ5A 1LL7A 5DRIA 3SCSA 3W85A 3D46A 1RAKA 2BG5A 2DJLA 5DANA 4KS0A 3HPFA 3I10A 2ABAA 2XM1A 2WMIA 4WK9A 4ACZA 4NJGA 1O1ZA 1WKFA 5A6LA 2QNEA 4D6IA 4TO8A 4AG0A 4GVFA 3H22A 3KVJA 1WA3A 3THUA 3KL5A 1GVIA 1LRQA 1XSKA 2DGAA 4MB5A 1J12A 4NXKA 2QVHA 4ZQOA 1W54A 3KLLA 4W8AA 5HQLA 3O0FA 4F9DA 1BGGA 3CMFA 2P0OA 2OMAA 4AIOA 3SUSA 4KGLA 4MWAA 1IXPA 4YWIA 3B9OA 3EYPA 3G6LA 4F3HA 3KOYA 2R1PA 3GH4A 2JQXA 2W4XA 1T99A 3VI2A 4XBSA 2E9LA 4KIEA 3AHXA 3HGJA 3PK7A 1ITCA 2E8ZA 3WF0A 2FH6A 3Q45A 1E5JA 4AHPA 2DZBA 5EBUA 3GUWA 3W1QA 3OVGA 3QQ1A 1W9BM 3LRKA 1AH4A 3MSGA 3QGAC 1KRCC 3DFHA 3L2IA 4DJFD 3WQ5A 3FA5A 1PBGA 2D3NA 5SWUA 4MFDA 3AS2A 1UIPA 4LVBA 2RDXA 4S1FA 1EBGA 2CKRA 3LA4A 1POKA 4I8DA 3RG6A 1QW8A 3BSMA 3GRIA 1A5NC 4B9YA 3UA3A 3BJFA 4P7OA 2PDIA 1E4NA 1KLYA 3F5JA 1UOKA 1K6WA 4NAEB 1Q13A 4KEZA 1C8QA 1EF3A 3VD9A 5FSDC 4D72A 1KBLA 2YXXA 2BGQA 3C86A 3M0MA 5U4NA 4H9ZA 1JULA 1XQLA 2J8TA 3H4XA 3K13A 1XYMA 1G4EA 1JAKA 2CWXA 1TV8A 1O7AA 4L80A 1X38A 3RAOA 1EB3A 3QQWA 2BY1A 1TPEA 1CXHA 4UUIA 4XTIA 3ZLFA 1FWRA 3V0TA 3EDEA 1U2YA 3TWAA 1RQEA 2NUWA 4MWAE 5T9BG 3CO4A 3L4WA 4DYEA 4MJZA 3TIMA 4AX7A 4P7LA 1ZQ5A 1D3GA 3GU1A 4K6AA 5KZMA 3TZFA 1XYAA 1G01A 1WXJA 1RVKA 2PD5A 5BWFA 2QHAA 3URAA 3GTFA 3NFUA 4GCAA 1SJAA 5GQBA 2EXOA 1KQZA 4MOZA 1ZP3A 4YTSA 4LH8A 3LHUA 3PC0A 4OOUA 3NGJA 3MI6A 5JBFA 3VNZA 3N2CA 1S2AA 1Q6GA 3QJAA 4B5TA 2OTDA 2X09A 4D2JA 3CAVA 1HKKA 3FKRA 4GO9A 2WPBA 3AIRA 2R9RA 1OINA 2CHNA 5HMFA 1KTBA 3AIEA 4MNLA 2DPEA 1HVQA 1H0GA 1V77A 5JBEA 5FJJA 3U8GA 3DERA 4QLLA 3W86A 2BGSA 1C93A 2AAAA 4PUKA 4LPCA 1W9DM 3T08A 1XH2A 2FFIA 2E4TA 3ZT7A 3FJ4A 2J27A 1C90A 2B7PA 5K4XA 1WB0A 5BRBA 4OOZA 4A3QA 3M47A 1ESWA 1CENA 2X42A 3A5FA 3CLWA 2JALA 1CI1A 1CPUA 3SRKA 4S3KA 1RALA 3OU8A 2ZRYA 3AMKA 2HPMA 2GVJA 4IMAA 1QHZA 1J0IA 3HN3A 3VABA 2X30A 1DVJA 5TF0A 1PAMA 5A95A 2YDSA 3VIKA 3M43A 1Q7ZA 4TVCA 2E1WA 3CMGA 4W8LA 1WDSA 1Q45A 2OKTA 4HOXA 2DT0A 2NT0A 4GI8A 3GHSA 4DPPA 2YCLB 3WLRA 2XUCA 3H2AA 1IWAA 3QW3A 4IFKA 1TCDA 2GVEA 2WBGA 1JFXA 3SFWA 2VYOA 4RDWA 3FV9A 3WNMA 2F6XA 1UH4A 2PA6A 3VOGA 1DTNA 3ALGA 4HK6A 5EMJA 2QIIA 5BROA 3UR8A 2PURA 5D9OA 3ZLHA 5A8NA 3TYUA 4HCLA 1UWQA 2NWRA 2VDIA 2FLIA 1R38A 3UZWA 5B7YA 2V5CA 2WYSA 3C0QA 4GKTA 1KGWA 2FMOA 4JTKA 1JD7A 3PUGA 3RCYA 2Y88A 5M2FX 1JPKA 1S5WA 2VDGA 1E6RA 2AOSA 1EJ7L 3DHDA 3MWAA 3ITVA 3ARXA 4P7RA 3P0XA 4ICNA 4I9MA 3PZMA 3C3UA 3MKVA 3C4UA 3H6OA 1MXDA 4TV5A 1NWSA 4NHVA 4DXVA 3E2SA 5HQEA 4WOQA 4A29A 4BZYA 4DYKA 2DZVA 4L4OA 1V6YA 3ITLA 3S2LA 3PR2A 3GNNA 2CKSA 2DIJA 1KD0A 1TZ7A 1XIFA 4FPSA 3ZWSA 3UFYA 4I9JA 1V08A 1VIZA 3DFSA 1A49A 3NURA 5F2GA 1KA9F 2ZE0A 5LHFA 4FLRA 3K30A 4AD5A 2OPJA 3DEQA 3UZYA 3WLKX 3NM3A 4JX6A 3WLMA 9XIAA 3OLEA 4Y96A 1ADOA 1LBFA 3CQKA 4S38A 1RJRA 4OV4A 3SSJA 2QV4A 3VNYA 4Y9NA 4O1CA 3W88A 5FKYA 1G4TA 1S38A 1LF1A 4C91A 1FWBC 3B8IA 3VM5A 3VIHA 2HTMA 3S5NA 1SW7A 3UXAA 3GDKA 3GR7A 4GNJA 4B5WA 3G1FA 1W1TA 1UR4A 2Z1VA 4W7VA 4AHQA 2VRKA 3OLDA 3S6OA 2V2DA 2PWFA 3KUMA 2OO0A 3VOIA 3G8EA 3CZKA 3K2GA 3TAOA 4GC3A 1E1EA 3BOLA 4NUWA 1TKKA 3VIIA 3VK5A 4ONVA 3P74A 2JFEX 2HDJA 1I75A 3AZRA 3PWIA 2ZADA 4D6EA 3E3HA 3OIHA 2PODA 2FKPA 3BPWA 3AIUA 2XN2A 4LAZA 5G4HC 4L64A 3W1MA 1UC4A 2QCFA 5D38A 2OCZA 5GNZA 2HMCA 4U3AA 1DE5A 3WQEA 4MKSA 1TO3A 4N9CA 4RV8A 1UR0A 3UWWA 1TR9A 1UYQA 4WEVX 5ABGA 3SCNA 4ZXLA 5JVLA 1ICQA 3TYDA 4MF4A 4QSFA 2A79A 3S2MA 3INPA 3QY8A 1EA0A 1BXCA 1WV2A 4LVAA 1PEZA 2FB2A 1V6WA 1DQXA 2YX0A 4ZOAA 1CBGA 3RIKA 1UR8A 3OIXA 2PE4A 3TC7A 4FIRA 4CN1A 4LB4A 2DIEA 3RCMA 3QW4B 3FXYA 3DYOA 4CKQA 6CGTA 1DIKA 4GGBA 3NIYA 1MFVA 1A0CA 4CEUC 4QE5A 1JPIA 3CV6A 1UD3A 4XZHA 4LRTA 4N6FA 5FF3A 4RDYA 1GOKA 2Z6JA 2CHRA 1PV8A 4C6CA 4L1XA 2ALDA 3VNKA 4BI7A 3ANYA 1W8GA 2NT1A 1XC4A 5J8LA 1MUCA 4MZ1A 4GUIA 4K3ZA 4WSHA 1S1RA 1X96A 4ICCX 2POTA 2OYMA 1P6CA 1B3OA 1KRMA 3CZLA 3W83A 2FDSA 3NR0A 3CAWA 1R2SA 2Q8XA 2QCHA 4MHBA 3FSTA 3MUCA 3WK3A 5DEZA 3UJEA 1KBIA 2VEKA 3WBEA 4A3RA 4AAJA 2RGMA 2D2JA 2YCLA 5C7HA 3OOQA 1E6XM 5C2GA 3GVWA 1MW0A 4FNUA 5MKGA 1YQ2A 1EPXA 3S5ZA 3GVRA 3GIPA 1Y5VA 4AWEA 5D4YA 3PPHA 5CPSA 1IE7C 3CQ0A 4I5RA 2WMHA 3AXMA 1PYMA 2OQHA 4V15A 2WMIB 2QUUA 5CJMA 1F6YA 3D3AA 3UNTA 4S3FA 3M64A 4JL2A 1QR7A 4IOTA 3ZJKA 1LBLA 1VB9A 4XAFA 1GCYA 2J74A 1XX1A 1KC7A 5E0FA 2PDGA 4G2DA 1FKXA 2ACSA 5DELA 3R10A 1KM4A 3QPYA 4W88A 2E09A 4IGMA 2KX9A 4XUYA 2HVMA 3FDGA 3GG7A 4QTGA 2FPYA 3BAKA 3L4YA 2J78A 3NVTA 3CHCA 3EZ4A 3RUBL 2WQPA 4WJXA 4H8UA 1GKQA 4GZEA 4IJRA 4E2OA 1EC7A 1I8JA 1B3VA 1CWYA 4PMXA 3DGBA 3PULA 4D6HA 4FALA 3AJ7A 4NAFB 2C6QA 3LLFA 1Y65A 4GQRA 3TV8A 4NP7A 2W67A 2PDCA 3O1NA 4FA3A 4J28A 1H7RA 2EQDA 5K2ZA 1IHIA 1NQKA 1FWGC 3ZVHB 3H7VA 2A3HA 2ICSA 3FVDA 4A05A 4UCFA 1JEZA 3TYZA 4DJED 4FLQA 1Q5MA 4LW7A 3QH2A 4YVVA 5IFPA 3WQOA 4M0XA 2Z4GA 1V7AA 2HS6A 5EMLA 1ZJIA 4PB3A 1FWCC 3WLJA 2X1TA 3KZPA 3ARSA 1VENA 5AN7A 3IVTA 5E6ZA 1EHNA 3PP7A 4JTHA 3IGSA 2V5DA 4IZGA 3UG4A 4O28A 4F9JA 3G2GA 3KFTA 3WMLA 4DO4A 3VGHA 3N2XA 4DXKA 2ZTKA 3CLMA 4AEOA 1KM6A 4H2CA 3EEZA 3B9AA 2P5NA 3IAQA 2WWCA 3LCWA 4Q8MA 3IJQA 3USZA 3PG9A 3WLIA 1I2QA 4J4KA 4MPQA 3KDNA 3W75A 2E67A 4AWSA 1H61A 3JS3A 2DQWA 4IQJA 3ITXA 3GHRA 1JYXA 4NAEA 1JDCA 2PWDA 3LCGA 3Q65A 3LMZA 1IYXA 1AQ0A 4LUSA 2ZZ4A 1KRAC 1UWAA 1VH7A 1CGYA 2ZX5A 1LL6A 3CWOX 2D22A 3ENLA 2EPLX 3E96A 2DUXA 4LQ1A 2WJEA 2OVLA 1MYRA 2Y24A 1POJA 4I7VA 1QATA 1I2OA 3LTYA 2J7CA 4JIHA 2NVCA 1BVNP 5FESA 3V36A 4A8NA 3MUY1 3ZT5A 2A2IA 4UQDA 1AJZA 3BCFA 5A69A 3GTXA 3LU2A 4CCZA 4JTJA 3RLUA 2WJZA 1XQKA 1ONEA 3TW7A 1G5AA 4Y2WA 3GD6A 4HB7A 5HATA 4Z08A 4JXCA 2WXDM 4R53A 4OKDA 5IFTA 2E77A 1Q2SA 1E0UA 2ASHA 1AZ1A 1IZCA 2OU4A 2BZNA 2GWGA 2GGIA 4A2SA 4UQAA 4JQ2A 1Z42A 1PX8A 3EX1A 4H7CA 4Z1YA 1FP9A 4EVZA 1W1VA 6ENLA 4HTYA 3PJWA 4X22A 1E9YB 1PWLA 2REQA 1TE6A 3C2RA 3GUGA 3LPPA 1P0NA 1QTWA 4B4HA 1O68A 4LF2A 3MB9A 1GUVA 4LVGA 1VRXA 3CUHA 4Z1AA 4WUIA 3LCHA 1ZGDA 2TMDA 3KCLA 1M03A 4KEVA 4B5NA 1TR1A 2OGYA 4UC5A 2PSNA 3GWQA 3M6DA 2WHKA 1ADSA 4CQCA 3W26A 1JCTA 3CMJA 5G4EA 3GDRA 3SY1A 2CETA 1RP9A 2O9PA 2GVYA 2GLKA 1UWSA 4K2SA 3NQ2A 2WHLA 2VNCA 1JD9A 5EMKA 4MUZA 2QAPA 2DIKA 4O19A 4AH7A 4N9DA 4IG2A 2YGYA 1TJ1A 1AL8A 5BXRA 4YL2A 4UR8A 2VFHA 4CCEA 5JUVA 3U2EA 2GJLA 3OBEA 3L4ZA 1W37A 5DN1A 3DHPA 5JXQA 4REQA 2I56A 4Y8FA 1KGUA 3ZJ6A 1P7TA 4FP1A 4MIMA 2BS9A 5M5DA 5XINA 2OWXA 2QMKA 2PGWA 5ECVA 3LRMA 3M0VA 2PGRA 4A3UA 3GR4A 2XH2A 1OCQA 3NQ7A 2PTYA 1KGXA 3VD3A 4LEFA 4UQCA 2QR6A 3EOEA 3RMEA 5HA7A 3GDLA 2IKHA 4MLJA 1JI2A 2PTDA 4J27A 4ZE5A 3TH6A 1V93A 2WC3A 3O16A 4S3JA 2J25A 2IPJA 1BSLA 1H4PA 1P7TB 4NXSA 3UW6A 5BXTA 4HIBA 1VCVA 4EK7A 4GG9A 5XIMA 2R94A 1JXJA 1GTHA 4NZCA 1OG0A 1NH6A 1V0LA 1VBJA 4AF0A 4GXPA 5H1WA 4ECLA 3R25A 1U5JA 1Q6FA 3AIWA 1GW9A 4IL0A 4KERA 5LGZA 2ZVIA 5CJNA 1IF2A 4KRZA 1QDSA 1EEPA 5AZ0A 1I1XA 3RM9A 7XIMA 1UG6A 2E25A 1E51A 1KCZA 1T41A 3EX2A 2OYKA 3W00A 3MU7A 4JYEA 1V03A 3TCEA 3GFZA 3BV4A 4EWJA 3UG5A 1JDEA 1C7SA 5CCZA 1VC4A 4AEEA 2E9BA 2P8BA 3TC3A 2SFPA 4NJIA 3U3HA 1E1CA 2ODOA 3FK4A 1QBAA 1RVGA 3GXDA 4AQLA 2BGNE 3H2FA 2R1MA 1XLGA 3WUGA 3FFSA 1NIUA 4Q7BA 1ZAHA 4HPNA 3DH7A 2D23A 5C9RA 4FXSA 3A5VA 4HNUA 8TIMA 1XIBA 4FX6M 5G2HA 5C9UA 3T78A 2HNEA 4W8BA 2G95A 4BWLA 3QY7A 2XIJA 3I3DA 2R6OA 3L0NA 4O1DA 3C2EA 2V3DA 3OZYA 3PTDA 4ZFCA 4F0KA 1CXKA 4H4IA 4Q8UA 2ZRUA 4G7EA 2ZDRA 1FXQA 2XSAA 3EKLA 1U5HA 3AZTA 4DI8A 4CD5A 3POHA 3THCA 2FFCA 1VCGA 3GR8A 4AVNA 5E93A 4YYCA 4JTTA 1ECEA 5HNNA 3G1SA 1SFLA 1XIEA 1GORA 2C7FA 1FDYA 3OVQA 1MDRA 5CPNA 5AYYA 3WQWA 1LRNA 3WENA 2TYSA 4FSAA 3KBSA 2Z28A 1A5LC 1QW7A 4CQDA 3ZR4A 4ERGA 4S3CA 1RA5A 3BAYA 4FLOA 1LQ0A 2WCGA 5HJXA 1MNSA 1W3TA 4WLCA 4AU0A 3QQ0A 4KBXA 3DHFA 4Q4QA 1PTAA 3W29A 4IT1A 4XKYA 1AH3A 1OVDA 1KQYA 1VEPA 2O55A 4HN8A 5KTLA 4LV9A 3B8TA 5G2WA 1E6ZA 2CYGA 2I9EA 5AHNA 4LJ3A 5AC6A 1K6AA 1H2JA 4KW2A 2Y8VA 2CC0A 4GYPC 4Y9OA 3OP2A 4TOQA 1W3HA 4XBKA 1A4MA 5CZKA 3IIOA 1US2A 1XBZA 2X05A 4KCVA 2XIQA 4HZ8A 4BQ4A 2QLYA 5E0KA 3WH6A 4GZJA 3V0UA 4Z42C 5K4ZA 1CX9A 1KFEA 4G9PA 1K4GA 1Q6CA 3MSRA 4ZGYA 3W6MA 3M5VA 4FX8A 1BWLA 5I5RA 3SY8A 4C65A 3A6OA 3HOJA 1GJUA 2NXHA 1P0BA 5F2IA 4GIRA 1G6CA 3P8JA 2V81A 1LOQA 3EPNA 3GDTA 3NQCA 2QMJA 3V75A 1TA3B 3ZR6A 2DH3A 3NQBA 4RZ5A 3NNTA 4UFLA 4LC6A 3SQMA 2ZRVA 3JZUA 3VD5A 2D0FA 2DH2A 3QVQA 3FOKA 4MZYA 4OECA 4FLSA 4WXZA 1WDPA 1M01A 3KM8A 2Y89A 3SRFA 1YHTA 4XZNX 3DFNA 4M6VA 4URIA 2QF7A 3L67A 3TSMA 3TQKA 2WOQA 1DP0A 3R79A 4DUWA 4I7WA 2G3JA 3II1A 1HGYA 3IGUA 1IGSA 3ZSSA 1YDVA 4ZZ9A 4XG1A 4B5XA 2HROA 1U1HA 2CLEA 3W23A 1SR9A 2PDQA 4GUFA 4HOWA 4H8NA 2E3ZA 4O0QA 1OGGA 2A5HA 1ZFJA 3RR4A 3FLUA 2B7NA 2MANA 3CUIA 3WF2A 1EOKA 2VC9A 2E40A 3ITGA 3DFQA 5HWMA 3LXCA 4AVFA 1XRSA 4JEJA 4EANA 2G37A 4YIWA 3U5UA 3WLOA 2O4QA 3CBWA 3NSMA 1VBHA 2EPMX 2ZKMX 3W7MA 4DJDC 3TEVA 2XU2A 1J10A 3U6WA 1K8CA 3Q58A 3CV2A 1GZ1A 4QNEA 4QJ1A 1L0PA 1IEVA 4UMCA 4PTDA 2O4MA 3EOLA 1JUBA 1XRTA 3K8KA 3GXIA 5J5DA 2PRMA 5D37A 3SCWA 4TVUA 3KDOA 5AC5A 1KR1A 4MMWA 5EB8A 4RZ4A 4CVUA 2IUZA 1F3TA 1SVDA 4GI6A 4Z2KA 1W1IE 4HSOA 1QOXA 2HBXA 1ISVA 1WBJA 5G1YA 3SGZA 4I3GA 2HRWA 1XR2A 4QITA 3GKAA 4DB7A 1OF8A 4RW3A 4W5ZA 4KRTA 1FWSA 4FK9A 5AVHA 1O94A 1EX1A 1BG9A 3W7DA 5DO8A 1DL3A 4KWWA 2FDMA 3HPZA 2QCCA 5H2ZA 1L6GA 2ATSA 4YTTA 3I6TA 4DIAA 4NYYA 4S23A 3H2NA 1LLZA 3WLLA 5A6MA 2F6UA 4LAMA 4E3TA 4OE7A 1MFUA 1GOWA 4KT2A 3LM3A 2QS8A 3LNMA 4NF7A 1YXCA 2ZZ2A 1TPDA 5RUBA 1W31A 1GKPA 4CGTA 2CFFA 4NNAA 2H9AB 7ENLA 4HYRA 3B0XA 3ANVA 2VMFA 2MUCA 1GOQA 2KZHA 3HF3A 3N1AA 4QG6A 1WQ5A 4E38A 2WHJA 4L6HA 4YLWA 1XLJA 3AIBA 3HQNA 4WY0F 2ISFA 4ICMA 3MV01 4KGJA 3GG1A 3FNDA 4JBRA 4EE9A 4W7UA 3NZPA 1J93A 1WNOA 1REQB 3HA1A 1NU5A 4IQDA 4QE4A 1H7XA 4IIEA 1O66A 1DQUA 4RJEA 1ZS2A 3F2CA 1AZ2A 2PDUA 2G0WA 5LHEA 4DN1A 3LX9A 3OHMB 2A7NA 3MZNA 3LZ5A 1J11A 4KMQA 4WGXA 4A3HA 1OX4B 1QPRA 4MWAD 2R1LA 1C8VA 4JTGA 1VHCA 1AJ2A 3GNPA 3WEMA 3CHEA 1OHLA 4P7NA 2FJKA 3NUKA 4NQ1A 1MVYA 4R9OA 1UC5A 3OQ8A 2QPSA 2C1GA 2G3IA 1B5TA 3IVSA 1BRLA 4GX8A 4LY4A 4R3UA 1XC6A 1B3YA 1UR9A 5J04A 2D69A 1SO6A 4JR5A 3P0WA 3BWWA 3BSGA 2PDJA 3B8DA 1HKIA 3WUFA 2GOUA 4JYDA 1EX5A 1E55A 3OLGA 5FJIA 2JE8A 4DZHA 3KTSA 2XYLA 4OBTA 2Y0FA 5LZLA 4X61A 5DCBA 3TXZA 2VELA 1YTEA 5FA5A 5T91A 1XIDA 1N7KA 4C6LA 1G4PA 4C6BA 1GZJA 4Z17A 4XVDA 1UOZA 1IV8A 4KQNA 4JFWA 2BOEX 4OWGA 3VIPA 3IRSA 3H8AA 2C3ZA 2RDUA 4ZODA 2PS2A 1TTIA 3AMLA 3EWZA 1EP1A 5CC6A 2GVGA 3I7SA 3WUBA 2J75A 4A4AA 3RK8A 4RZBA 3NEVA 1IZKA 3P60A 3RO8A 2F2HA 1R3WA 1V79A 4JL1A 2J4GA 3NO1A 3VNJA 8CGTA 5TBOA 1VFUA 4NL1A 4H00A 3W2LA 2WVVA 4WDXA 2BHUA 1UUMA 1TZ9A 4HMNA 3S1UA 1QUMA 3AWNA 2Z7KA 2V30A 4IMGA 4LWWA 4AZHA 6XIMA 1O5XA 4KWSA 5K9DA 4JTEA 1XLDA 3CZGA 3ANUA 2ZC1A 1UBSA 3VD7A 1YTDA 3D0CA 2PDWA 4E4PA 1E15A 1FP8A 1QWGA 3AS3A 4WKHA 2B81A 3SN4A 5EY5A 1W5QA 4B3LA 3SFKA 7CGTA 2A3EA 2IQ0A 4KIRA 3EEGA 3D5HA 3W1TA 2FPVA 2NUXA 4UTWA 3PG8A 4FNPA 2QVNA 5BWAA 1ISYA 5FAJA 4RDZA 2DSZA 2IXVA 2NUYA 2QQ6A 2WW5A 4K36A 3H2CA 1JRCA 3KBMA 1Y5WA 2OLSA 1OEPA 2W27A 3IRDA 4JY8A 4ZO6A 4L5ZA 1JDAA 3LPFA 4QQUA 1B3XA 1V3IA 3HPXA 4ZOCA 2A6NA 4N4PA 2G97A 5AHLA 1J0YA 1MQPA 4LU0A 1HL8A 5BMWA 1HKJA 1WZLA 1AFSA 1FHLA 2O0TA 1CB2A 1TMQA 4D6CA 1Q2RA 2BBFA 4KEMA 5TIMA 3S2NA 5HK4A 2L5HA 4C1LA 1FWHC 3K4DA 4M3PA 5GNYA 1TE1A 3T1GA 4DWSD 3DECA 2WM0A 3WD1A 1NEYA 3UYIA 2E5BA 3I68A 1K9FA 3VXGA 5C71A 2I5QA 3CK5A 4QNWA 4BWLC 1DTUA 1VBGA 2J24A 4QCEA 3RITA 3OGVA 4W85A 2WHMA 2YLLA 3OG2A 5A94A 5T26A 3AXIA 4HZMA 2PC4A 3UPMA 3MHUA 3PTMA 4LY8A 3WX7A 1RP8A 3DFTA 3L5AA 3A47A 4XIMA 2VUNA 3OZMA 3O8AA 1ELSA 3EMQA 4XSMA 4D1IA 3LS9A 1PDYA 1XKYA 3B4UA 4NJHA 2O56A 1JCLA 1EGZA 2GWNA 4PUNA 1OFEA 3LV5A 3TOYA 3AMCA 3VYLA 1VEMA 2VGFA 2AMGA 5E9AA 1MQRA 2WJDA 4M6UA 2RGLA 3A4WA 3DN5A 4R7WA 1Z32X 1VFFA 2FQIA 2QGHA 1XIMA 3ABZA 4RLIA 4HKPA 2J7GA 2VEGA 3NQ8A 3G24A 2X1IA 1KFCA 2VC5A 4PUDA 4C60A 4J3SA 4XISA 2HS8A 4O4VA 1OC6A 3TAKA 3M16A 3A24A 1RUSA 4GYPA 4RE0A 5DBTA 3TMQA 3EOOA 3GKFA 2XIBA 5F4WA 3NL3A 1O6IA 1TX2A 3R8RA 4ZQPA 2A7PA 3FCPA 2NLIA 4EXBA 2AKZA 3WNKA 3L7RA 1V3HA 3WK0A 2QDDA 3VM7A 2XH7A 1NDWA 2V68A 5FACA 2VR4A 5BCAA 1Q6RA 5LYRA 3TUUA 1XW8A 4JZ5A 1SFSA 1XYBA 4AW7A 3P80A 2ZYFA 3A3XA 1QVBA 1LQ2A 5EFDA 1V6XA 1EZ2A 1UD5A 1ZNNA 3BQ5A 3EWCA 5IRPA 7A3HA 4PSRA 4L6DA 3PZUA 2R91A 4LB3A 3HGOA 3W24A 4ZQRA 1XWYA 2VCCA 2FPTA 3PJTA 2B31A 3UVIA 4GFIA 2GSJA 4GVGA 4GPNA 4FIQA 3PZQA 3KEHA 4AWTA 3H53A 3W1AA 3E0IA 3NJ3A 1QK2A 4P8WA 2YKKA 4OZOA 2BVYA 3CEUA 3GG8A 3LPOA 2WZHA 4F4RA 3IWPA 1OFAA 3WBAA 2YJQA 2XJ7A 3N29A 2E6YA 4C6FA 3HURA 3H7UA 5FF4A 4HJFA 4ACZB 5E1QA 1ZJAA 5FF2A 1GYNA 3SGGA 2UY4A 4H6RA 2I5GA 3MJYA 1L6FA 3U0HA 3A9BA 2RH9A 2RDTA 1NARA 2QCGA 1G4SA 3F5LA 3S3GA 1CEOA 1E70M 1XRVA 5C70A 2XFWA 2AGKA 4K7YA 3TJLA 4NNCA 1HO1A 1RXOB 4Z1CA 1FWTA 2A3LA 1YADA 2PTWA 2E0PA 4HGXA 3WH9A 4GH3A 1ONXA 4DJDA 1XLLA 2WSKA 1DIOA 4ZENA 5ECUA 2OZTA 4S3DA 1TV3A 1TREA 1EUNA 2WNNA 3GDMA 2VGGA 3R1ZA 1E56A 1YDYA 2WZTA 4N9EA 3E49A 2OSXA 5B7ZA 3VZYA 3M0IA 1I0BA 4WKFA 4F0MA 1R2TA 1LJYA 3MMWA 3AMDA 5D2TA 1S5MA 2J8FA 1UASA 4LCQA 3LCFA 5CZTA 4BI6A 2OT0A 1DWFM 4MUPA 3STFA 4WOZA 4Q22A 4BF9A 3OVRA 3BXWA 1UWRA 3EKGA 4YS1A 2GPTA 1QPOA 3LBMA 2WSPA 3S4TA 3BLFA 5D9NA 1XF0A 3TLLA 2FVMA 2NQHA 2Z6IA 1VAHA 4U33A 2R8WA 1HVXA 4K7VA 4U4MA 1X8FA 4DJFC 1IR2A 4O57A 4UR9A 1GHRA 3W7PA 2PDNA 3RFAA 1Q6OA 1VLIA 3BZGA 1E9LA 1UD4A 2F9RA 3ITOA 3WMBA 1GQLA 2XVNA 3WZ0E 3NPUA 3ABRA 3CAKA 1QT1A 3LLDA 5D2XA 1S39A 4B3KA 5I3FA 4E6MA 5M03A 2IXUA 3VE9A 1EP3A 4JS3A 4DBUA 4UXDA 4S3GA 5F2MA 3R8HA 1U83A 4UFIA 5DT7A 2ZXDA 2EPOA 5CG7A 1EL3A 2F61A 1EIBA 1YXDA 2CPUA 4I9AA 2AL1A 5AHEA 1FHUA 4GIAA 1F73A 3MQTA 3W76A 2V69A 2AQVA 3GFXA 4LFYA 1UWTA 3PFMA 5A3HA 2OX1A 2F38A 4LOCA 3VVGA 5CG0A 1WBHA 3MMUA 3CPGA 4KCWA 5GNXA 1KV5A 2NV2A 4FOJA 3IPWA 3C2VA 2FGZA 3JZEA 2WPGA 4NZ4A 4H9TA 4WKAA 4K39A 3VGEA 3CQIA 3CO8A 2NXGA 1DWHM 3RJYA 4JX5A 2ZX6A 4ATDA 3UESA 4BK9A 5AZ1A 4NILA 4PCSA 3F4WA 4H9VA 4HZ6A 2H9AA 4ZB2A 1MW1A 1FQ0A 3NO3A 1KXHA 3SRDA 2J66A 2VP8A 4B92A 4C7GA 1AMYA 4NZFA 1HJWA 1VR6A 1K8XA 1EXPA 5DMLA 2OJPA 3VGBA 1MNZA 3TNBA 3MA8A 1T40A 4NVTA 3LMYA 1Y7VA 4AIBA 5D32A 1RY0A 1X6LA 3S8HA 4JY9A 5B80A 4IGNA 4B15A 3M9YA 3MUXA 4UFJA 7ODCA 1MXSA 5L9FA 2C71A 7REQA 3CASA 3MP4A 1FHVA 1XBVA 3UZXA 3WCZA 1PTGA 3U2OA 1TTQA 4JTUA 2YCKX 3KWXA 4NZ1A 1CYGA 3H2OA 1V02A 3BLDA 1MW3A 5C9WA 2BTMA 5I7GA 1BLIA 1CGTA 3OO2A 2XSBA 3B3DA 3FEQA 3TTSA 1LDCA 1A80A 3QLLA 4QS6A 1YPIA 3MMTA 4HHMA 3KRUA 2GGJA 3BW2A 1W6TA 5I2UA 2PF0A 1GG1A 1GEQA 1U22A 4B2DA 1LLWA 3M0JA 3VNIA 2YBUA 3T07A 2GQ9A 3EWXA 1Q8JA 4AZBA 2WNQA 3UU0A 4FO4A 4WIWA 4C6JA 2WO5A 3TN3A 3T0TA 1KB3A 3QHMA 5HINA 1KKRA 4HOZA 4N4QA 3E38A 4IQLA 4XD6A 3ATYA 2CLLA 1KM5A 4HYVA 3H2EA 3G8RA 1W5OA 5FEPA 1PSCA 3COTA 3SDOA 4RNJA 1CXFA 4YHGA 5LNSA 2E6FA 1V3LA 1UR1A 2W91A 3C8NA 3T0AA 2CESA 2FZNA 4IP4A 3PJUA 2DORA 1XIHA 2PRLA 5HR6A 4WD0A 3W7NA 5IBXA 4DO7A 4KF1A 5A2AA 1TJPA 4JQAA 4A21A 1R3QA 4JCLA 3AIVA 3M0YA 1KFKA 5ABHA 3JR2A 6TAAA 3ES7A 3VGDA 4JICA 4ZA0A 1TV5A 3UY7A 3P82A 4XK2A 3IJIA 4PUJA 1MDLA 3NSXA 3ELFA 1GOXA 4XV0A 3KBNA 2PDYA 2IKIA 3I7QA 5IHSA 1BG4A 1TPWA 3L65A 2RKXA 1EGMA 4DEFA 3U4AA 1UW9A 1JZ3A 5G1TA 1EO5A 1V3MA 3O3RA 4RNIA 5FJTA 5CBIA 1OBAA 1BF2A 4J5NA 2Z2UA 2ABBA 4PB5A 3KRSA 4QDPA 2G41A 3C0SA 1E4IA 1KTNA 4UZSA 3ZFHA 1IIHA 2AL2A 1I60A 3WDRA 1LRTA 2EJ1A 1EJRC 2CXGA 2OELA 1OQFA 1MRAA 2VRJA 2ZE3A 3QOKA 3ARYA 3WBWA 2DSVA 4PUUA 1SJCA 1TUFA 3VDGA 2HXTA 3M5ZA 1GKRA 3IJ8A 4RKAA 4LYKA 3RMJA 3ZYZA 1Z44A 1NAL1 4US6A 3QM3A 3TR2A 2PLJA 3ITTA 3K8LA 5AYXA 3S2JA 3DDMA 2J7HA 5D8WA 1E71M 4N9BA 3HGSA 2W5FA 3O07A 2Q3OA 3BARA 3PSVA 1W1ZA 1BYBA 7REQB 2DU2A 2ZWZA 4S2BA 2J9XA 3W37A 4IP5A 1DOSA 1T8QA 1ISWA 1XBYA 2KAUC 4C7FA 5HMSA 3UCDA 4PYSA 1F6KA 4TMBA 3BVJA 4G7EB 1DEDA 4AZ6A 3KS6A 2PBGA 5LIWX 2Y70A 3N6QA 4O1BA 3G3DA 3R13A 2TPSA 5CJ5A 3K1GA 1FHDA 4TU1A 4XD3A 3SW6A 3DZ1A 3KCOA 2MNRA 1WUFA 1Q6LA 1VPXA 2WKJA 5AFDA 4LVFA 2BODX 5A6SA 1F74A 4XQ6A 3ARPA 2XIIA 1HXJA 4KWOA 2VUYA 1XUUA 1QMLA 3T8QA 1E6QM 1E1CB 1GNXA 1GVEA 3HTWA 2BFGA 1H1YA 3M44A 3WQ4A 4ZFMA 1VFTA 4O4WA 1ZSXA 4EXAA 4HQVA 3GYCA 3UJ2A 2PGEA 3XIMA 3T81A 2X1UA 3AAMA 1W32A 4EPKA 4C6MA 3CM4A 2OLHA 2ZRWA 2CLPA 1RV8A 2NX3A 2R82A 2BLEA 4CN4A 4RE4A 1OCJA 4MNMA 1PHQA 4UCGA 1DV7A 4Q33A 4AF0B 4ADTA 2BY0A 3CHFA 4RCXA 4D6GA 2J8GA 1HJVA 3WFZA 3BGJA 4E4UA 3LTSA 3TONA 2QPUA 1W0MA 3TWBA 1BWVA 2ALRA 4P7QA 4LS0A 3WDPP 4G1NA 3B4YA 1R9YA 1FWWA 1YDNA 1J2BA 3T09A 2DJXA 3THQA 1PS9A 1AQHA 4YTRA 4GHRA 3GBDA 2OFJA 5C55A 2EF9A 1PKMA 1QI0A 1XRFA 3Q94A 4G5DA 5LA0A 3MO4A 3LHYA 3MCOA 2ZX8A 1OABA 1OYAA 3BE7A 2JEPA 4ORMA 5KITA 1JIBA 1M41A 5XIAA 3CUZA 4IXXA 2WLYA 5H8PA 2ACQA 4TX9A 3KX6A 2DZTA 4LYRA 4YWSA 2ZZ1A 1RHCA 2Y4SA 1JVNA 1E40A 1Q4WA 5I06A 1ZP4A 3ITCA 3V5OA 1FX6A 4IPIA 1BYAA 2NLYA 1FWIC 2W63A 5I02A 3IK4A 3MDWA 1QI3A 3QZEA 5JQ9A 4M8UA 2TSYA 3KVKA 5H91A 1UA3A 1CZ1A 4BEUA 1GGOA 4ZE4A 2OQYA 1KKOA 4QCFA 2GDVA 5F1UA 1TQXA 2J7EA 3TQPA 3M0ZA 1J2WA 1OFDA 3B03A 3HZ3A 3QKEA 3W25A 4UR7A 4HPGA 2QPXA 2HBVA 1MEWA 1JGMA 5G2IA 1OIFA 3CUJA 1MEHA 1QPNA 3ZWTA 3NZRA 4GO8A 4WXYA 2ZRZA 3VMOA 3M41A 4I6VA 1XLAA 5LIUX 2DSUA 5CAKA 4QEHA 3SCUA 4IPPA 3SUWA 5BU9A 3UT0A 2ZXAA 1ME8A 5REQA 3WSUA 1I2RA 2DV0A 3L2MA 1W5PA 4GKLA 2VX6A 4TQTA 3PZIA 2X40A 2GQAA 2DQXA 5M1TA 2QCDA 2RJHA 5BW6A 2UBPC 1WX0A 1ZBKA 2Y85A 3PJXA 1NY1A 4IUGA 3IANA 3OGSA 3VUPA 3L4VA 2V3FA 4J2MA 4YVPA 3B40A 4A8LA 1YPXA 4JNZA 1XGEA 1VIWA 3TN4A 2DUAA 3T0DA 5AC7A 1JZ5A 1JZ6A 3UWYA 1QO2A 1N8IA 4J40A 2BVDA 4FHAA 3IIZA 4L56A 1UHVA 2XZ7A 2G50A 4H9YA 4J35A 4ZOBA 4O1EA 4IM4A 1EOMA 1P5BA 2DZXA 2QCLA 1PJ9A 1UD6A 3NDYA 2GQ3A 4HN4A 4XIAA 3BDKA 2XIOA 4FEZA 1J18A 3WJZA 4GQ0A 4LRSA 1LZOA 3LV6A 3RJXA 4GY7A 4OBSA 5CSYA 3ARVA 4ROPA 2Z25A 1QCWA 1M7XA 2WSRA 3SURA 1BXNA 4H83A 2IKGA 3UCCA 5KSWA 2W79A 3VKBA 4CD4A 2ISDA 2F8QA 1QOQA 3R12A 3E6EA 1V51A 4S3EA 1LBMA 1TPUA 2QW5A 1C3FA 2INFA 1P43A 1BPLB 4GZ7A 1R9ZA 3W72A 3HIJA 3GG0A 3S9YA 1O5QA 5I0DA 2XZ9A 3H23A 2QUNA 2HK1A 3H24A 4PCTA 2BXZA 2OR2A 1ME9A 1IT8A 4KFOA 3SZ8A 3EDJA 5FOOA 3HB9A 1R5YA 1NWTA 4EPEC 3GXMA 3KBVA 3TNOA 3FJNA 3GXNA 3Q37A 1FUYA 2CLKA 4HA4A 2YIHA 1F4HA 1VJSA 3IS4A 3IUDA 3W7KA 1V6TA 4REQB 1VPYA 4O12A 1H49A 3IAPA 3KAOA 3OVPA 3ZVHA 1C9DA 3DYMA 4AYGA 4RW5A 5CZJA 1W2PA 1GW1A 2HQAA 3R11A 5D33A 4IG2B 1ZBWA 4ZB0A 4H01A 3R89A 3PB2A 1LM1A 1RBOB 2TAAA 3PBUA 2ZXQA 3RX4A 3CZJA 3EA1A 4MM1A 3A9IA 3AFBA 3N13A 4TXEA 3HO8A 1R9XA 2B4GA 5CC7A 4NX5A 4MDOA 3S46A 1OJXA 4Z0JA 1DBTA 3UGRA 1XIGA 3MS8A 5G4WA 3WH7A 1US0A 3MUZ1 4AC7C 2W92A 4NI3A 2Y2WA 2D1ZA 1FWDC 3UZ5A 1W56A 5A8GA 2GSHA 3QZ6A 2C91A 1SU5A 1L2QA 4LBSA 5BRPA 1UZ4A 1S2UA 3W38A 4UTTC 2V82A 2PBOA 1CW2A 3GHUA 6XIAA 1T6MA 2J88A 3N9KA 1B0IA 2PLKA 3UEQA 3BAWA 4HHLA 1HG3A 3GLCA 5AC4A 1H5VA 3UJRA 3QGKC 3DXIA 3MHGA 3EAUA 2V9DA 2ZIDA 1HO4A 4FX7A 1OYCA 5TD4A 3PZTA 3SI9A 3GFYA 1HNYA 1Q7MA 2PC8A 3ALFA 4QE1A 4DUVA 1TJ2A 3PTQA 4PMUA 4LUJA 4Z2JA 2PRHA 1OK6A 2Z7GA 1GVSA 3MCNA 4U31A 3E74A 3RPDA 4LYPA 4MAZA 2XGZA 2JKAA 4C7DA 5CLWA 3O15A 3SR7A 4HA1A 3A3HA 3RDKA 5CGMA 3LLXA 3RU6A 3CHVA 3TJXA 1XLEA 1AD4A 4PZVA 4JQ1A 1S3TC 2YDQA 2Y7FA 4UBPC 1HL2A 4DHGA 1AQFA 6REQA 3PZ9A 2UV8G 4PRTA 3OYZA 1T8XA 2DZAA 3VOHA 5F1VA 2VEMA 4JFUA 3T0CA 1QPKA 3VILA 2DUZA 4WJ8A 1UR3M 5GJPA 4J3TA 3EDDA 1AL7A 3GW0A 1PWMA 2V3EA 4M81A 1OD0A 4JHZA 1J9YA 3ERPA 5BU6A 2I17A 3L23A 1R3SA 3TR9A 3CUXA 4EPDC 1K7FA 4LS2A 1YNQA 1ZAIA 3MI2A 3UQNA 4PR4A 5DBUA 3PBWA 1LOSA 2ZZ3A 1P6WA 4P8UA 2DSWA 3B9DA 3SRHA 1Y5XA 4C5YA 4DBSA 2XM2A 3PB0A 1D7FA 3AIQA 1F8MA 4K37A 4D6JA 4D8LA 3KCJA 3ZR5A 2BMBA 4GABA 1OM0A 3QLDA 2AMXA 5CSRA 1KFBA 2A3CA 1EGVA 3WQCA 3MHFA 4C6EA 3ARZA 3D6NA 1F3WA 1DJWA 4KFNA 4LTSA 2F7FA 3VCCA 1MI3A 3F2DA 3EBVA 4JTFA 1TPC1 4TX6A 1HT6A 1EC8A 3NA8A 2ZZ6A 2ANUA 1GEHA 5LGXA 1F05A 1OYBA 3ABSA 1DJXA 4DUXA 2HISA 4UB9A 3PZNA 2FB3A 3TLQA 1GYLA 1H09A 1BQCA 4V2XA 3URQA 3C52A 3R4IA 4MGGA 4AISA 4M1RA 4PFHA 4PCPA 3VIJA 3G1DA 1EJUC 2A1YA 1AJ0A 3APTA 2OEMA 3K8MA 2E7FA 1BAGA 2AQOA 1GJWA 4HPXA 1UWUA 1H41A 3LGEA 1BKSA 2Y7EA 4TTGA 1FWNA 3VD4A 3CTTA 1SR0A 4BJHA 1REQA 3N2TA 4Q7IA 1GVRA 3REQB 2YZRA 4QEEA 3PAJA 4M6PA 3NOEA 4Y9PA 4IP7A 1V0KA 4LX4A 3SN1A 2YYTA 1EJTC 4PSPA 5HXMA 3MW7A 3GAYA 4Y6GA 4JKMA 4E3VA 1H63A 4FNSA 1YBQB 4F0LA 4E2VA 4MDPA 2FZ8A 5ABEA 1X7IA 1JZ7A 1UIOA 1JDFA 3AICA 4PGLA 3W81A 1WKYA 2Q6ZA 1OZQA 5FF0A 2WLZA 1OFPA 1Q7QA 3NM1A 2Z26A 4IISA 5MKGB 2EO7A 1XDMA 1HJSA 3WNLA 2EGZA 3S2CA 4N0RA 3WF4A 4L4MA 2ZUTA 5H8MA 3V3WA 4XO7A 1VFLA 4L61A 1D7KA 5DMYA 4ERAA 4TR9A 2I5IA 3OW1A 4PMDA 1ODUA 2Z29A 3VTRA 3P8IA 4HU3A 5C9XA 3FIGA 1UH3A 4GY1A 4PMQA 3LK6A 4YTQA 3WNNA 3WO8A 1FCBA 1YBQA 4N7QA 1WOBA 4PMYA 4W84A 2P0IA 3LHWA 3VKAA 1JXKA 1CGVA 3GAKA 3FYPA 1QNVA 4DX3A 3EXSA 1E0WA 3TSBA 3VC5A 4YPJA 2CNCA 3PPFA 4A3YA 3TSDA 5DCEA 2V3GA 4L65A 2WCAA 1RD5A 5AB3A 3UERA 3RM4A 4GY0A 1W1PA 1H51A 1JR1A 4J7RA 4AY8A 3AS0A 3G22A 3HFTA 1GWJA 1MSSA 3NQFA 3BANA 1H7OA 2GGGA 4DI9A 2OKOA 3C8FA 1MEIA 3MY9A 2J7BA 3MSYA 1VHNA 3LXAA 2VZUA 3C5QA 2ZUWA 4OU1A 1K7XA 1M3UA 4GQBA 1VYPX 2BY3A 3VKJA 1IXQA 4PODA 3DG3A 1KWKA 3PPCA 2I1OA 1FH7A 4Q8NA 2J7FA 2F84A 3F4DA 2ZXBA 3GVGA 2VFFA 3WQDA 2WNWA 1E72M 3NSNA 1XS2A 4EP8C 2ON3A 1IEQA 2OLAA 2UWFA 3WDJA 1VFSA 5MHBA 3HJZA 2YBVA 2CITA 1YW1A 3BL3A 4P5UA 3FAXA 3A4XA 3BOFA 3UPWA 2QDGA 3BO9A 1ZY9A 4V1XA 4E8GA 3WBXA 1TPB1 1J0KA 1K03A 1MUMA 1ZENA 4PMJA 4JNYA 4CNNA 3STPA 4US5A 5HJYA 1FA2A 1E3XA 2WK2A 3GU9A 1JZ8A 1HZYA 1A5MC 2XG9A 4LEQA 1TTPA 2CEQA 4AUBA 1WYIA 3LD5A 1TMLA 2Q3RA 5BXSA 2PPGA 3OA3A 4OGZA 1B30A 4ZSUA 4B2DD 4JIQA 1J0HA 1CGUA 2VFEA 4W93A 4PFMA 3BK0A 2VZVA 1X1ZA 2JEQA 4CU8A 1Z69A 4Q8QA 4DF0A 2CCRA 5D2YA 1TUXA 3IUIA 1XPYA 3LM7A 4NX0A 1PHWA 4L4LA 3AJXA 4AY7A 5A6AA 3WL0A 3GXPA 2DT1A 1NDYA 2VCAA 1TVPA 2VTFA 4HP5A 4GUJA 6REQB 5HUPA 1I2PA 1CXEA 2Z0IA 2OZ0A 1M04A 4B9ZA 4EX4A 1PDZA 4QDMA 1HX0A 4PMNA 3LBCA 3AYRA 3EOSA 3H26A 5JIWA 4RL3A 1SJBA 1TQJA 3HBLA 3TYCA 5EPDA 1M7PA 3WQ8A 2INEA 4C1KA 2X7VA 2TRSA 3CGTA 4BR1A 4AWUA 1NSJA 4OHQA 1YIXA 5D03A 1EO7A 4LSBA 2FVKA 4CCCA 1P0EA 3NQVA 3L0GA 1IGWA 1OFQA 2PP1A 2E8YA 3HG4A 4JQ4A 1A5CA 4PMZA 3B8WA 2OSWA 1JJKA 1N82A 2PMQA 3V5CA 3SCQA 4CQBA 4PRRA 2C19A 2PGFA 3QGVA 1FVPA 1JYNA 4FNRA 4QAIA 3S6DA 5C2CA 1E73M 1WXYA 1XISA 2CZVA 2OWWA 1K02A 4JYFA 1IT7A 3WIJA 3JVAA 1JCXA 2V2CA 4KWUA 3MC5A 4CVWA 4M1BA 3GM8A 5CAHA 2DT2A 3MSDA 3BV7A 2PWEA 4FOUA 5TQLA 4ZR8A 3NPXA 4H3DA 1F76A 3G3MA 4DAIA 3WDIA 3W02A 1PZ1A 1GQNA 1X6NA 3H4WA 4IMEA 5DY2A 2Y5SA 4TMCA 4ERIA 1EIXA 5T8GA 4IX2A 1J79A 5D9PA 3VGGA 5KEZA 1WAWA 2A0NA 1WAUA 4DWSB 3P67A 1L8NA 4JTSA 1YXYA 2ISWA 3OB8A 3LPGA 3ARWA 2DW7A 1S2WA 3NTYA 1GYMA 1UQYA 4HPJA 4ATLA 3OBAA 2C16A 4YTUA 2ZFAA 3CH9A 1EJSC 4P2VA 1UD8A 1E1FA 4MYXA 4Q4OA 4WVXA 1KTCA 4JHMA 4QP0A 1M6JA 5JH1A 1RK6A 3UETA 5BMXA 4IPNB 3LDVA 3GY1A 4KETA 3WJYA 3CIVA 3EA2A 3I4KA 3QN3A 1Z89A 4MAVA 1UP2A 3BAIA 1TMHA 3AROA 1LQAA 3CL7A 4OBRA 3AOFA 4UNIA 1BRLB 4UTWC 4WDUA 4UTHA 1F5ZA 3A12A 1FBAA 3EWWA 1QU4A 4NZ3A 3MKKA 4MJMA 3SCTA 3G1RA 3MP5A 4YJ5A 4NSBA 1MRQA 1F7BA 5FJUA 1DHKA 2DVXA 1XG3A 3QTPA 4QISA 1NOFA 3DBNA 3VMNA 1I9CB 3VPLA 1Q6EA 4O0KA 4UOQA 2G3NA 2C18A 4AD4A 2XH0A 2EG7A 1LYXA 3ZJ7A 1V3KA 1A5AA 1ZUAX 2H3BA 3LYEA 4L1WA 3DKJA 2PLCA 3N3TA 4QRNA 2XPKA 1NOUA 1ZBVA 1SFJA 2EBNA 2CW6A 3LEPA 4XAZA 4QBXA 2V8ZA 3N4EA 3T4WA 3EXTA 3SECA 4O52A 1FDZA 3T2PA 1HW6A 1YDOA 2QYGA 3W9ZA 4E0CA 1QI4A 1VLWA 4G56A 3OJGA 4J9JA 4V1YA 3W70A 4AXKA 3RHGA 3IJ9A 4O50A 1I2NA 5FAGA 1KM1A 3UXKA 2PDPA 1RJPA 4XKYB 3LBOA 2IMRA 5IM51 1TJ0A 4RV3A 2X2YA 2I9UA 4XZMX 3SAZA 3TC6A 4L9YA 3NEHA 2Q09A 5BYWA 4WGHA 1SGJA 5HNRA 2PDBA 4DLFA 1QXLA 4QSHA 3TA9A 1CLXA 4IJBA 1NP2A 2CLIA 4Y7EA 4F40A 4HSHA 4JN6A 4JAWA 2VEFA 4A8IA 3W1LA 2X7WA 1X1OA 3M0KA 1TJRA 5FI8A 2CBIA 3OTRA 2IQDA 1TFVA 4H1ZA 1ITQA 4TV6A 3BSHA 4C6KA 3BG5A 3PHAA 2XFFA 3IVUA 1OFRA 5AY7A 2QCDB 1LOLA 3TYEA 1TRIA 4DRSA 5L6UA 3N25A 5D05A 4RK8A 5LXEA 2GDQA 3BLIA 1RK5A 1LLOA 3IJDA 5EBAA 3MVIA 1I0DA 4QHRA 5LNWA 2WKLA 4M7SA 1VYRA 1SW3A 1C9WA 4N02A 1K9TA 3TDFA 2VFDA 3BMXA 4X0VA 3ORWA 2PDLA 2OEKA 1XYCA 3KTCA 4GUHA 3AO0A 3IEBA 2GQ8A 4CUCA 3ITYA 4UNLA 1S5NA 1ZHAA 2ZUVA 4JTAA 3IIXA 3N2MA 2QJHA 4GVHA 2OSYA 3VZXA 1PE1A 1TCMA 3VDBA 1A0EA 3NQMA 4L9ZA 3M7SA 4UTJA 3W7JA 3NQ6A 3TJIA 4GE8A 3WY1A 2A21A 1P0DA 1P0KA 4ORIA 2WWDA 1K9DA 2CLHA 3W7HA 4LUYA 1ODZA 2DZPA 4UOZA 2E6AA 3OA5A 3APGA 1LORA 4KPLA 1KO0A 5AYIA 2Y61A 4J1OA 1WUEA 1B57A 1Y8BA 2GZXA 2QDEA 1T5AA 2Y8UA 1DJGA 1FH8A 3H70A 3DYPA 2PP3A 3EXRA 1NM9A 1VZWA 4DWSC 5I6SA 4H9XA 1GTEA 1DJHA 3R8GA 4BA0A 4ALDA 4BEQA 1NVMA 1KCLA 1SZFA 1EBHA 1RLDA 1OFBA 1A3WA 2ATMA 3KVLA 1O60A 4L4PA 3OBKA 1A5UA 5KZDA 3W0KA 4AZ5A 5CH9A 4IIHA 5FD0A 3NZ1A 3W7CA 3WDHA 2E6DA 4D6DA 3WD2A 3AXKA 1FY6A 1D3HA 3TROA 1Q85A 1GVYA 2BVTA 3TOPA 1FRBA 5E5CA 1UH2A 4XZIA 5HR7A 2X41A 4C6DA 3W7IA 2WBKA 4QJ3B 1TV2A 1ZU8A 3MI3A 1XD1A 3DIPA 2ZA1A 2FTWA 2P88A 3TW9A 5JBDA 3QMRA 4D8AA 3HM7A 1M68A 5H6HA 3HQOA 5BNKA 1WDWA 3H55A 3UNDA 4XWUA 1O12A 2YW3A 3SCPA 3LHVA 2WV8A 1WZKA 2VX7A 3NWRA 3QV6A 2NQJA 5AECA 4X2RA 1TX0A 4NAFA 5FL0A 1UKPA 2OX4A 3QFEA 3W4RA 4DJDD 3EWDA 2GK1B 4RPQA 4H9UA 1L9WA 2VI0A 1F3EA 1IEIA 1QWKA 2QJNA 4GJIA 2CLOA 3TCSA 5TNVA 2FMNA 3FXGA 1OFOA 4RXFA 2XHYA 2ZX7A 3PS7A 3GC4A 3TFXA 2JGQA 2QUTA 1A47A 8A3HA 1HJQA 1XHGA 3RRAA 2WB5A 3EB4A 3URBA 4P8VA 3P2VA 1GVOA 1W3LA 3BC9A 3UCQA 1GQIA 1TPVA 4JGDA 3TQVA 4I7UA 2H8ZA 1W9PA 4X3ZA 3SCVA 2WCSA 3IJLA 3AYSA 3VDAA 3NPWA 3WJWA 4DZAA 4ASTA 2ZRXA 3ECQA 4BY3A 4BQ5A 1UR2A 4CNPA 4D8ZA 5BOOA 5LIXX 1W3JA 1XIIA 4GWEA 3B05A 3U57A 1M5WA 2ZDSA 1LT7A 4XSLA 4DJEC 3V16A 3WNOA 5CPMA 4PMVA 2QAFA 1H62A 1TVNA 1ZL1A 6A3HA 2QULA 2EEXA 1JL8A 3R0DA 3C0LA 3G5EA 4QLKA 1UQZA 4ZEPA 5DY3A 4UTUA 5EKYA 3MUAA 4V33A 4K8GA 4C1NA 4YMZA 3CL8A 4EAYA 2AL2B 3EWBX 1YNPA 3PZVA 4QM1A 3WD4A 2W3ZA 3CUFA 3H4GA 4W5UA 1EQPA 3FS2A 5CSSA 3UYCA 4AVOA 3ABXA 3AHZA 3G0SA 1F9CA 1W2VA 1V02E 4M51A 4ZO7A 4UMBA 3SQLA 2CZFA 3AS1A 5CEWA 1YLVA 3W6LA 1ZB5A 3EDKA 4I9TA 2FIQA 3T4CA 1VYSX 4X9SA 1OC7A 2WVTA 1OCNA 1JG9A 1YMYA 3E1F1 1THFD 2PCQA 3IUHA 1LP6A 4POCA 2G4FA 5HNTA 1DJQA 3VKDA 4PTNA 2O7SA 1IXNA 3NCOA 4LCRA 3QXBA 1JZ4A 2CBJA 3TE9A 3W1XA 2FZDA 1ZJHA 1Q8AA 1TVLA 6TIMA 5HULA 1F6PA 3N2BA 4R88A 1TA3A 2VFIA 4ZVJA 1TG7A 4GINA 4NIRA 3W7RA 3LOTA 2XVLA 1UA7A 4JIPA 2GDUA 2XWDA 3H54A 2B0MA 5AHIA 2P50A 3OGRA 5CC5A 1HKVA 4F48A 3FSUA 3MBDA 4Q6JA 3LI0A 1J6PA 1XIJA 3MPGA 2Z00A 3DI1A 3W01A 3PBVA 2X0SA 4MY1A 2BB0A 1BD0A 2Z24A 2LLEA 3HV9A 5HNUA 3M07A 4ZXOA 5FL1A 3AHTA 4K8HA 4JNMA 4TTUA 1ZCOA 4F0HA 4Y90A 1B9ZA 4RNFA 3N12A 1R87A 1S2VA 4S2CA 1K8ZA 4CQAA 4MKVA 3N4AA 5EGRA 3HU7A 1C8YA 2OO6A 4JEQA 2CXEA 5LNUA 4PL2A 2D2HA 3LXBA 2YXGA 7TIMA 4EIVA 1E0TA 4JIRA 4HD5A 2R1KA 1B90A 4KKXA 3S9IA 2VGIA 2BV9A 3PVFA 1XL9A 3H21A 1EP2A 3N9RA 1C7TA 2JF7A 1B3WA 4DWDA 3N34A 7TAAA 5A6BD 3RF9A 2NQ5A 3WLQA 3W74A 1GJPA 1XLHA 1OZMA 1U1JA 3TKFA 4FF5A 5CZSA 5ABFA 1QFEA 5EMMA 3B8UA 3QYQA 2NVAA 3GVVA 4JTRA 2VX4A 4LAUA 4Z1BA 3W1NA 2FYMA 1D8CA 3QYSA 1BVZA 4Z2IA 1SPQA 5D04C 3BG9A 3VNMA 3CJPA 5AOUA 1V0NA 4AMAA 3RXZA 3NQGA 4OT7A 3OG3A 3NAVA 4GI9A 4Q4PA 1UROA 4H6KA 2NQZA 4L7ZA 1H0IA 2GUYA 1EC9A 3WJSA 2HXUA 5ABTA 5KZ6A 1QBBA 3B0UX 2W66A 5DT5A 3CL6A 1RSCA 2D2OA 3KL0A 3L66A 3LN3A 4PTWA 2BXVA 5DLCA 5JU6A 2X1RA 8XIAA 4DBWA 5K9CA 4XTDA 1JNEA 1TTJA 1MW2A 2Z1XA 1TB3A 3TA6A 5BOFA 3LSBA 1O95A 4WSKA 1AW5A 3MDUA 2XFRA 3XISA 4GRSA 2C0AA 1QRQA 1V6VA 3VX0A 3CWHA 3MVTA 1JYVA 1G9HA 5EA9A 4LS1A 1T96A 1B31A 1R3RA 5A1AA 1FWFC 1NELA 1MZHA 4MNKA 5MF5A 4BS0A 2YL6A 1PO9A 4MZ8A 4RNHA 1SZRA 1FTXA 3AYVA 2XISA 4JN7A 4LV4A 1YRRA 3QV9A 4UTKA 1R7OA 4GGHA 5FEZA 4LBRA 3TZNA 3CNYA 5TAOA 3DHUA 2Y6ZA 2G96A 4LUSB 1UUOA 4D71A 4EAMA 3C61A 3O6CA 3QPEA 1J96A 1GT8A 1O5KA 3U5YA 1IR1A 3HQ1A 3A64A 4Z2LA 4V27A 3PBGA 4HMEA 4GQQA 2YA0A 3QOMA 1WE5A 4QFUA 3VMPA 1XD0A 3WJXA 1XXXA 2J6XA 1YTKA 3UR5A 4EACA 2FZ9A 2Y63A 3IGHX 4JN8A 4Z0SA 5AKQA 2AKMA 1NF7A 2G3FA 3AHVA 3IJ7A 3FY1A 2WVSA 1KFWA 4GIEA 4O1FA 3DG7A 3PWGA 2XDFA 2C79A 4I90A 3GNXA 3SIMA 4WSJA 2CZDA 3S42A 3KOFA 1J01A 2YDRA 2BDQA 2VZOA 3V35A 3PFRA 4JIIX 1PZ3A 3GB6A 1QK0A 1XH0A 5AYBA 3YPIA 3QC0A 4W9TA 4W87A 3VOCA 1RY8A 4CCDA 4I5XA 3RLGA 4AMCA 3MJMA 2PDKA 4B3ZA 1UB3A 2XVPA 2DEPA 4C6PA 4C6OA 1VFHA 4M7TA 4MYAA 3VCNA 3LCLA 3UJSA 1EDGA 5CPOA 1RA0A 2VM8A 3O9NA 2HE5A 4IFOA 1LG2A 3UF9A 1BHGA 4OJYA 1G94A 3AI0A 3I6RA 4JKLA 3BLKA 2D3LA 2E68A 4HNCA 1X7FA 3Q2DA 3UY8A 3VOJA 3ATZA 1IQ8A 3ZT6A 4QXIA 4QJ5B 3PM6A 3PZGA 4MY8A 1Z48A 4W7WA 2X0HA 5C0QA 1QNQA 2JIWA 1BTMA 2EJAA 2Y8KA 5PTDA 2VR2A 2VVSA 2Y7GA 3W2KA 5LA2A 3W84A 1R3YA 1FKWA 2V0TA 4H7ZA 5M3WA 4Q7NA 2XINA 1FH9A 4HK5A 3F5KA 4GA8A 1VBRA 3NG3A 1E3ZA 2RUSA 2RFGA 1HJUA 4FS9A 4FAMA 2ONEA 3VIMA 1R85A 5LKYA 3GS6A 2C1IA 3QHNA 3ABOA 4MPKA 4IJCA 2PU0A 4HSNA 2PAJA 1EHAA 1SO3A 1F61A 2JGYA 3WL1A 1I4NA 3HPSA 1EDTA 2Y62A 3WD0A 4NG3A 1IWPA 3BUVA 3N9SA 4YU1A 2PZ0A 2W9MA 1BF6A 5IOBA 4IIGA 2OWCA 3QZAA 3T40A 3WN6A 4IL2A 1TV4A 3JU2A 3A22A 3Q4DA 2BASA 2JF6A 4UFMA 4GISA 1Z7AA 4FR1A 2VX5A 1TELA 4LT9A 3W28A 4AC1X 1JGIA 4ZB5A 3RR1A 5LXXA 3GNDA 1EEXA 1PIFA 3W22A 1TWZA 3CB3A 3W1PA 3GX9A 2WC4A 4F66A 1KLZA 3QFWA 3L4UA 3O06A 3B9NA 5C54A 4IGSA 4O16A 4JFSA 3WQGA 1FCQA 1NFGA 2VDHA 3QR3A 3GXFA 3SY5A 2A85A 1KBKA 3W7GA 1R0MA 1K77A 2V6AA 5KINA 1JPMA 3WQVA 1XI3A 3PN8A 4NKCA 3ZM8A 3QRHA 4RXGA 5ABFB 3WEZA 4WRHA 3HV8A 2PDMA 1C8XA 5HWJA 4J3WA 4RE3A 4ADSA 2C8NA 3MANA 3UR2A 3KWSA 3L12A 2ISSA 1W9XA 1GK8A 4LUIA 3UD6A 1LTDA 3VIOA 4F0RA 4WF7A 4Q8PA 1EYWA 4R9XA 4BQ2A 2XWEA 4DY1A 4IIDA 5DX7A 1JUEA 5JIPA 1ZRQA 4AD0A 2V5KA 3R6IA 1KXVA 3W2UA 1TWIA 1OX5A 1XLMA 3ONCA 2OGJA 3OHIA 2VRQA 4IQEA 5CPLA 1RH9A 4QS5A 3GNOA 2DVTA 1CGXA 4KH2A 2BSLA 4G6CA 1W3KA 1ZBCA 1YE6A 1S1PA 1XLBA 3WNPA 1UKTA 4IXHA 5AHMA 5E0CA 1RQBA 4GYKA 4AZCB 3W73A 2W6RA 3NYDA 4IMFA 3PUEA 2VR5A 3DU0A 4MJ4A 5FCZA 5CQ1A 5CLTA 3IIVA 3G77A 1OX4A 1VFOA 3NQAA 3NZQA 2QKFA 3VKKA 4ZMGA 1EQCA 1OB0A 4ENLA 1WPCA 2J9ZA 5DFAA 2FGLA 4BFAA 4GZIA 1H60A 1M9HA 2XVGA 3HMCA 2ZVRA 3LI1A 1FWEC 3DC0A 1NFBA 2OOGA 3FVMA 1AW1A 2NV1A 1BQGA 3NVDA 4U2ZA 2VOMA 1OF6A 3P84A 2J62A 1XFBA 5EU9A 4TVDA 3C6CA 4LAKA 1P4CA 3B0VC 4XUGA 1UBPC 3VX1A 3SGUA 3A3WA 3CZEA 5DQPA 2X16A 3B0PA 5ENLA 4R85A 3E9AA 3EKZA 5I3GA 4U2YA 1JAEA 4JTIA 1M65A 3L4XA 2ZTJA 4M6QA 5DRCA 1SSDA 4DUOA 2VEIA 3LCXA 2DW6A 4HNNA 1AQMA 3N6HA 2WZEA 3RILA 1VGAA 3P7YA 3BMVA 3M6YA 3AU6A 2D2GA 2JKPA 1WDRA 3B8VA 3L68A 1HP5A 2OT1A 3HQPA 4H2HA 2NQLA 3WFLA 3S1VA 1F07A 3ZQ9A 1N8WA 1XV8A 3VCRA 4MB4A 3Q67A 4KCUA 3S5YA 3QKZA 4AEFA 3TYAA 5HMEA 1H50A 4NNBA 4H9MA 4ZQCA 4QQ3A 4B16A 4JFVA 4F79A 4GMEA 4S39A 5AHFA 3MP3A 1QASA 3BURA 5M17A 4FB7A 3FW6A 4AIUA 3F4CA 4C90A 1XBXA 3QR0A 3VFLA 1A3HA 4KEUA 1DXIA 1KM3A 1HTIA 3VE7A 1UJQA 4Q8WA 3VKCA 4X63A 2XN1A 1IXOA 3E0FA 4HVXA 1I1WA 2NQ9A 3L5MA 1ITUA 3B8SA 4CQ8A 4KESA 1KFLA 2BX7A 4R7JA 5FJPA 4E5TA 3AWOA 3U7BA 3UP8A 3SCRA 4O11A 3ID7A 2QJJA 3O6AA 4M80A 4A22A 3P5ZA 4XAGA 1QI5A 5IHRA 1G69A 2PWUA 3STEA 4UTFA 3DKLA 4YVXA 4IIFA 2NX9A 1A3XA 1KRBC 3AYTA 4QAWA 2FTPA 3WF3A 2OQLA 4TX8A 3ARTA 1KW1A 1EPVA 4ZBCA 5I24A 1BVWA 3UJFA 1V8EA 1SYTA 3W2MA 2GL5A 5A6KA 3IACA 4L9XA 2UY3A 4GBDA 3CUGA 1B9BA 3DI0A 1UP3A 3P61A 1XKJA 1DXFA 2RAGA 3DFPA 1HGWA 3URNA 1LUCA 2PTZA 3LY0A 3GW3A 3QR1A 1WZMA 3TX9A 3E2VA 3QSRA 4JTLA 2R1NA 3OODA 3U2CA 1UCWA 3E0WA 2D0GA 4LC8A 4JIEA 5DCDA 5EL1A 1P6BA 3U4FA 3I3BA 1YEYA 3AHYA 5F4XA 1KBJA 2DZSA 4XVEA 4CD8A 4HK7A 5G5IA 5E70A 1SUXA 3N3MA 2PUZA 3WLSA 1DJYA 1P1XA 1FFQA 3KZSA 1F2JA 4Z2GA 3PNUA 3RPMA 3FAWA 3UGVA 3WDQA 2D24A 4M5PA 2DP3A 3EWUA 3UG8A 1QO5A 2NSOA 3BLOA 3LTPA 5A8PA 2Y5JA 2P3ZA 2GYIA 2P10A 2YSWA 1NWRA 3BAJA 1KV8A 3TN6A 4DLMA 3W53A 1NDZA 1HL9A 3CC1A 1W91A 4EOUA 5A2CA 3QMTA 4PUWA 1YKWA 2QXWA 1JQVA 2J79A 3FKKA 3V18A 1PL9A 1UP0A 4N42A 3UWEA 4EF9A 3QPZA 2IPGA 2OODA 3VDCA 2VWSA 3W2NA 2CIPA 1R6WA 2CLMA 5FJRA 3SJ3A 2I16A 5K9XA 4NJJA 3GHTA 4XAYA 2YLAA 3WYZA 5I3JA 4HNTA 3V1PA 1ICSA 2ZX9A 1GQJA 4R34A 5C6MA 4PEEA 2GGHA 5F4SA 1XFCA 2VQTA 4XX6A 3F1QA 1Z41A 3BGGA 1HUVA 3XINA 1ZAJA 4B4FA 3CIWA 3QV8A 3KW3A 1AVAA 1E6PA 2QUMA 3PANA 3MZ2A 1L6YA 3MO7A 5LNRA 4MJ2A 2YA1A 4C6QA 3C2OA 3KHDA 1L6SA 4Y9AA 4IGHA 1ONRA 2BHZA 2O9OA 3FX4A 3OLIA 3T2QA 3QHOA 4HCDA 3R2GA 1PB0A 4XZ9A 1GG0A 4YCOA 3MCMA 1BEUA 3S6TA 3M7WA 3MTWA 3N14A 1P1MA 1DKWA 3S1XA 1JZ2A 1KNWA 1PX4A 4WDTA 1D3CA 5HOSA 1K4HA 5I78A 1A4LA 1V4YA 5D02A 2IPFA 4FR6A 4DNMA 1ADDA 2PD9A 1XSIA 3R5EA 3T6CA 2E9MA 4XZBA 2DDXA 2YCIX 1R8LA 4N6EA 3UPBA 2ACUA 3HGRA 2XH4A 1V7YA 3S83A 1DHPA 5BOEA 3W3OA 2E1DA 2ESCA 3RM8A 1B1YA 3SIZA 3I3EA 3ES8A 4HYWA 4M29A 4AX6A 2YB4A 2QF8A 2DSKA 1PCWA 3QMSA 5IDZA 3QV7A 1UUQA 1W1A1 3A4AA 5IBXC 2V5BA 1UWIA 3V1HA 3GSMA 3NYZA 1A5BA 2HVNA 1NTHA 2VT0A 3L2LA 4GNKB 3G1VA 1G7VA 1EDQA 1AD1A 4GFSA 4H8HA 2FHFA 2YL5A 2GUBA 4L1GA 1RJQA 3G0UA 1HJXA 2V38A 3SUTA 1GPFA 3O05A 5AC8A 1J6OA 1JI1A 1YYAA 4NRRA 1CLKA 2ZOXA 4U3CA 1VCFA 1TPFA 2QUVA 2NX1A 1OT1A 2QCNA 4DELA 1W9UA 2WC7A 5DMMA 4OFCA 4U5KA 2WVUA 4R7OA 1ME7A 1SO5A 1TIMA 1XGZA 2H90A 3OZPA 1TZZA 3BTNA 2FZBA 5HWNA 3UG3A 4GOAA 4WQ6A 2RDWA 5I09A 3G1AA 3W7LA 3CQJA 3VIGA 3C3NA 1Q63A 3GH7A 4NJKA 1JQXA 4EXQA 5D9MA 1ML1A 3RX3A 1M7JA 4AY1A 2Z1SA 1Z9AA 4LANA 1J0JA 3WEOA 5CPTA 3A21A 1UZ1A 1BFNA 1GOMA 4IPLA 1JPDX 4J3VA 1FWAC 3EMCA 2TODA 5A8QA 4DBEA 3GZ3A 1R30A 1WKEA 1U1UA 6ALDA 3KHJA 3LGDA 4UQBA 1JCMP 1PYFA 4ZCWA 9XIMA 1J0ZA 4C6NA 2V67A 5HPCA 3W71A 4JKKA 3NXFA 2VENA 2PDXA 2WMFA 1HP4A 4XZWA 2R14A 3F03K 2P53A 1DIEA 2XN0A 5C9ZA 1XYZA 4QX4A 1XYFA 4ML4A 1OG6A 4UWMA 3N15A 4AFYA 1LWHA 3B04A 1XICA 4A35A 3SADA 1TYGA 3MUIA 3WH8A 3FHQA 3TP4A 1M7OA 2CBUA 1TV7A 3W1RA 5CKSA 4UTIA 3OEXA 1Q6DA 3STGA 1ZCCA 3MBFA 2PZNA 3SUVA 2NVDA 2ZA3A 3GQYA 4HBKA 2YA2A 3B0YA 5REQB 1XJBA 1GVFA 1XLIA 4GXMA 2PWVA 4LNYA 4XKMA 1SMAA 5I3HA 5DF0A 3DAQA 4DVOA 3LERA 5IDIA 1TWDA 1CDGA 1HN1A 1VFMA 1X6UA 4GI4A 4PL1A 5KETA 4XB3A 1GVQA 1S3HA 4US5D 3HJEA 3F4NA 3AUOA 1ONWA 3KOWA 2HEJA 5FJOA 3AXHA 3W87A 4LUTA 3WK1A 3THDA 5CBJA 1E43A 4N2YA 2BXYA 1QHPA 2WMKA 4KRUA 4U10A 3S1WA 3GC5A