3B3DA

B.subtilis ytbe
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
280
structure length
280
Chain Sequence
MTTHLQAKATLHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNEAGVGEGIREGIEEAGISREDLFITSKVWNADLGYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKEAWRALETLYKEGRIKAIGVSNFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQGQLLDHPVLADIAQTYNKSVAQIILRWDLQHGIITIPKSTKEHRIKENASVFDFELTQDDMNRIDALNENLRVGPDPDNFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative morphine dehydrogenase
publication title Structural and biochemical analyses of YvgN and YtbE from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 100
structure length 280
sequence length 280
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3b3dA00
2F38A 3V35A 2PDQA 4JQ3A 3LEPA 3BURA 3UGRA 4XAPA 3Q65A 3LD5A 1ZQ5A 1AFSA 4JTDA 3UYIA 3LUTA 4JQ2A 2A79A 3UWEA 5DANA 2INEA 4HBKA 4LBRA 2PEVA 3G5EA 2WZTA 3UP8A 5LIWX 2QXWA 3R7MA 2IPFA 2J8TA 4WDUA 4FA3A 4JIHA 3R94A 2HEJA 2IKGA 3WG6A 3DOPA 3CMFA 2PDIA 3LZ3A 4LB4A 1PZ0A 3EB3A 5C7HA 2DUZA 2PDMA 3MC5A 1RY8A 5LIUX 4GACA 2PDPA 2PDWA 4I5XA 4JQ4A 4XZIA 2BGSA 1M9HA 1X97A 4PRTA 3KRBA 4OTKA 3LNMA 4YVXA 2PDHA 4GQ0A 4IJCA 2P5NA 2IKIA 1K8CA 3UG8A 1Z9AA 4PUUA 4QR6A 2INZA 4YVPA 1X96A 2BP1A 4JTCA 2ALRA 1Z3NA 4PMJA 3WBXA 3V0UA 2R24A 1AH4A 3P2VA 4YS1A 4LAZA 3WBYA 3UFYA 3EAUA 3ONCA 1XF0A 3LN3A 4XVEA 3BCJA 4YVVA 3H4GA 5HA7A 2HE5A 2BGQA 1US0A 4GCAA 2PDNA 2PD9A 1PYFA 3R43A 4WEVX 3GHSA 1ZSXA 4GABA 3O3RA 3T42A 1T40A 4PR4A 4XO6A 1IEIA 2DV0A 1S1RA 1GVEA 3R8GA 4XZHA 4DBWA 2FZ9A 3UZYA 2PFHA 1MI3A 1SM9A 1S1PA 3RX2A 3VXGA 1ZGDA 1ZUAX 3G1RA 3H7UA 3GHUA 3GHTA 4G5DA 2I17A 3CV6A 3FJNA 4JQ1A 3D3FA 4XK2A 1EF3A 2I16A 3CAQA 4JQAA 2F2KA 4H7CA 1PZ1A 1VP5A 3V0SA 4EXAA 4IGSA 4WDTA 3CAVA 3NTYA 3LZ5A 3CASA 4JIRA 4ZFCA 2IKHA 3LBOA 3ONBA 1RALA 2AGTA 3QKZA 4PUWA 2PDBA 4XZNX 3M0IA 3M64A 4FALA 2PDLA 5LIXX 1LWIA 1ADSA 4DBSA 4WDXA 1Q13A 3WCZA 4IJRA 2DUXA 3B3DA 3UZXA 2IPGA 5HNUA 2WZMA 4DZ5A 5JH2A 4GA8A 4R9OA 3WBWA 3R6IA 2ACRA 5LIKX 3UZZA 1AH3A 4Q3MA 2FZBA 4LB3A 2PDXA 3MB9A 3EB4A 2PDUA 1PWLA 1T41A 5JH1A 1HW6A 1S2AA 2ACSA 3R58A 2CLPA 3Q67A 3CV7A 2PDCA 1YE6A 4L1WA 3M4HA 5AZ0A 4QXIA 4ICCX 1VBJA 4XZLX 4AUBA 4JIIX 1JEZA 4JTRA 2HVOA 1YNQA 1EL3A 3LQGA 4FAMA 4DBUA 2PD5A 1AZ2A 4YU1A 5M2FX 1FRBA 2PDJA 1OG6A 4GQGA 4XZMX 1AH0A 3RX4A 2ISFA 2HDJA 2HV5A 4H8NA 1C9WA 1PWMA 2PDKA 1UR3M 4LBSA 2PDGA 2FGBA 2FZDA 5HNTA 3C3UA 2PDYA 4XO7A 1S2CA 3ERPA 2IPJA 1MZRA 2FVLA 2HE8A 2NVDA 3U2CA 3N6QA 1J96A 1LQAA 4Q7BA 1AZ1A 2ACUA 3BUVA 4FZIA 3R8HA 1YE4A 4F40A 2C91A 3V0TA 2HVNA 1XGDA 1YNPA 1X98A 3GUGA 4NKCA 5AZ1A 4JTAA 4QX4A 4WRHA 3UZWA 1MRQA 1Z8AA 3GHRA 4PRRA 4GIEA 1Q5MA 4WDWA 1EKOA 3RX3A 4WGHA 2R9RA 3LQLA 2IS7A 2IPWA 1R38A 2VDGA 3COTA 4XVDA 4L1XA 2NVCA 1RY0A 1A80A 3N2TA 4LAUA 3FX4A 1QRQA 4JTQA 3LENA 3V36A 3DN5A 2IQDA 2PF8A 1EXBA 2ACQA 5KETA 4RPQA 4EXBA 4HMNA 5LIYX 1HQTA 4MHBA 2PZNA 3F7JA 1QWKA 4QBXA 3BV7A 4ASTA 2IKJA 3S3GA 3H7RA 1XJBA 3O0KA 2FZ8A 2PDFA 2IQ0A 1IHIA 1Z89A
chains in the Genus database with same CATH superfamily
3E12A 4PUKA 1D3CA 1W1VA 5J04A 2DU2A 5CJNA 1OT2A 1XIMA 4JX5A 1K7EA 1XYFA 1M7OA 4JTDA 2IMRA 2DZAA 5I02A 1HJXA 2DSKA 3MUIA 1W3HA 4JFVA 1H0GA 3J7HA 2RUSA 2INEA 4H2CA 5LIWX 5HUOA 4DJED 2VTFA 3SQLA 2J7FA 3M07A 2QDHA 3USZA 4XBJA 4D2JA 3R94A 2NXIA 4LXFA 1Q3NA 1UP0A 1V3JA 2E9MA 3VUPA 5FCZA 2NLYA 1FWBC 1XYBA 2V5KA 4L6HA 3GR7A 4X22A 2Z7GA 4MY1A 5JBEA 1TTIA 2CHOA 3HOJA 3W1NA 4DUWA 4N9EA 1BG4A 1QOPA 4L80A 1PIIA 2PWVA 2XU2A 4JQ4A 3OVGA 1XBYA 3WF0A 4OTKA 2E6AA 2Q6ZA 3BL3A 4MJZA 2G3MA 4OFCA 1UMLA 3B0XA 4O50A 7PTDA 4TX8A 1O60A 3DDMA 4KEZA 4US5A 3CHFA 1XLMA 4R53A 5JUVA 3H21A 4TTGA 5A95A 2R94A 5K9XA 4QQ3A 1KFEA 1GW1A 5A8MA 3WNMA 3V0UA 3VD4A 2V8ZA 2R24A 4RX0A 1V5XA 1SFSA 2VR2A 3EAUA 1A5AA 1BG9A 4ENLA 4CNTA 2BGQA 1TPFA 1V8EA 1F61A 1EBGA 1V77A 3O3RA 3RRAA 4AY8A 3WUGA 2Y8VA 1KQZA 1W3LA 4GI6A 3UVAA 5AFDA 3WK1A 2GUBA 3W1MA 1FWWA 4WX2A 3UJ2A 3V5OA 1TCDA 1RSCA 1XD0A 5JU6A 1UBSA 3LRMA 4HCDA 1SQ7A 1FH7A 1F7BA 3O05A 5AC7A 1G94A 3UXLA 1HP4A 2VR4A 2VWTA 3D3FA 3H55A 2VC6A 3IGHX 5G1YA 2EPOA 3K4AA 3LXAA 4B3ZA 1VR6A 2YZRA 5CC3A 1A47A 2LLEA 3M1ZA 3S2JA 4J3ZA 2R1KA 1CXEA 3DIPA 1ENUA 3VKJA 1F8IA 4V33A 5LGZA 3NYZA 1R8LA 2CLLA 1R3SA 1QPKA 2NSXA 3C6CA 3SGZA 4M8UA 2HNEA 4EPBC 3GB6A 5HPCA 2V5JA 3TV8A 3PZNA 4GYPC 1JDCA 3SAZA 5D32A 1E1EA 1J0ZA 4N42A 3N2CA 1IEVA 3ES8A 3SUTA 2Z28A 3YPIA 3VDHA 3SBFA 3EB2A 4ZOAA 4P8XA 2YDRA 4IJRA 4ZQNA 3WL0A 4AZHA 4LVFA 1AJ0A 1TIWA 3PB0A 3CO4A 2WHJA 5BXTA 1DQXA 1DJXA 4IISA 1V0MA 3LMYA 4ZVJA 2YDAA 5JH2A 1NSJA 2O9TA 1MDRA 1XIFA 3CL6A 3XISA 4F2BA 2YCJA 4JCMA 1R86A 3OW1A 1D7FA 4AQLA 1FCVA 2GVGA 2V69A 3BSMA 4NVTA 2ZTKA 3S42A 4ERAA 3B8VA 3L12A 1EDGA 2PLCA 3CV7A 1WZLA 2PDCA 2ZTJA 1US2A 3B8DA 1KR1A 1H5YA 2NWRA 4ZQOA 3QY8A 4JTRA 4JYFA 2VP8A 1SW3A 1UASA 3DH7A 5FJPA 1EL3A 2AQVA 2YKKA 1J01A 4HK5A 4I7VA 3F03K 3VE7A 3NGJA 1AZ2A 1OADA 1AH0A 3C2RA 4OKDA 1XYMA 2E5DA 2HDJA 5D02A 2NQ9A 3UT0A 1ELSA 2PDKA 2XVPA 1BYCA 4WZHA 2NSOA 4DXXA 2ZIDA 4GI9A 1I8JA 1MEHA 1HL2A 4PZVA 1MMFA 4JDYA 3WK2A 5C7VA 1ICQA 4QISA 1C92A 1EGMA 4A3HA 2G3FA 3FLUA 3QH2A 2ZXAA 3GIQA 3WLMA 3NEVA 2VDHA 4NXSA 3CLMA 4WSHA 1JUBA 3U48A 4QJ5B 4N4QA 3TDFA 5TIMA 3WN6A 4MB4A 3NG3A 3UXDA 1XGDA 3FJLA 1AMYA 3JR2A 3CZEA 3WDRA 3FAXA 2BOEX 4AC7C 2V2CA 3S9IA 3CB8A 4R34A 4W4QA 4BWLA 4PTNA 3AQUA 2Y5SA 3FVDA 3NGFA 1IXNA 2YA0A 1XIDA 1XLFA 2Z26A 3VIFA 1KM1A 3KZSA 5ECUA 4KETA 2D20A 3KUMA 3HIJA 4IIHA 2VGIA 1OC5A 3COTA 1LM1A 1K8YA 1VBRA 4B15A 4W9TA 1HVQA 4JY9A 5LHEA 1BTCA 4LY4A 3T4WA 3C0SA 2YXGA 4MNJA 2ZX9A 3N4EA 1KGWA 1Z42A 3B06A 3RPDA 3UY7A 2CC0A 1LZOA 4R88A 2Y8UA 2VGGA 3QV9A 2J9ZA 3K30A 2E6YA 4PTMA 3WUEA 3NQFA 3HMCA 2P1FA 4NX5A 4Z0JA 4ONVA 3AROA 3N13A 1HX0A 3T0AA 4YWIA 5TBOA 3WBEA 1LQ0A 3MVIA 3VAVA 4D6IA 2B7OA 2Z1WA 3GTFA 4IL0A 3BURA 2WPBA 3SDOA 3RO6A 1JUEA 4RR4A 1TO3A 1FHDA 3UJSA 2FMNA 3GTIA 4GK8A 1GOKA 1PTDA 3PAJA 4BF7A 2B7QA 3B4UA 2XFYA 3I7SA 5H8UA 1XLLA 5IBXC 3SY8A 3MHUA 4MYXA 4AHOA 5FIPA 3AS0A 3N29A 1VD6A 1AJ2A 3BANA 2E8YA 1M1BA 2PP1A 3MC5A 2VEGA 3WH9A 3HU7A 2RKXA 4ZCWA 2QJJA 5CPMA 1DJWA 4KKXA 2XN2A 2AAAA 4A2RA 1CXLA 1XXXA 1UWQA 2RHGA 1XLEA 1M9HA 1N55A 5JIWA 5ECVA 1D8CA 5HQMA 2WMJA 2XJ7A 1MO0A 1XQLA 2F84A 1W5NA 1WNOA 1TELA 3LHTA 2VXNA 4F0MA 1ZJBA 4EOUA 3NNTA 1KWGA 2QZRA 1X1ZA 5BMXA 4X0VA 3RGTA 3H2FA 1R46A 3MUCA 3SUWA 3W23A 1GONA 1VFHA 1IV8A 4CNNA 1VFMA 1F9CA 2NUWA 2DZSA 4DI9A 2WB5A 1XPYA 5FI8A 1A5UA 1YXDA 4RZ4A 2D2GA 3QFEA 2RH9A 5LZLA 3WF2A 5HWNA 1S1RA 1H7PA 2HROA 1MNZA 3L5MA 2WJEA 3MWCA 4DBWA 3WQGA 4DJFD 3LCGA 4LTSA 4IM4A 3G1RA 1LL6A 3IRSA 1J0HA 2J74A 4JTLA 1QMLA 4TVDA 1MQRA 1Q6LA 4O1BA 5IHSA 1P6WA 2WZHA 3GK0A 3NZPA 2O0TA 1GOQA 1UZ1A 4OGZA 3S1XA 3WLOA 2Y70A 1JGMA 3RN6A 1PUDA 5GJNA 3IACA 1VP5A 4GO9A 4UFHA 2DZXA 2NQHA 3CT2A 3DG6A 1FVPA 5FF0A 4NRRA 3WNNA 3A3XA 1XIHA 3HA1A 3WO8A 3VOGA 4KCVA 3BJFA 1JUKA 3BOLA 1A0EA 4PMQA 5G4HC 3E49A 4C6DA 5HR7A 2DIEA 3H8AA 5ABHA 4E3TA 1POKA 2EXOA 2D0FA 3FDKA 2PDLA 3AHTA 3UJFA 4MZYA 3IK2A 2OELA 2GDVA 1AODA 3WD0A 4U28A 3ZR5A 1EP1A 3QTGA 3E0VA 4S3DA 4WKFA 5ABFA 4ZB2A 1SYTA 4C6PA 4LVAA 2WZMA 1ZENA 4M6UA 3EWYA 5CGTA 1FWGC 1PTAA 2AKZA 1DHPA 1AH3A 2FZBA 2RJGA 4K1GA 5DBTA 1BYBA 4NU7A 5JBDA 3WQWA 2QT3A 4Z1CA 4JFTA 1QW7A 1PDYA 3TCSA 3RPTA 4CNUA 1MW0A 3BG3A 1P0BA 1V0NA 1Q7MA 4TO8A 4JBRA 4ZODA 4QXIA 4BQ4A 3USBA 3CUXA 1FKXA 3APYA 3GFXA 3N6JA 1PJ9A 3GKAA 3SUSA 2NVAA 1L6WA 1JYNA 3BJTA 5E0FA 4B5WA 4E2VA 2EJ1A 4B2DD 1UWIA 4UIOA 5IHRA 1TV3A 4HQVA 1FRBA 3S8HA 1OG6A 4BJHA 2QCEA 4DZIA 4NNBA 6XIAA 4OV4A 3GH4A 3VIMA 1JGIA 4LX4A 4D72A 3EWXA 2XZ9A 2GJXA 1QUMA 2EPLX 5AYIA 1KO0A 1NP0A 3EKGA 1LL7A 4H19A 4HHLA 3HJZA 3TYCA 1IE7C 3RM9A 1QAPA 3RIKA 4W5ZA 3S6DA 1CZ1A 3W85A 1R3YA 3ERPA 1ZZMA 3BW2A 5MKGA 1V02E 1TV5A 3N6QA 4X60A 4UFKA 3BUVA 3CM4A 2C91A 4XSMA 4NKCA 3GR8A 5AZ1A 3IJIA 3HG5A 8RUCA 2BZNA 5I3GA 7ODCA 4HK6A 5KSWA 1WDQA 5BMWA 5M17A 5CG0A 5D09A 4HNTA 1R3TA 2QUUA 3SEPA 1E0TA 2WOQA 2AL2A 4AXNA 2Z1BA 1GQIA 1AQMA 2GJLA 3ZM8A 3UW6A 5ABEA 3R8RA 3CQ0A 4HSOA 4B5NA 4RJEA 4ZR8A 3KOXA 3TC3A 2CZEA 1PZ3A 3QLDA 5IFPA 4Q6XA 1ISZA 1SU5A 4WKHA 1K70A 1MQQA 1JZ3A 3POCA 2Y4SA 4H6KA 4EXBA 2QIWA 3KX6A 3KHDA 4NASA 2QLYA 1DPMA 2ZWZA 3L4XA 1GQLA 1ZTVA 2BY3A 2VRJA 1KB3A 4V27A 5K3VA 3PUDA 2FZ8A 4JHOA 1WUEA 5E1QA 1Z89A 2PBGA 3CZJA 1HJSA 1OBAA 3VMNA 3CS2A 1RR2A 4N2YA 1ME8A 1OD8A 2QULA 5CLTA 3PZOA 1P48A 3MMTA 4YTQA 2F6KA 1K7FA 2OKOA 3A9BA 4UQEA 3G5EA 3B9OA 4Y8FA 3IJ9A 4K1WA 2Q01A 1UQYA 2WNQA 2O92A 1TB3A 3W71A 3SCWA 2ZDSA 1JDEA 4BF9A 2QYGA 1RVKA 5DX7A 1SMAA 3R79A 3N25A 5CEWA 1HFBA 1LBLA 3TH6A 5D8WA 3MI2A 4F66A 4O57A 5C7HA 2BXYA 2ZC1A 3WK3A 3CXOA 3QN3A 3OVPA 4NZCA 3AIVA 3FNDA 5LIUX 5XIMA 1O95A 2PDWA 1XG4A 3HV8A 3R2GA 2BGSA 4GVIA 4ZGYA 4O8RA 5HR6A 1EP3A 2OT1A 4N6FA 3F4WA 4O52A 3BZJA 3MV01 2YBVA 4N6EA 2QVNA 5EKYA 2UBPC 4FS9A 2QJHA 2ALRA 1KA9F 1H5VA 1T8XA 2ZRVA 1OCNA 1OQFA 3DFQA 5FJOA 2GSEA 2NX1A 3SRKA 1M01A 1V02A 1M7PA 2CBIA 1DTUA 4XWUA 1O12A 1VKFA 3NCOA 3CTLA 2UY4A 1UH4A 3TCEA 4B90A 3ABOA 5GJPA 4LBUA 2QUTA 3S9YA 2INFA 4LYRA 3QHOA 1ICSA 5A8GA 1J0JA 4PODA 3VX1A 4YWSA 3NXLA 2Y0FA 1EPVA 3LX9A 1DJGA 4O15A 2ZUVA 2BGNE 5HJYA 5G1MA 1S46A 1Z41A 4PBGA 4CD5A 1X1NA 4G7EA 1JYVA 2Z1VA 4MNKA 4MWAB 2OG9A 5HOSA 1VEMA 2P3ZA 5A8PA 1V6VA 5GJMA 2PS2A 3BCDA 4QM1A 3NO3A 5G4EA 1AD4A 3RX2A 1POJA 1OK4A 3W7PA 1EGZA 1OIMA 3G0SA 9CGTA 3HPFA 1U22A 1P1MA 1UR1A 1WP6A 4ZO8A 3AMGA 4IQJA 4FNTA 1ZL1A 2Y6ZA 1RA5A 4DQWA 4Z08A 4Z2GA 4KF1A 1GK8A 5HJLA 1VJIA 3LSBA 4EF8A 3LCFA 2ZZ5A 1LUCB 5CQ1A 3A4XA 5DMNA 4KWSA 1VBGA 4JYDA 4RNFA 1M68A 3NQ8A 2GFTA 4RDVA 3TVAA 3B9DA 3W53A 2HPIA 5FEXA 2X1SA 3BC9A 1JDAA 3FN9A 3RR1A 3IAQA 3SUVA 3UCQA 3CL7A 3T05A 4E8CA 3UU0A 4DBSA 5I79A 2XYLA 2Y24A 1GKRA 1TE6A 2OGYA 2OJPA 5C9UA 1BKHA 1NEYA 1DJQA 1CT5A 2R14A 2V5BA 5JBFA 4GIRA 1Q6DA 1HXJA 3EA2A 1TJ2A 1VH7A 1JNEA 4A3UA 4BFAA 4DJEA 2VMFA 4GH1A 5E6YA 1DP0A 1JZ4A 3EB4A 1FWRA 5I09A 2PDUA 4OECA 2XWDA 3CUGA 4LCQA 4W8BA 3EX4A 1UC4A 4H04A 1B57A 1TA3B 2YL9A 2AL1A 2O9PA 1OVDA 4F9JA 4GKTA 5AZ0A 3VD9A 1HUVA 3DENA 2FKPA 2QUNA 4O0QA 1FX6A 4FO4A 3RU6A 5AVNA 3UG3A 2OWXA 4K6AA 3JZEA 2CZVA 1F74A 4HA1A 1UWSA 4CCEA 4IP5A 1OGBA 2G3JA 3FGCA 1PWMA 1FQ0A 2Z29A 1E6RA 1AVAA 1TIMA 1D3HA 3WJZA 4XG1A 3AI0A 2QAFA 3ZSSA 2G97A 3VKBA 2IUZA 2Z6JA 1XFCA 4NJHA 5BZAA 3EBVA 3WJWA 1S2CA 1SPQA 3N2BA 3KBJA 4AYGA 4WF7A 2VC9A 4MOZA 4Q7BA 3UD6A 3MQTA 4AXKA 1Z69A 4DY1A 2WQDA 3SURA 4FR6A 3VIPA 4E38A 2VNCA 3A3WA 3H26A 3GBDA 1PKLA 4IUOA 2RDTA 1QNPA 5KMYA 4LY8A 1XBZA 2YW4A 5PTDA 3V5FA 5D33A 3SCPA 1BF6A 3NQBA 1KGUA 2PTWA 1G1YA 1PX8A 4I6VA 1CNVA 4K38A 1TV4A 3W82A 2EPKX 4LS0A 5EMUA 3LM3A 1FHVA 2GWNA 4XVDA 2NLIA 1EDQA 3B0UX 4XIAA 5BOOA 4H6QA 8TIMA 4INFA 1A80A 3LDVA 1QRQA 1UR2A 1GW9A 3BTNA 3M47A 4WSKA 2CLFA 4DEFA 4UTFA 2I1OA 4KRTA 2CERA 2ACQA 2ZUTA 2I5IA 4RPQA 3LV5A 1DKWA 5LIYX 2Q02A 5BYWA 1NQ6A 1O1ZA 3NQEA 3VM5A 1VENA 5D05A 3I7QA 4GI4A 4FLRA 3W88A 5BXSA 1OT1A 4CU7A 1R9YA 1B4EA 2JGQA 3UYCA 3W26A 3TYZA 3CT7A 2PI6A 2GQ3A 4Y6GA 3HV9A 3HZ3A 2XGZA 4B9ZA 3W2KA 4UFIA 3VU2A 1KCKA 1OD0A 3Q37A 3IGUA 3GNRA 2OO0A 5DANA 2PEVA 5E9AA 3MZ2A 1J18A 2GUUA 1PKMA 2EG7A 3I7RA 2IPFA 2BHUA 3UPBA 3ZOAA 3DC8A 1S5VA 1R2SA 4LJ3A 2FLIA 2X7VA 4GG9A 4CQ9A 3B0VC 4MKSA 3WENA 1ISYA 4KCUA 3LI1A 2PC8A 1R2TA 1DJZA 3GNNA 1KXQA 4MWAD 4F0LA 2XSBA 5HUPA 4D6GA 4H1ZA 4K8HA 4GY1A 1JPKA 4L61A 4I6KA 4Q7IA 4C91A 2WHMA 1OINA 1V4YA 2GJPA 4B91A 2D2OA 3KRBA 3WQPA 4LYQA 2YDQA 1ADDA 4RE2A 1W31A 1FFQA 3LPOA 4DUVA 1JAEA 5D9NA 1QNVA 3AJXA 1Q6EA 1Q6GA 4PUDA 1KLYA 4LV4A 1UUMA 2ZXDA 5AHEA 3ARQA 3VD3A 3O6DA 2E6FA 3SZ8A 1K3UA 1TX2A 4ZEPA 2EPMX 1QO5A 2XSXA 1WOBA 4OBRA 3UFYA 1E3XA 1W3NA 1ME9A 2GK1A 3NM3A 3W74A 2J7HA 1NOUA 4HP5A 3UBPC 4AWUA 2HE5A 5HULA 3NAVA 4OU1A 2QPUA 1US0A 2WLZA 2A3LA 3HFTA 1L0PA 3DECA 1DJNA 3EXSA 3L5LA 4QDWA 2FQIA 3G0XA 3T42A 4JOMA 5CSRA 2ONEA 1OCJA 3S5SA 2H8ZA 1F5ZA 3ZSTA 3PTKA 3M9YA 3ME3A 3QF0A 2C15A 3GHUA 5CAHA 3THUA 3EWZA 1MEWA 3GDMA 4KERA 5FL1A 5F2LA 4Z42C 1JD7A 2BTMA 2WC4A 3VZZA 3TJ4A 4GE8A 3AMCA 4RL3A 3VOHA 1W9BM 4YXGA 1C29A 1XRTA 2JIEA 1JPMA 2VM8A 3KLLA 1DWAM 1TQJA 3W1TA 1K6AA 1F6KA 4O1EA 2DW6A 3SCQA 4QG6A 1JXKA 3LBOA 5JVLA 3AZTA 4QGCA 4CQCA 3VPLA 4PUWA 2EPNA 4GQRA 3NQ7A 4IPPA 2CLKA 4FALA 1HO4A 3E1F1 1BRLB 3URBA 1A4LA 1IWBA 4GCXA 3M0HA 3SRDA 1XISA 1HVXA 3K5XA 4UTWA 3T78A 1O6IA 2GQ8A 3WH7A 1E72M 2V2HA 3D6NA 3D47A 1FP8A 3OYZA 1JULA 4JNYA 3WD2A 5IRPA 3VNZA 3AIBA 1S2VA 3W25A 4PB3A 3H53A 2IPGA 3CQHA 1QI0A 4AMAA 4G7FA 2X30A 1GUVA 3CLWA 4IMAA 3VKAA 2CLMA 2V3FA 4HMDA 4W8LA 1OG0A 2UY3A 2VZUA 4QJ1A 5K9CA 3QRHA 3TW9A 3QBUA 3A47A 4UC5A 1FKWA 1TCMA 1RH9A 3QTPA 1HW6A 3CAWA 3MU7A 2POZA 2GOUA 5IDIA 1G67A 4PBEA 3IV3A 3W75A 1XDLA 3RLGA 1GYMA 5CGMA 4GYFA 3PP7A 1HF6A 4W88A 1SZNA 1G4EA 2E7FA 5A94A 2E68A 1SUXA 3B0PA 3VC6A 4LALA 2D0HA 3TTSA 3KBSA 4EAYA 1V6XA 1T7LA 1YDVA 3R1ZA 3VDBA 2DSVA 1NWUA 3TFXA 1VB9A 4GYJA 2PU0A 3VCNA 3S46A 1W1A1 2G3IA 2D3LA 1H4PA 3PAOA 3ELFA 2WSQA 4RK8A 3T0CA 4UXDA 4CLMA 3W7GA 1SO5A 1YLVA 3EXTA 2C71A 3SSJA 1ESWA 1FH9A 3UR8A 1Q6CA 3MVTA 3KDOA 3WNLA 1CI1A 4EK7A 3AZRA 4AZ6A 3TR9A 3W1QA 3IUHA 1LWJA 2YLAA 3C5QA 3LHUA 2FFCA 4JHZA 4XD3A 1QNOA 1OIFA 4GXPA 2X0HA 3W6MA 4C60A 2OX4A 4CVUA 3P7YA 2H8XA 5CC6A 1HGYA 4IMDA 4XD5A 5F4SA 1SO4A 2PB1A 3DUGA 1ZCCA 3VMOA 3U2CA 3AS1A 2PWEA 1SZRA 2ACUA 4YHEA 2VCAA 1YRRA 4Q4RA 3WEMA 1BXNA 4DO5A 3V18A 4IG2B 1S38A 3SQSA 2DSZA 4LANA 3ZLFA 1M3UA 1HIZA 2I7GA 4GKLA 3KHJA 4PRRA 4DJFA 1N8WA 3CGTA 2C13A 3QKEA 2R9RA 3VGFA 1GTEA 3D3AA 3RHGA 3H2OA 2BG5A 1CLVA 4UQ9A 4B3KA 2J79A 1VLIA 2YBTA 2DORA 4HJFA 4JTIA 4U2ZA 3S2LA 1ODZA 1FXQA 3L23A 1VPQA 2QGHA 3RO8A 4GO8A 3C52A 3EDDA 4HMNA 5CZ0A 3L9CA 3RITA 2FJKA 5F7UA 2C1IA 1JCLA 4UTTC 4YYFA 1DIDA 1H2JA 4I90A 1SJCA 3VILA 3OLEA 4JGDA 5I3JA 4LF1A 1SW7A 2NXGA 1GG1A 4YNGA 1MFVA 4UZUA 2QEZA 4AZ5A 1XUZA 1A5OC 4WD0A 4H83A 2ODOA 2PDQA 1KFJA 1JJKA 4ZO9A 1IGWA 2J66A 1V79A 1WDSA 3W7CA 3FV9A 3RLVA 4QRNA 3WQ8A 3ZYZA 3RXZA 4O1FA 1OHLA 5BRBA 4A8NA 4AYSA 3QJAA 4Q8WA 3CIWA 3OLGA 3LMZA 3MCNA 1GOXA 2MNRA 1TVNA 4Z0SA 1J10A 4BWLC 1EOKA 2TSYA 2YDSA 2C1HA 1K9TA 1ICPA 2PP0A 3A23A 1KW1A 4NUWA 2RDXA 3GVWA 1J5SA 4NILA 4AFYA 3KVLA 2Y7GA 3L4VA 1S5MA 3BLDA 1EJTC 2H90A 4HMCA 3LTSA 3OLIA 4LB4A 1F05A 3IIOA 2R1MA 4P7NA 5JIPA 4OBSA 1W32A 4M3PA 4PL1A 4S3GA 2DZTA 2WSRA 4ZQRA 1U83A 5BOFA 4J3SA 4GXWA 3N04A 1A3HA 1NP2A 2XWEA 4Y9NA 3GXFA 3NSXA 1XH2A 4GC3A 2B81A 3BAYA 1QHOA 3E2SA 4CD4A 3HQNA 2UY2A 3GXNA 1K8CA 1EYWA 3NL2A 3L7RA 3TSDA 1KBBA 4IFOA 5DBUA 4B2DA 3W38A 5D04C 1DWGM 3WLLA 2BVWA 2TRSA 1Z3NA 5HXMA 1S2UA 1EJVC 3AALA 3UETA 3GR4A 2QCCA 3WBXA 1H61A 3UEQA 1WV2A 3QZEA 1P0EA 3R25A 1F8MA 3ARWA 1PE1A 1RHCA 4HCLA 3PJTA 3WBYA 4WY0F 5DF0A 3EOUA 2YGYA 1J79A 2QKFA 2RGLA 3H4GA 4HN8A 3GTXA 3RRXA 3TTQA 4GY0A 4I9TA 1IXPA 1W5PA 2OOFA 1DWJM 4WEVX 3EX2A 1EC9A 2JIWA 1BXCA 1EJWC 1B1YA 3E9AA 5AY7A 4LPCA 3A9IA 1SVDA 1E9LA 3KWSA 4IP4A 3FYOA 3GRIA 1GVRA 2CXGA 4IXXA 4MADA 5CPSA 4NYUA 1TRIA 4PFMA 2WJFA 4JN8A 2QCFA 2WW5A 4J7RA 3EZ4A 4HPXA 4L64A 3U2OA 2GJNA 4KGJA 1ZUAX 2BBFA 4H9UA 3GYEA 1RV8A 3V1PA 1EJRC 1U5JA 1KV5A 3M0LA 3SRFA 1RK5A 5E0CA 3QQWA 2XFRA 4AMCA 3DHFA 4GUJA 3E6EA 4I9AA 3U6WA 3O1NA 2HNHA 4IQLA 3PZ9A 1GCYA 4JQAA 2F2KA 4XUGA 1PZ1A 4N9BA 2YLLA 4RE4A 3L4ZA 1QI2A 2CESA 4KWVA 3W73A 2CFFA 2V5LA 3ZVIA 3P5YA 1TR9A 1AW2A 1C7TA 4TIMA 4Q8MA 1UYQA 2QAPA 4QAWA 4UBPC 3MUZ1 1T99A 3PJUA 1X7FA 3DCPA 1F73A 1R5YA 2E25A 1LWIA 2VFDA 1P1XA 4WXZA 4DO6A 2HCVA 1YADA 3GXDA 5F1VA 4JS3A 2QMJA 2BODX 1H11A 4OVXA 3TLQA 3CPGA 1X6NA 2Y61A 1VRXA 2ZZ4A 1TMLA 3ITCA 2A7NA 2EGZA 3CH0A 4LF2A 1AW1A 3N2OA 1IXQA 2PGFA 1E9ZB 2PE4A 2BASA 1B9BA 4Q3MA 2E28A 1DV7A 4JN7A 2QCMA 3WLPA 4IH3A 3SCTA 2WMFA 4FF5A 4TTUA 3QR3A 3R58A 2RDUA 3VD5A 1EP2A 1JCYA 1IZJA 3PN8A 5BXRA 4HNLA 3KTXA 5U7SA 2OPJA 1G4PA 3OVRA 4ICCX 2YB1A 3NOEA 3RM8A 1E4MM 4UQDA 2Y63A 1QHPA 2V0TA 1NDZA 1OK6A 4MDPA 2C0HA 1Z7AA 2CWXA 3CNYA 2VVNA 1OGGA 5EPDA 1MW3A 3A3HA 4YU1A 1UIPA 5F1UA 1TTPA 4MJMA 3MP4A 2AKMA 1MUMA 3Q45A 4GYKA 1Q2SA 5AC4A 3IPWA 3VIIA 4FIQA 2VCCA 5D37A 3E0FA 5AYZA 2PLKA 4R33A 3NPXA 2HBXA 2H9AB 1Y65A 3NL6A 1YX1A 2BX7A 3BW4A 1AMKA 3OVQA 3U0HA 3GY1A 2ZADA 4NQ1A 1QTWA 3ARZA 3B40A 4PYSA 4UNKA 2G8ZA 1UR0A 1GPWA 3P61A 2FVMA 4ZSUA 4O4VA 2E09A 5FF2A 2DZVA 3EA3A 2BMBA 1OC6A 5LA0A 3G1XA 3EOEA 1OM0A 1BTMA 5LKYA 4JNMA 1AZ1A 1KC7A 1LP6A 4DELA 4NNAA 3FJ6A 1XLJA 4NAEB 4M0XA 3KL0A 3SGUA 1YNPA 2HXUA 3M5XA 1PL9A 2NQJA 4PL2A 5I3DA 2VX4A 2CKRA 4L4OA 1MRQA 4C7DA 1DORA 2Y89A 1ZBCA 3GHRA 3G3MA 3MBDA 3SY1A 5REQB 2O55A 3QSTA 4GIEA 1NY1A 1EKOA 2CZDA 1XKJA 3U4AA 1E51A 3CV1A 1PKYA 2RDWA 2ZE0A 2IPWA 1Q85A 4KIRA 3BARA 2VEIA 4ZL1A 4GRSA 1BEUA 3T6CA 3GDBA 7ENLA 1RY0A 4BZYA 4FNSA 3UWUA 4MYAA 3P81A 2CHNA 4Z1BA 3LNPA 4X9YA 2TPSA 3NSMA 2OODA 1RK6A 3NL3A 4ZO7A 4IGMA 2OZ8A 4M24A 2X1UA 2XIOA 3PZMA 3HTWA 3AWOA 1HKMA 3KS5A 2DVTA 5DY3A 3DFNA 3R13A 1VPYA 4JL2A 4UNLA 3QV8A 1WUFA 3ABQA 3O0KA 1ZU8A 1IHIA 4O1AA 4MFEA 3PZVA 4WCJA 4DJDC 4LUYA 1QPNA 2ZX7A 3P67A 1R3RA 4JQ3A 3M0YA 3UGRA 3JZUA 1IZKA 1EPXA 2W61A 3QYSA 3N3MA 4OQVA 1NAL1 1QI5A 3QZAA 1DJYA 3TA9A 3CIVA 1JIBA 4JQ2A 4Q8QA 4LQ1A 3AUJA 4U31A 3VGBA 3ZO9A 3DG3A 4S3CA 3VC5A 3R7MA 1OFQA 3FW6A 1R3VA 1KGXA 4FLSA 3VDAA 1MXDA 4C1NB 1M65A 4MM1A 1EWEA 1S2WA 1JZ2A 2Z7KA 3RU8X 4AX6A 2X0SA 2GDQA 4C6FA 2DJXA 1CPUA 2PWHA 4OIFA 4BHYA 3H2NA 3IJ6A 5AKQA 1MW1A 2PDPA 1QBAA 3GBEA 4HOZA 1OCBA 3BMWA 2VEMA 3ZJ6A 4LAMA 3FSUA 3BLEA 4WY0B 4MMWA 2J13A 3SQMA 3UG8A 3MO4A 2VVSA 1AK5A 2J75A 1E71M 2GPTA 4AZBA 3N15A 5DRIA 4I5UA 4MWAE 3GWQA 4C6LA 4L56A 1VEOA 2ABAA 3ZZ1A 2VRQA 1TWIA 3P2VA 4D71A 5B7ZA 3T8LA 2YIHA 1UPMB 3CWNA 4AX7A 3LERA 2PDNA 1SZGA 5K7JA 2KZHA 4KESA 3VE9A 5I00A 1L8NA 4Q8VA 4P7QA 1B54A 3D46A 4XZ9A 5C8BB 3P80A 4QAIA 3CC1A 3FEMA 3ECQA 3R8GA 1XLDA 4R9XA 1A53A 2PFHA 3WQOA 5AECA 2WMKA 2ZYFA 4KQNA 4PTVA 3VXGA 4B4FA 5FAGA 1R7OA 1WXZA 3WX7A 4H8UA 4W7VA 1LOSA 1BGGA 4JKLA 1WXYA 3R11A 2PCEA 1F3EA 2QCDA 6ENLA 3M0ZA 3IIZA 1FBAA 3FYPA 5HNRA 1EF3A 2JKPA 1E0WA 3CTTA 3GM8A 4PTDA 3GAKA 4H7CA 5DT7A 1REQB 3LBCA 4J35A 3B04A 3KCOA 1JF6A 4CQAA 1QNQA 1JCNA 3WFZA 4HPHA 2PGWA 2DZPA 3LHZA 4Q33A 3MKVA 1U2YA 1P4CA 4CD7A 1MEIA 1YIXA 2YA2A 2QIIA 3FKRA 4L6OA 3P84A 2IW0A 4D6CA 2WBGA 3QXBA 3JS3A 2JGYA 1C9DA 1KTNA 2DSWA 3OHIA 5G5IA 3VNYA 4TXEA 1HJWA 2G5WA 1GVOA 4Q7NA 4QDMA 1AW5A 2CBJA 4Z17A 3TXZA 5TAOA 3QMSA 1BWVA 2BNJA 5AHFA 1T8QA 3EPOA 3M0XA 4FX6M 4ORIA 3IJLA 2XFWA 3LCHA 2EQDA 2R82A 4R85A 2X16A 4CEUC 1F6PA 3DG7A 1VFFA 1FHLA 3MI3A 2VFFA 2FTWA 4K37A 4W86A 4LB3A 3E2QA 4ZB5A 2OLAA 3MB9A 2OYMA 1W3TA 1A5MC 5TD4A 1UKQA 5HPOA 3BAIA 3EYPA 4Q6JA 4Q8NA 5CC5A 1X8CA 4AHQA 3KOWA 5FF4A 3VZXA 4QTGA 4A4AA 5D8ZA 4PCSA 1SZEA 2X2GA 2Y5JA 4GVHA 3SB0A 1OJXA 2X7WA 1MFUA 1BGAA 4PEEA 4MWAA 1VBJA 3NDZA 4JNZA 1G4TA 1H62A 3EX6A 5CZTA 2ASHA 1UQZA 4AUBA 4PUJA 4RE3A 2ADAA 1EEXA 2G96A 4MY8A 1S5WA 1YNQA 3ZVHB 3BAXA 2A4AA 2DPEA 4DBDA 4PFHA 3P60A 3WNPA 4BQ2A 2GVEA 3D0CA 1G9HA 3KTSA 2NUYA 4KEMA 2HS6A 3EMQA 1I2NA 1WDRA 1NF0A 1UG6A 3UESA 4FLQA 1V51A 3UWZA 3H2AA 2FZDA 5M1TA 2P8BA 2VC5A 1DBTA 1LUCA 2VGBA 1OX5A 4XO7A 4JN6A 2QJMA 1M6JA 2FVLA 2QCHA 4QNEA 3ZIZA 4DJEC 2GYIA 1OF8A 1QNSA 1VIZA 4O11A 5AVHA 3T08A 1UR4A 2ZA3A 4ZB0A 3B0YA 4GVFA 3CMJA 2ZKMX 4X61A 2BV9A 2DZWA 1XX1A 4WGHA 3ITLA 2XH0A 4CNOA 2XZ7A 4R7WA 2NV2A 1R38A 3OG2A 3AIQA 3S0CA 1H60A 4DVOA 1D8WA 4D6EA 2JF6A 1TPC1 1J2BA 4ERIA 1GQKA 1XBVA 3NVDA 4JTQA 3RJYA 2G41A 2PMQA 1CLXA 3T0BA 1TA3A 2VHLA 3BMXA 4WSJA 3PSVA 3QQ1A 1Y5XA 4WJEA 3IJQA 3KVJA 1TV7A 1R7AA 3TZFA 2Z1KA 3PJXA 4FOJA 3HPZA 4CD8A 3XINA 3GNOA 3TTOA 1IXOA 2BVDA 1FWDC 2VEKA 4L1GA 3BSHA 1P5BA 1XLAA 4L5ZA 3N12A 1EZ2A 1NFBA 4TQTA 5CKSA 4JX4A 3GVQA 1DWFM 1G6CA 1EJ7L 4UZSA 4LW7A 3TXVA 4E6MA 3ZR4A 1UKPA 2FHBA 4CGTA 3KAOA 1XR2A 2A3HA 3BH4A 2XDFA 4TX9A 5A8OA 4QDPA 1CXKA 2X2YA 1VJZA 2FDMA 4JIHA 2IKGA 2QDGA 3LY0A 1OSEA 1Z48A 4J3WA 1UWAA 3DERA 4NI3A 1OX6A 1GHRA 5LNVA 1K9EA 2OSWA 2VX6A 1B90A 3T40A 2GUYA 1RCQA 2PF0A 2XGBA 4IHCA 3UZJA 4GACA 4GY7A 2XGIA 2OO6A 1B3XA 5G2WA 1A0DA 4QE4A 1E6PA 5CZKA 2WMIB 3PG9A 1YXCA 2W9MA 4R27A 4YVXA 1L6SA 1BWKA 1PXGA 4HOXA 2YCKX 4GI8A 3C0JA 4L9YA 1V7AA 3NQ2A 2G0WA 1X96A 1YMYA 4JTCA 1E6XM 5C9WA 4HNOA 2J27A 4YIWA 4OV9A 2VZSA 4PMJA 3WD3A 3UF9A 3WF4A 3L4WA 3ZR6A 2YCLB 1YTEA 4MB1A 4DXKA 3URNA 3DYPA 4RV8A 4MLRA 1Z44A 3BLOA 3LN3A 3TAOA 4XUYA 2D69A 3OG3A 3W00A 2XSAA 1TJRA 2H3DA 3NURA 3G22A 1PO9A 1J0IA 4BQ5A 3WQ5A 3XIMA 1LYXA 3SR7A 1WPCA 1H50A 2D73A 1XYCA 4C6NA 3FDGA 2WSKA 1AQ0A 4MB5A 3W4RA 3AO0A 4N02A 4LYKA 1PHWA 3G24A 2FZ9A 4BI6A 4H7ZA 4LU0A 1ZBKA 4NRSA 4TV5A 3VZYA 3PJWA 3OQ8A 3H7UA 2DZUA 2A6NA 6TIMA 5EB8A 2YFOA 4G5DA 3TLLA 3AZSA 1W6TA 2VRKA 1L9WA 3AISA 4ACZB 2OEJA 4XV0A 5CPNA 1HGWA 3VGDA 4C90A 4CCCA 1IGSA 3P3BA 3AMDA 4YTUA 1UMYA 1FWHC 5I3IA 1J12A 4DZHA 3NQMA 1XKYA 4HNVA 1M53A 5K9DA 1F76A 1I1WA 4FK9A 1W54A 1H7OA 3LLFA 3NSNA 4CN4A 4LRSA 8XIMA 3QW3A 3KXQA 2D23A 3APTA 4P7LA 4ROPA 3F4VA 3I6RA 5AOUA 4OOUA 3FS2A 1E1CB 3ZLHA 3AXKA 3ES7A 1UP2A 3OPSA 3HGRA 4B4HA 1W37A 4AU0A 4HZMA 5D2WA 3TNBA 4WDXA 3WCZA 4NZ4A 2ZUUA 4DUXA 3KZPA 3S5OA 3I65A 4J40A 3W1PA 4M51A 1TJ0A 2REQB 2X42A 4R7OA 1O66A 3QZ6A 1GGOA 1LRNA 3TQPA 2E1DA 2EEXA 4O13A 1F4HA 4D8ZA 3RAOA 4EACA 1VS1A 3KE0A 1VYSX 5I6SA 2J62A 3FHQA 1V6TA 3UWWA 1T41A 4L9ZA 5FOOA 1JF5A 6A3HA 1S2AA 1HO1A 1UHVA 4X2PA 4IQEA 4W87A 5I2UA 3PNZA 1TKKA 3LOTA 2WZIA 2SFPA 5C71A 2BLEA 1W2VA 4JIIX 2VZVA 2HVOA 1YHTA 5FA5A 2ZVIA 5IOBA 1O68A 4B16A 2VC7A 3EKZA 2PD5A 1WYIA 4C6IA 5BRPA 1YPXA 3QPYA 1XRSA 3WNKA 3H24A 3NZGA 1XD1A 3KBVA 3ZT7A 3B8TA 3VABA 3TFCA 4BQ3A 5KZMA 1KKRA 1W3JA 1RLCL 1XSKA 3CH9A 2HV5A 3L21A 3MY9A 3DFSA 5DCDA 3UWQA 3W7LA 4AWSA 1UJPA 4HHPA 3OOQA 5I3HA 4LNCA 4J27A 5D2XA 3I4EA 4S2BA 1BVNP 4RCXA 1CB7B 2HXTA 4ADTA 3K13A 4IPJA 1BF2A 2G50A 4GX9A 5BCAA 3ABRA 4EF9A 1SW0A 5FF7A 3FA4A 1MZRA 1JZ5A 1DE5A 1XYAA 2EHHA 2V5CA 3KVMA 1KXVA 6TAAA 1EWDA 1IEWA 3C2YA 4IUGA 1BRLA 3IVSA 1JZ8A 2JFEX 2L5HA 3ICJA 4M6QA 3UA4A 4LOCA 1E15A 1LORA 3BPWA 1Q6RA 3TW6A 3SIZA 2PWGA 3A6OA 1R47A 3RX3A 2VCBA 3HPXA 3GXPA 3QGKC 3UERA 2MANA 3K4DA 2FPVA 1P7TA 2NT1A 4P7OA 3IS4A 1B5TA 3D5HA 2KX9A 3N2TA 3TJIA 1ZAJA 4PE8A 1W0MA 3TYDA 2WNZA 3PULA 1YTKA 3H23A 3TN5A 3L2LA 5GNXA 2PF8A 5KETA 1IR2A 3MYOA 5I0DA 3PPCA 4M5PA 3E0WA 3T8QA 3IUDA 4NL1A 3GDTA 3WKZA 2GVYA 2Q3OA 3VOJA 3ALFA 3N19B 1D9EA 2PBOA 1UP3A 2BWGA 1H09A 2WYSA 4A29A 5JMUA 4ZENA 2PURA 3UA3A 1OFPA 4DYKA 3A12A 1DE6A 5A2BA 3OO2A 4IFKB 3TKFA 1XIJA 3LM7A 1FCQA 4NIRA 1XQKA 4FNPA 1G5AA 5BOEA 3IGXA 1BSLA 3UG4A 2WCAA 3UXKA 3QEZA 3CZLA 3UP8A 3KDNA 2VR5A 3QW4B 3K4WA 1ZAIA 1XUUA 4UOZA 1CGUA 5DCEA 1HKVA 2ZZ3A 2WANA 3BSGA 4AVFA 1EHAA 3WJSA 2OB3A 3KVKA 2PDIA 2YCIX 4KIEA 2WVUA 2I56A 4HSNA 4GUIA 5D9PA 3JU2A 3ANUA 2X40A 1ZHAA 1E0VA 4V1XA 3ARXA 2YXOA 4IG2A 3MTWA 3GG0A 3A24A 1PYMA 1DL3A 3MMUA 5FEZA 3CK5A 2PDHA 4WUIA 3A22A 3P0XA 2R1NA 4EIVA 3BV4A 3STEA 1C3FA 4V2XA 4JFWA 5FSDC 1TMHA 2B7PA 2TYSA 4UWMA 3P8IA 3V16A 3RLUA 1O1HA 1FH8A 4G9PA 3FEQA 4WK9A 3ZJ7A 4ZOCA 1NTHA 3DFTA 3NQCA 4POCA 1MVYA 1TG7A 3H12A 3N3TA 4U5KA 1LCOA 4BS0A 4KRZA 5BXPA 5CSUA 3BDKA 3RJXA 2FYMA 4QJ3B 2JKAA 4HZ6A 3CQIA 4UR8A 4D6HA 1F3TA 3W1UA 4RZ5A 1BFNA 3BMVA 2PD9A 3KOZA 3R43A 5E0KA 4GABA 2P50A 2CBUA 4DZAA 3OB8A 2E1WA 5HINA 3IIXA 2YBUA 4UQAA 3IK4A 2DV0A 3WQCA 4LSBA 3GVVA 1TZZA 4XZHA 2WQPA 1MUCA 2FPTA 3F2BA 1KM3A 2DFAA 2XN0A 2VUYA 3LSCA 5FEWA 3BXWA 2HTMA 4DM2A 2PGEA 3TAKA 4HNUA 2J6VA 3QYQA 3PANA 2BXZA 2VFEA 1H7NA 4AY1A 4O0KA 3IV8A 1NARA 2P8CA 5XIAA 3W7JA 3WLIA 5BWAA 2XIMA 2VX7A 1QWGA 5EA9A 1OYCA 3HGSA 2V82A 4RNHA 3B03A 2WVSA 3F5KA 4ZFCA 1HN1A 1ZCOA 1H0IA 2YJQA 3EWWA 1JCMP 4I9JA 3PZTA 3FYYA 4PTXA 3QKZA 1F6YA 3WYZA 3M0IA 2HRWA 1JZ7A 3VIOA 1CCWB 4FMVA 3VINA 3LA4A 2NQZA 4O14A 3W28A 5JXQA 4Y9OA 1EGVA 4P8UA 4UTJA 3ID7A 1FWTA 2Y8KA 4A05A 3APGA 2F6XA 4E2OA 1Q13A 7REQB 4UNIA 1W1B1 4OWGA 5J8LA 2DUXA 4TX6A 4ZQCA 1QR7A 4V28A 4P8VA 3SRHA 4OZOA 2X41A 4PCPA 3AIUA 2NV1A 1Z6KA 1XC4A 1XM3A 1H7XA 4R9OA 3FXYA 4UOJA 1IWPA 2EO7A 5FEPA 3OHMB 1V3LA 3PWGA 1TRDA 3H2CA 3Q4DA 4GZIA 1NDWA 2V5DA 3PTMA 2OLSA 4PSRA 2ZZ7A 1AG1O 2B31A 5J5RA 1RPXA 3ZJ8A 1TV8A 1XINA 1H7WA 4EXQA 4FSAA 2P88A 3V1HA 4MSSA 4G2DA 4LAOA 1F07A 3FXGA 3WEOA 1NVMA 3OYXA 1XLGA 1EBHA 3AIEA 4YL2A 1ZPTA 3C56A 4IL2A 4WOZA 1Q6OA 5AYXA 4FNUA 4XZMX 4GIAA 4S3JA 1NWTA 2WO5A 3W7KA 1ZJAA 2ZA2A 5CXPA 4F79A 1HG3A 3W7QA 3VTRA 3QR1A 4U4MA 1VGAA 4ZO6A 2YOCA 4LBSA 3PUEA 1YTDA 2ZUNA 3AXHA 5H8PA 2V3EA 3QMTA 2GLKA 4K2SA 4S3FA 3A13A 4PMVA 4E4PA 3CU2A 2DP3A 1KBKA 4CQBA 3HBLA 3RYSA 3TE9A 2A6LA 1JR1A 3C3UA 2J6XA 2PDYA 1XC6A 1LROA 1BHGA 4EP8C 4AF0A 2DT3A 3AHZA 1K9DA 3A21A 5LA1A 2ISSA 2BFGA 4ORMA 1UR8A 1GKQA 5F4WA 1OFAA 2NVDA 3IJ8A 4ICNA 5A3HA 4OT7A 4XD6A 5H1WA 4FP1A 3C61A 3AYTA 5H6HA 2NX9A 1TPH1 1YQ2A 3WL1A 3SCNA 2ZUSA 2OQYA 4AISA 3KRSA 4MLJA 3OGSA 3K8LA 1NQKA 5FJIA 2WVVB 3R89A 1Q5MA 1QI4A 5D2YA 4KBXA 1G01A 4WDWA 3WK0A 4H2HA 7A3HA 3DKLA 4D1IA 4DAFA 2VDGA 3GNXA 4LUIA 3THDA 4IIGA 1W8GA 3SCRA 1TR1A 4GZ7A 2HZGA 3C2VA 2ZX5A 5DO8A 4FR1A 4B92A 4IP7A 2X1IA 4AIOA 3PBUA 1EO5A 4F0KA 1JD9A 4RZ6A 3DBNA 3OIHA 3F7JA 3TMLA 1BVZA 1WQ5A 5ENLA 3BG9A 1UIOA 4ML9A 3GYCA 3DFPA 3STGA 3NZ1A 2BDQA 1J0YA 4HPJA 4D1JA 4DWSC 5FSEC 1VHCA 1UBPC 3NQGA 4NX0A 6REQB 4BA0A 1ZQ5A 3W01A 1WBJA 2ICSA 3KEHA 3B97A 1K03A 3O16A 1XLHA 4Q4PA 3WLJA 2NXHA 4J3UA 4FEZA 3UWEA 2H9AA 1QFEA 1UA7A 4A3QA 2YL5A 1FFRA 3LBMA 3PM6A 1XIGA 1KRBC 2B4GA 1QW9A 3RK8A 1QDSA 1W1YA 2XHYA 4EPDC 1B3OA 2ZRYA 1P6CA 1GOOA 3U5YA 1V3IA 2Z27A 3WG6A 4MJ2A 4Q8UA 1VFTA 1RQBA 3A4JA 1LG2A 4Q22A 3TX9A 4YTSA 2ZWYA 5T9BG 3CWOX 3L4YA 3C4UA 3DEQA 1RBOB 1RY8A 4KFPA 4US6A 3UCCA 4NAEA 2Z0IA 3BLIA 3L0NA 7TAAA 2VOMA 3HGOA 4BCEA 1X97A 4EKJA 2J9XA 4KEVA 3N4AA 5REQA 5I23A 2D2HA 3QQ0A 4QR6A 3WLRA 3BCFA 1XRFA 5EL1A 2WZEA 3EEGA 3H22A 4O0ZA 1R9XA 1TYGA 3SCOA 4OE7A 2A3CA 4KWUA 5E6ZA 1XFBA 2XPKA 2VWSA 3GVGA 4EPEC 3MI6A 3S2CA 2GSHA 4FX7A 1RJPA 3Q94A 3TN6A 4QCEA 3VVGA 4XVEA 2V63A 4YVVA 2A21A 3CHCA 5HA7A 3N73A 4HYVA 4MKNA 5DXXA 1VF8A 4GCAA 4CN1A 1S5NA 4UCGA 1CYGA 1K8ZA 2OR2A 5DRCA 4EAMA 1FUYA 2WXDM 3DFOA 3IIVA 4BI5A 2Z6IA 3PC0A 4CKQA 3S6OA 1F3WA 1ZP3A 4JY8A 4AIEA 4RZBA 5EBAA 4O10A 4NSBA 3DHDA 4WOQA 5HQEA 1A5LC 5LNUA 5CJMA 1JCJA 2V6AA 1ZGDA 4H6EA 5U4NA 5EU9A 1K9FA 3QPEA 3JRKA 5FESA 5C54A 4XBSA 1UR9A 3G2GA 4QE5A 3CO8A 1S3TC 3TYEA 5G4WA 4S3EA 3WDQA 4IGNA 1VYRA 4AWTA 3W6YA 3LV6A 4C1NA 1OZQA 3UWVA 4PMXA 3CAKA 4MVAA 3IVTA 3W7RA 4C65A 3NQ6A 2R8WA 4H4IA 3W81A 1HKKA 1IEQA 3S1WA 2QVHA 1UCWA 2Y85A 3UCDA 4N9DA 3WDIA 4JKKA 1QOQA 3M46A 4TVCA 1DJHA 3NTYA 1QK0A 3G1DA 3LZ5A 4JIRA 2BOGX 3GXIA 3T9PA 2D3NA 1UC5A 3IIPA 3TEVA 4PA8A 4WY0A 3CQKA 1CECA 3PUGA 4UQBA 4HSHA 3FAWA 3PSWA 3BLFA 1ZBVA 5MHBA 4A35A 3M7SA 2Q8LA 1V0LA 3DFYA 3URAA 2A3AA 1LDCA 1EX1A 2PA6A 2JALA 4YMZA 1N2VA 1Y5WA 1U30A 4EX4A 3W2LA 5CJ5A 1FWFC 5KZEA 2V2DA 4EPKA 4C1KA 1X38A 4DJDD 1UD6A 4FOKA 1DHKA 2PDXA 4HPGA 3K1GA 2YR1A 2WJZA 3KRUA 5G1TA 5AC6A 4QROA 4GX8A 2ACSA 4PULA 5DEZA 1JG9A 5A6LA 4XZLX 2PZ0A 4E4FA 3W29A 4TV6A 3SFKA 4IX0A 1SFLA 1EIBA 1VPXA 5DLCA 1GNXA 4D9PA 3PZGA 4AEFA 3L0GA 3QPZA 2ON3A 2WC3A 1W9PA 2X8RA 4GFIA 5EYWA 1KCLA 3O2LA 1W9UA 4CD6A 5M2FX 4K7YA 2F7FA 3GG1A 3ENLA 4PEKA 3RUBL 2OMAA 4I9MA 2ISFA 3EOLA 3HQ1A 4R3UA 1TMQA 2J7CA 2VEFA 3KLKA 2PDGA 1UOKA 1REQA 3MSYA 4S38A 1VIWA 2QCDB 1K4HA 4R5EA 4MPQA 4PMDA 1NDVA 4B5SA 1VBHA 2ATMA 1JYWA 4LT9A 3MMWA 4OOZA 1PAMA 1RP8A 4J2PA 3TROA 4W8AA 4DYJA 3K8MA 4H8VA 2HE8A 5DFAA 1UUQA 4GC4A 4U10A 2I5QA 3ZQ9A 4H9YA 2CITA 2DY3A 2FHFA 3GKFA 2A0NA 1HZYA 1OX4B 2G95A 1B3WA 1J6OA 4JTAA 1UD3A 2NV9A 3L5AA 3LPPA 1B9ZA 3GZAA 3ZJKA 1GVSA 5TQLA 2J78A 1OYAA 2QUVA 5FL0A 4MWAC 2AOSA 1TVPA 2D24A 3VIHA 2IS7A 1WAWA 4GNVA 4XKMA 1P0DA 4O1DA 3PVFA 2Y88A 2V81A 4Y90A 3IJDA 3LENA 1WXJA 3KBNA 3GDKA 5EMYA 2WCGA 4L4PA 5C9RA 3GNPA 4C1LA 2CBVA 4UUIA 1R30A 3I3EA 4K7VA 1RCOB 4XQ6A 2Q8XA 2CNCA 4QEEA 3BV7A 3REQA 4ASTA 5CSYA 1LOLA 2EKGA 3LI0A 3MKCA 3OBEA 5M3WA 4UMBA 3QGAC 1UW9A 3SCUA 3CHVA 1GVQA 2CHRA 1AD1A 4TR9A 3AUOA 5JQ9A 4JZ5A 3ZVHA 4MNLA 2F38A 4PUMA 1L6FA 1SGJA 2WJDA 5D4YA 3WH8A 3T09A 2ZOXA 3UY8A 3E2VA 5TF0A 1GJWA 1QT1A 1ITUA 3E5PA 2UV8G 4L65A 5I3KA 4ALDA 1ISXA 4IQDA 3V7PA 3WQ4A 5A1AA 2W62A 1FCBA 2AQWA 4Z2KA 4X9SA 4ATWA 1HJUA 6ALDA 2XG9A 2EKCA 3AS2A 4IWWA 3WQ6A 2BY1A 2YL8A 5D9MA 4MAVA 5C55A 1TTJA 1ZS2A 2WM0A 3ZWTA 3S5NA 1JI1A 2ZX6A 1ECEA 2E3ZA 4D8AA 3ARPA 4AZ7A 3LXBA 2GVJA 1K4GA 2W0UA 3IAPA 3G1SA 4PC8A 3N9SA 4FPSA 3POHA 2JF7A 1MDLA 2WNWA 5HATA 1UZHA 4BY3A 2QCLA 4AW7A 5AC8A 2P0OA 4IOTA 2YYUA 1GT8A 3KM8A 1JVNA 1YBQA 3W84A 5DN1A 1CBGA 1E5NA 2VJXA 1IIHA 3CUIA 3BGJA 3EPMA 3TU9A 3CEUA 3ARUA 4X0NA 3TYAA 2UY5A 4IX2A 5I07A 4A8IA 1FWJC 3GC2A 4D6FA 3QLLA 2O4MA 2WAGA 3SUUA 4E4UA 3PPFA 3E0LA 4LCSA 3OZPA 1WX0A 3LK6A 1VCVA 1RD5A 2V9DA 3E2RA 1TWSA 3FFSA 2R91A 1QK2A 4R7JA 1JI2A 2VGFA 3MKKA 4AZIA 5RUBA 4C6JA 1HKWA 4HD5A 4DB7A 2VENA 5A6TC 3SN1A 4LWWA 3EWCA 5KITA 3VOIA 3BAJA 4IF2A 4FXFA 3LHYA 3UG5A 3JVAA 2VZOA 1JPHA 1UZDA 3H2MA 1I75A 1KRAC 3SO7A 3NZQA 3RPMA 1GVEA 2RFGA 4AD5A 1XIEA 1HKIA 3G18A 4HNNA 2FGLA 1AL7A 3TWAA 2VDIA 1Q7QA 2A3EA 3CBWA 2AMGA 1Q6QA 3L67A 1B2YA 1W9DM 2C14A 3FY1A 5CAKA 3GHTA 5HMSA 1OZMA 1UB3A 2O9OA 5C70A 4KS0A 4QIUA 1VAHA 1W1TA 5BU9A 5C2GA 2W66A 1YXYA 1H3GA 1AQHA 1UOZA 3CAQA 1KBIA 1QXLA 2BB0A 2OZ3A 3UXAA 5CBBA 3TZNA 3G8RA 2E0PA 3W72A 2ZZ6A 3ZFHA 3G1AA 4IGSA 2QV4A 2VFHA 2YA1A 3I3DA 5DY2A 3QMRA 4AG0A 2IKHA 5LSMA 1GKPA 3U3HA 4PMZA 1VJSA 4NZ3A 4XTDA 3NM1A 4PH6A 2J88A 2WMIA 1UWTA 4RW3A 1QU4A 1SJAA 4AAJA 2A7RA 1DOSA 3I10A 3LRKA 4QS5A 3MUY1 5LXXA 4XAGA 1XSJA 2FVKA 5BROA 2XM2A 1L8PA 1PBGA 3EDKA 4IIFA 5A6BD 4MAZA 3R5EA 1DXIA 4DNHA 2YCLA 1UWUA 3ITGA 4AIUA 5LIKX 1UD5A 3SJNA 4U3CA 5I24A 3PBWA 2PLJA 2XIBA 1LBMA 1B3ZA 2J8FA 3K2GA 4ADSA 3W1LA 3O7UA 3TW7A 4AD4A 3QM3A 4ZA0A 3GG8A 1IZCA 1QNRA 3TN3A 4I3GA 4JHMA 1JFXA 1FCUA 1OFOA 3B9AA 1YPIA 3KL5A 2ESCA 9XIMA 4GQGA 1KFBA 2CXEA 2GGGA 3EDJA 1N7KA 4ACZA 1EC7A 3P62A 4FI4A 4H8NA 2D2JA 4MB3A 4QJ4B 4TU1A 1Y8BA 4GWEA 3STFA 3TOYA 3OBAA 4IPIA 4JTUA 4XX6A 6XIMA 3TOPA 1R2RA 1GQNA 3TK7A 4XZBA 2XINA 2J7DA 1NH6A 1XGEA 5CZSA 3A5FA 4X63A 4YCPA 2E9BA 2H6RA 1E56A 4MUZA 1KXTA 7CGTA 3EDEA 4NG3A 2CCRA 1U1JA 4JDBA 4DHGA 3W1RA 4GGBA 5CSSA 2X09A 2VO5A 1J96A 3NPUA 4NY2A 3THAA 1YE4A 5CC7A 3V0TA 3L2IA 1X98A 1KM6A 1E1CA 1WBHA 1PHQA 4CUCA 2TAAA 2QCNA 1BYDA 1UD4A 4D6JA 3AU2A 1DWHM 2J25A 4QFUA 1ODUA 4W84A 2W79A 3DAQA 3PWAA 4HPNA 1DVJA 1OFRA 2REQA 4LUTB 1KD0A 3TQVA 2V3DA 4ZBCA 1JFHA 1Q45A 3MSGA 3T4CA 2PSNA 1R3QA 2WHKA 3WMCA 3S83A 2XFFA 4G1NA 1C7SA 1AQFA 4H9ZA 4C7FA 4MHBA 4YTRA 4F9DA 1TUXA 4HNCA 3QSRA 3WELA 3H54A 1W5OA 3UWYA 4JTHA 1O5KA 3H7RA 2YZ5A 1DQWA 3E38A 1EO7A 3GU1A 2PDFA 2IQ0A 2ZRZA 4JIEA 2O7QA 3DGBA 3H6OA 4RLIA 3ABZA 5F2IA 3LEPA 1KR0A 2QJNA 1ZFJA 1EA9C 2FH6A 1MZHA 4QSFA 1CLKA 1V08A 3PBYA 4QG8A 2I57A 2KAUC 3G77A 3SY5A 4TVUA 2GSJA 4UTTA 4KFOA 1GOWA 3DI1A 1I4NA 4PCTA 3W9ZA 4HVXA 2ABBA 4PB4A 3I68A 4N0RA 1SFTA 3CZ8A 4C6KA 3WNOA 1FTXA 3DOPA 1KV8A 3F5JA 3INPA 4XAFA 2DQWA 1K1DA 2XVLA 1LL4A 3E0IA 3RCYA 3EB3A 3W2NA 3MJYA 2DUZA 1AA1B 3MA8A 5EFFA 2VURA 4DF1A 5T26A 1GEQA 3AJ7A 1GZJA 1BSIA 1SR0A 3CHEA 4EWJA 4HTBA 3GU9A 1QPRA 4XZIA 1EJUC 3A4WA 2A2IA 3THQA 3C0LA 3MZNA 4GINA 1E0XA 2IKIA 3S1GA 1HKJA 4PUUA 4NJJA 2PPGA 2Y62A 1ZB5A 4KCWA 2V3GA 2C6QA 3NZRA 4KPLA 4E5TA 5BRQA 3R0UA 1TJ1A 1X6LA 3E5BA 3I6EA 1GOIA 3KOYA 1FDYA 5HWJA 4G6CA 1XSIA 4QE1A 1ISWA 2E77A 5E70A 3VKKA 1CXHA 1P7TB 1K77A 2JBMA 1QHZA 1OFEA 1E0UA 1EEPA 5KINA 2ZBTA 4JFSA 3W70A 3M5VA 1TQXA 5G2HA 5GPRA 4B5TA 1T5AA 1WZAA 4WQ6A 2X1TA 1T40A 1V3MA 1A3WA 4CQDA 3WLHA 2HK1A 3BW3A 2PC4A 1C93A 4JPGA 4IFKA 1H1YA 4JCLA 3TUUA 4LV9A 3C2OA 3T81A 1Q63A 1FWIC 2OYLA 1XL9A 2JEPA 4DO4A 1YNYA 4C6OA 3RM4A 1XCFA 4M1RA 4K3ZA 3TIMA 3PTDA 1F4AA 3W7MA 1RZMA 3WMLA 4RUBA 1LF1A 1UJQA 4CQ8A 2DW7A 3AWNA 5A6AA 3QC3A 1Q66A 2DZBA 3WEZA 2YFNA 2BOFX 3UGVA 3SJ3A 3CZKA 4AD0A 3O6CA 3PPHA 2O9RA 3NYDA 3ZT5A 4A21A 4K39A 3LGGA 3T2QA 5IXEA 3TSBA 4P8WA 5D38A 4MZ8A 4XZNX 2GJRA 1PX4A 3CPRA 3M64A 3M0JA 4MJ4A 1E4LA 2CETA 1E6NA 4P2VA 2XVGA 3S47A 4M1BA 4I8DA 5XINA 3R0DA 2PRLA 2TODA 2Z4GA 3GFZA 1XW8A 3OP2A 5CGQA 3MSDA 3W02A 4L4LA 1KTBA 5C5YA 1UH2A 1SR9A 2ACRA 2Y7EA 4NJKA 1GWJA 4KCTA 4QNWA 1EUAA 3HG4A 2J8GA 1E4NA 3TMQA 1H51A 3KS6A 5LNSA 3AS3A 4MGGA 2Y1HA 3KRZA 4U33A 3EMCA 3WMBA 2PWUA 1E40A 1E9YB 2DGAA 1P0KA 2OFJA 1NM9A 1Q65A 2ISVA 2XH7A 5AB3A 4OUIA 1JQVA 3VA8A 2NWSA 3BOXA 4HYRA 1DJIA 1SJBA 1IEXA 3M16A 4FLOA 2PAJA 1SFJA 4YHGA 4S23A 3A4AA 2Z1XA 4S1FA 1BQCA 1P0NA 4GJJA 1U1HA 3MW7A 3NUKA 3VIGA 1S5TA 2C19A 1Q2RA 1HJVA 3F4NA 4DWSB 3IUIA 4LUJA 3PUOA 3T0DA 2FZNA 3QC0A 3G8EA 3TC6A 3MANA 3DX5A 2WKLA 1LLZA 3VNMA 3GS6A 1JDDA 1BXBA 1W9XA 1ZNNA 1W3IA 3EGJA 4PTWA 2J9YA 1LT7A 5C6MA 3DFHA 4CU8A 4E2BA 1BYAA 1C8XA 2HSAA 5H2ZA 3NEHA 4RKAA 3ITVA 3HO8A 1KTCA 2CLOA 1WZMA 7REQA 1QPQA 3EX3A 5FJJA 2BVYA 4AZCB 1XDMA 3C8NA 3MBFA 5K2ZA 1V3HA 3I4KA 5DELA 3WD1A 4HYWA 3LQLA 1FDJA 1HP5A 1G4SA 2Z2UA 4DM1A 1VEPA 1TPWA 7XIMA 3IJ7A 3W3OA 2NVCA 2D22A 1TZ9A 4HU4A 4LAUA 2HPMA 3QV6A 2IQDA 1OFBA 1MXSA 3HN3A 1TWDA 1EXPA 5HDRA 1I0DA 3RMJA 1QI3A 1I2RA 3VKDA 3ABXA 3UXIA 2IKJA 3ARVA 1V6UA 2QDEA 4BR1A 3N17A 5D30A 3HM7A 3L4UA 3LB0A 1WCGA 4FNQA 1CEOA 4XAZA 1H63A 3V35A 3NQDA 2PTYA 1I6NA 4GLEA 3UYIA 4GISA 2CWNA 3K46A 1PDZA 4O17A 4PMOA 4O53A 1IT8A 2ZRWA 2V67A 4HBKA 1A5KC 3ITXA 3H2EA 2CIPA 5BW6A 3MUXA 1N8IA 3DYMA 1A5NC 1L6GA 3U9IA 4GHRA 1KRCC 1OY0A 1FHUA 3RCMA 1US3A 4LUSB 2HEJA 2DIKA 4BEQA 1W3KA 4RNJA 4DJDA 3BOFA 4OUEA 3CMFA 2GQ9A 1J2WA 4O4WA 4CN6A 5KZ6A 3FJ4A 3IWPA 1PZ0A 4HU3A 1J0KA 2PDMA 3PBGA 5F2MA 5CBJA 2WWCA 2WSYA 1LG1A 4C6EA 4AF0B 2RGMA 4PN2A 3E96A 3IGSA 3DYOA 2P0IA 2Z25A 4PRTA 3MV11 3BLPX 1QATA 1VRDA 1YDNA 4NZJA 4XIMA 2WVVA 5DCBA 4DNMA 4LYPA 3V5CA 2INZA 1W1PA 4GMEA 4ZTXA 1A5SA 2P53A 1EA0A 4HZ7A 3GW3A 4QLKA 2HK0A 3MCOA 4IMFA 1ZY9A 4HU8A 4LAZA 3SSZA 3ONCA 1XIIA 3A64A 4A22A 4FNRA 4JTFA 3W24A 4RDZA 3P5ZA 1VCFA 1KM2A 4HA4A 3B8SA 3AXXA 4I5RA 1K7XA 3HGJA 1XIBA 4QSHA 4Z2JA 2OZTA 4DF2A 5EMMA 1GVFA 3GDRA 1H1NA 4Y2WA 3DZ1A 1OCQA 3TTEA 1BAGA 2DT2A 2C18A 6REQA 3LTYA 4HTYA 5I03A 2R6OA 3PBMA 4B5UA 1XS2A 5M03A 1TJPA 2WSPA 1KNWA 1MXGA 4GFSA 3VOFA 1A4MA 1XYZA 5I77A 4JQ1A 3BLLA 3LG3A 3AICA 4RDWA 2VKZG 4XK2A 2DT1A 1TE1A 4DPPA 1EQCA 3U7BA 1DXFA 4HT3A 1U5VA 4JAWA 4PGLA 2JKEA 1KXHA 4AWEA 1I2QA 4O12A 3W0KA 4JTSA 1UKOA 3VOCA 2GQAA 4NXKA 4F0RA 4EXAA 5FJTA 4LS1A 5GNZA 3OODA 4XBKA 3ORWA 1V7YA 4H7VA 3MDUA 1QASA 3TQKA 1X7IA 3ONBA 4JR5A 2PDBA 5EGRA 4XTIA 4ZTYA 4JTTA 1MW2A 3LPGA 1KFLA 3UZ5A 1DIEA 1P43A 4MNMA 2XIIA 2FB3A 3CV2A 3HG3A 4JTGA 3OTRA 4ILSA 1KFWA 4K8GA 1EB3A 2E40A 1T96A 5FD0A 1YW1A 4O28A 2DVUA 1W5MA 3PPGA 3VGHA 3PK7A 3AHYA 3R10A 2WLYA 2JE8A 4AHPA 3AC0A 1ZJHA 3CZGA 2PLMA 4DWSD 1IT7A 3NDOA 2GOKA 4YPJA 1SO6A 3G1YA 2YYTA 3UZZA 3H70A 5CBIA 3SADA 1QOXA 3M0VA 1F3XA 2QS8A 1E1FA 4UTUA 4PB5A 5C9XA 4CNPA 4GUFA 1CGXA 4NJIA 5C2CA 2BSLA 2J7BA 1TSIA 3N34A 5A8NA 3FCPA 4YLWA 2CU0A 1TX0A 3UNTA 3BO9A 4W89A 2NZLA 3O0FA 4Y9MA 4Z1DA 3M6DA 4D8LA 3LQGA 3MHFA 1IIGA 4DBUA 1PX3A 3T07A 3GQYA 4Y7EA 2BVTA 3G6MA 2XVNA 5HMEA 2PDJA 2CEQA 1CXIA 2QPSA 3ARYA 3UJEA 3KBWA 3U2ZA 1W2PA 3B9NA 1WE5A 1UR3M 4GPNA 3L65A 3KTCA 4IICA 4UR9A 1C90A 2ZICA 2OWWA 1PSCA 1TPDA 2A7PA 1JXJA 3B4YA 4AIBA 5FACA 2GGJA 1ONRA 1X1OA 2XIQA 2E6DA 3GIPA 3ZLGA 1WKFA 1TUFA 2QV5A 3U2EA 4LS2A 4QG9A 4PSPA 3B9EA 3TJXA 4UR7A 3DI0A 4Z1YA 2HVNA 2OOGA 5D2TA 3GUGA 4HK7A 2PP3A 4P61A 1Z8AA 2VUNA 1XDJA 5A2AA 4JEJA 2PTXA 3OEXA 2G4FA 4C5YA 3VIJA 4O54A 1JRBA 2NX3A 4ES4A 1SZFA 4IMCA 2QQ6A 3ARTA 3W7HA 4NNCA 4HOWA 4GIYA 5KZDA 3U8GA 5EY5A 4C6MA 1L2QA 3AIWA 1Q4NX 2QW5A 1R3WA 4QITA 1EXBA 4GJ1A 1PCWA 3T1GA 4O8AA 3WD4A 2GL5A 1I9CB 1IR1A 1JPIA 4ZXLA 1ONXA 3SECA 3T2PA 1P6BA 1ONEA 3LHWA 3OGVA 1TPEA 2QDDA 4NAFB 4WHBA 3H4WA 3NO1A 3BZGA 1DIKA 3URQA 3U7VA 1H7RA 4WIWA 3S3GA 5L9FA 2V68A 4AD2A 2PRHA 2XH4A 4GBDA 4I7WA 1JCXA 2PU1A 1THFD 3OBKA 1ITQA 2NT0A 2E8ZA 4HA3A 1W8SA 3W2JA 8CGTA 3WBAA 3WSUA 5A6JA 2OQHA 1L6YA 3P0WA 3LD5A 4XSLA 3GNDA 4CCDA 3S6TA 3MJMA 2E5BA 4MFDA 1EFZA 1CB2A 1E55A 4XAYA 3KWXA 4MKVA 4Y96A 4Q4MA 3GC5A 5A6BA 4P5UA 2ZXQA 4WDUA 1IT0A 1XRVA 4M80A 3HPSA 4F8XA 1XV8A 1ZLPA 4C7GA 1VFSA 4G8TA 3E3HA 3SGGA 3FK4A 4WLCA 3N1AA 1A5CA 3F2CA 4EANA 1W56A 3AAMA 1A3XA 1W17A 3WLSA 3M5ZA 4A8LA 4F0SA 3MHGA 3FHAA 1OX4A 4KWOA 4K68A 3VX0A 3MDWA 5AHNA 4S39A 1CGWA 2J47A 1GORA 2B0MA 2W6RA 1I2OA 3MUAA 4AD1A 2P5NA 1GEHA 1EYEA 3W83A 4UTKA 3KW3A 1ME7A 4YVPA 2WWDA 1NJJA 2WMHA 1TPUA 4B3LA 3F4DA 3BQ5A 4FB7A 3C86A 1CW2A 3OGRA 4KWWA 3WFAA 1AH4A 1VBUA 4JTEA 4S3KA 3WJYA 4XKYB 3CMGA 3S9ZA 4D6DA 2Q8ZA 4LC8A 4HHHA 4F48A 3WMSA 4ACYA 3OZMA 1OABA 3VUSA 4JEQA 2BXVA 2QMKA 1FWEC 1E70M 3CYVA 3G6LA 3M43A 3KFTA 4GUHA 3GSMA 5HK4A 2PTZA 2WBKA 2G4JA 3N6HA 3G1HA 4GJIA 4UB9A 1ZSXA 1ALDA 4JL1A 2W5FA 4XO6A 1IEIA 2YL6A 1YEYA 2WKGA 2ZQ0A 4C6BA 3REQB 4AB4A 1G69A 1RJQA 3M5YA 2ZVRA 3ATZA 3AYSA 4UMAA 1TWZA 4QP0A 1SMDA 5EFDA 2X05A 3C2EA 1M41A 1XLIA 3FJNA 2A85A 1W1ZA 2OT0A 1LQ2A 3LTPA 3PTQA 3CUJA 1VFOA 2R1PA 3EOOA 4IJBA 3LU2A 1Q4WA 4LNYA 5D03A 3VYLA 4UQCA 3WLQA 3O8AA 3V0SA 3ZXWA 1JCTA 1E6ZA 1PZ2A 3ITTA 3CAVA 2CLHA 3CASA 3E02A 1B31A 1R9ZA 3OZOA 2J4GA 4O16A 1RALA 3VFLA 1R87A 1WAUA 2Q09A 3QVQA 2ISWA 1HJQA 4WVXA 4MPKA 1IF2A 2EG6A 5K4ZA 5E5CA 5A5WA 1FP9A 1V03A 5ABGA 1ADSA 5E09A 1J93A 2ANUA 2ZXBA 4F2UA 1OF6A 4GUGA 1YBQB 1XYLA 3VI2A 4JIQA 2ZRXA 2FGZA 1JRCA 2ZE3A 3O63A 3KOFA 5AN7A 5HNUA 4DX3A 5T9CE 4JYEA 3ITOA 1VZWA 1BKSA 1KM4A 2VZTA 4REQB 4M7SA 1ZJIA 1NFGA 3SM0A 5ABTA 4W7UA 5HBFA 1D3GA 2R1LA 1OWQA 1RA0A 4OBTA 3ATYA 5TNVA 1E73M 3GFYA 2CLPA 4H9XA 5LHFA 1XLBA 4L6DA 3TC7A 3RNDA 1QO2A 1MUWA 4L1WA 2GGEA 1LT8A 3M4HA 4GBUA 4J4KA 4EE9A 3GX9A 3W7EA 4W5UA 2OTDA 3KCJA 4PUEA 3DHPA 2C7FA 3GW0A 3NPVA 2FHCA 9XIAA 4HCHA 2Z2BA 3VDGA 1M04A 2H3BA 5I06A 1UROA 3GUWA 5FKYA 1XICA 4K36A 4LVDA 1MYRA 4BK9A 3W7OA 1GJPA 3L2MA 4F3HA 3B8IA 2CZ5A 3W7DA 2ZZ2A 1CGVA 2VD9A 3DU0A 4FX8A 4IT1A 1WZKA 1C9WA 1UWRA 1W9VA 5BU6A 2E67A 2VT0A 3LCLA 3HF3A 4ATDA 4RV3A 3RILA 3PG8A 3CQJA 3WFLA 1EJSC 4E8GA 1PIFA 4V15A 3AFBA 5DMLA 3L4TA 1WDDA 1UD8A 4J1OA 4JFUA 4DAIA 1UD2A 2J77A 3TNOA 2FMOA 3N9KA 2E4TA 1WB0A 1R0MA 5LNWA 1PTGA 3TN4A 3CIXA 2ZX8A 2OEMA 2Z24A 4FZIA 5IM51 4KMQA 3CEPA 4A6GA 2GZXA 3ANVA 1JAKA 1MRAA 4QX4A 4FOUA 3UZWA 3V4BA 2C1GA 1VQTA 3FKKA 5BNKA 3HQOA 1NOWA 2FTPA 3E74A 2GWGA 5CPTA 1B3YA 3MCMA 4Z1AA 1PIGA 3BE7A 3W07A 4BKNA 5HAOA 7TIMA 1IQ8A 3WY1A 4J3XA 3P82A 1CXFA 4RPPA 2Z1SA 3F2DA 3CYJA 3LCIA 3N9RA 3M41A 3LGDA 4XD4A 1JNDA 2VQUA 2PWFA 3FX4A 4GQBA 2ZUWA 1UA3A 3DN5A 3R0KA 1O94A 3T7VA 1EZWA 1O7AA 3TONA 5CPLA 2QR6A 3MSRA 1KBLA 6CGTA 3MT1A 1Y5VA 3FVMA 2W91A 4QBXA 2E9LA 4M82A 4Y9AA 3VD7A 2X0YA 1NWRA 5CCZA 3SN4A 1N8FA 1RD6A 2P76A 1H41A 3TSMA 3ALGA 4ZOBA 4DF0A 3RR4A 5CPQA 2HBVA 1UPPA 1J4EA 4KT2A 4J28A 1EQPA 4XAPA 3EKLA 3UQNA 2X1RA 2VI0A 3CWHA 1KM0A 3W22A 3EDFA 4WJ8A 4C6CA 1JQXA 3LCWA 3WQEA 4IPLA 1VFLA 3HMJG 2C3ZA 1G7UA 4Q4KA 2OWCA 4AY7A 3GTNA 4PMUA 3PZQA 1L2UA 1JYXA 5LA2A 3PB2A 1UH3A 2J8TA 4MF4A 4QS6A 3VDCA 3FA3A 1I2PA 3WQDA 3MO7A 2J7GA 3Q2DA 1T0OA 2FIQA 3LZ3A 4NT0A 1WA3A 3GD6A 5AC5A 4JIPA 1V0KA 1WDWA 1MWOA 4Q4OA 4I5XA 3NA8A 5G2IA 3GH7A 1G0CA 3KP0A 1HTIA 4Q4QA 4UFLA 2HISA 4IJCA 4NI8A 3S5YA 2O7SA 3UR2A 1J6PA 4RW5A 2HS8A 2XISA 3PZUA 1QW8A 3U5UA 3BICA 4LUTA 1S39A 1J8VA 2WPGA 1WKDA 4G1KA 4Q8TA 1UKTA 4H00A 5A6SA 5DMMA 3WQFA 4LFYA 4PMYA 2YX0A 3BLKA 4Z2IA 3TYBA 1LOQA 4E0CA 4GYPA 1BPLB 3LS9A 1IYXA 5CH9A 1O5QA 2PUZA 3QGVA 2JQXA 2DSUA 3VM7A 3PR2A 3WUBA 1C8QA 3GHSA 1B3VA 4YYCA 4F0HA 2OQLA 1EJXC 3MMDA 3LHVA 1CENA 3EEZA 3HPAA 4NHVA 2O56A 1GZ1A 4A8RA 1CDGA 1B4KA 1RQEA 4ADUA 1EHNA 1UKSA 4Y8EA 2OU4A 3CB3A 3R12A 4H41A 1MI3A 4UOQA 1NIUA 1SM9A 2XTKA 1FWNA 4LVGA 1FWSA 1XCWA 1NWSA 3GDLA 3HURA 4LCRA 5HWMA 1XLCA 4NZ5A 4CU6A 3OQEA 3QHNA 2ZA1A 4NJGA 4JKMA 3PF3A 3MP3A 2WNNA 4UTWC 2CKSA 1XCXA 4C6QA 1ITCA 3B8WA 5M5DA 4Z2HA 2BS9A 2YW3A 2P10A 2WKJA 3CUZA 6PTDA 4M19A 3AHXA 4M29A 3FIGA 2OKTA 3KBMA 3BJSA 3V3WA 3VFCA 2AMXA 2VQTA 3LRLA 1B0IA 3WJXA 3G0UA 3S1UA 2W63A 2DH2A 4HMEA 4E8DA 3PWIA 1J11A 2F6UA 5LIXX 3MPGA 4GZJA 3RG6A 4S2CA 3SFWA 3O6YX 1ADOA 4J2MA 5CLWA 3P6LA 4WR3A 3PNUA 1VYPX 3LLDA 2BY0A 3TYUA 3T44A 3B05A 2NQ5A 1LWHA 3SCVA 1E43A 2Q71A 4MZ1A 1J9YA 2WC7A 4KRUA 2D1ZA 5MF5A 1GG0A 1GOMA 3I6TA 4I7UA 1PWLA 5T91A 4M56A 2OSXA 1CX9A 4GQQA 4ROQA 4U5IA 1XBXA 2I9EA 3C8FA 3G3DA 4IFRA 4L7ZA 2CPUA 2QJIA 4UFJA 1T6MA 2Z00A 3WUFA 5KTLA 1K8XA 1OGSA 4MG4A 3RLHA 1ITXA 1JEZA 3S2MA 2FH8A 1EIXA 4ZQMA 1RVGA 4H6RA 1RBAA 5EMJA 4US5D 3EA1A 2AAMA 1LBFA 3T2OA 3W87A 1JZ6A 1FXPA 4WGXA 2WHLA 2XN1A 2J7EA 2J24A 3GG7A 5HMFA 1BQGA 2FB2A 3EMZA 4QLLA 4GVGA 2OVLA 1ZBWA 4UTIA 1E3ZA 2VD8A 2VX5A 4DJFC 5CZJA 2JEQA 1RJRA 5LYRA 1VLWA 3EWDA 1RLDA 3VO0A 5A6KA 2DDXA 5A6MA 4FIRA 3LXCA 5CPOA 4AZGA 4FXRA 3RDKA 2W4XA 3UR5A 5DXYA 3HG2A 1R85A 1LQAA 3R8HA 2PGRA 3BK0A 2GDUA 4DWDA 3CUFA 1I1XA 2QPXA 4J5NA 1F2JA 3IARA 2FPYA 2HMCA 1DTNA 5IBXA 3OA5A 2F2HA 3GAYA 1TV2A 4M81A 4ZFMA 2PRMA 1H49A 4CNSA 1NOFA 4EVZA 3M44A 4AC1X 1SSDA 2VYOA 1BLIA 4DRSA 4IIBA 4L1XA 3SW6A 3O6AA 4NF7A 5HQLA 4S3BA 4AVOA 3W2UA 4LEFA 2UWFA 2BY2A 3TA6A 1XP3A 2OLHA 4GGHA 1HNYA 2EF9A 1XHGA 1ISVA 1C8YA 1WO2A 4HIBA 3NIYA 1Q6FA 1QPOA 5LGXA 4LEQA 4DUOA 5I7GA 4YN5A 2XIJA 1AL8A 4MDOA 2ZUMA 3NXFA 2YSWA 3NDYA 1Q7ZA 5C9ZA 3SCSA 5E9XA 3Q65A 1AFSA 2IXVA 3GC4A 3VNDA 3LUTA 4OJYA 4Q32A 5B7YA 3ZT6A 3NFUA 3HJEA 1SSGA 2HWGA 4IXHA 2A79A 2OX1A