3B3DA

B.subtilis ytbe
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
280
structure length
280
Chain Sequence
MTTHLQAKATLHNGVEMPWFGLGVFQVEEGSELVNAVKTAIVHGYRSIDTAAIYGNEAGVGEGIREGIEEAGISREDLFITSKVWNADLGYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKEAWRALETLYKEGRIKAIGVSNFQIHHLEDLMTAAEIKPMINQVEFHPRLTQKELIRYCQNQGIQMEAWSPLMQGQLLDHPVLADIAQTYNKSVAQIILRWDLQHGIITIPKSTKEHRIKENASVFDFELTQDDMNRIDALNENLRVGPDPDNFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative morphine dehydrogenase
publication title Structural and biochemical analyses of YvgN and YtbE from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 100
structure length 280
sequence length 280
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3b3dA00
1T40A 4XO6A 3LQGA 4XVEA 4XZMX 4DBSA 3EB3A 3UZZA 4YS1A 3UFYA 3LEPA 1S2CA 4WRHA 3EAUA 3R7MA 2FZ9A 1ZSXA 1ADSA 4QX4A 5LIKX 3H7UA 1IEIA 2HVNA 2PDXA 2PD5A 3H4GA 1S2AA 2HV5A 1RALA 1AH3A 1Z89A 4L1WA 3UG8A 3O3RA 2IQDA 1QWKA 2PDMA 4IGSA 4YVVA 4JTAA 3O0KA 1GVEA 3Q67A 4WDWA 3C3UA 2PD9A 1Q5MA 4LB4A 1YNPA 2HEJA 2HDJA 1AFSA 5LIWX 2ACSA 3Q65A 3V36A 3BV7A 1ZUAX 4I5XA 3U2CA 1EXBA 4JQ1A 3GUGA 2PDBA 1J96A 1PZ0A 3MC5A 3KRBA 4Q7BA 3V0UA 4FALA 1Q13A 3F7JA 1JEZA 3GHUA 5KETA 1EL3A 1X96A 4LBSA 3LNMA 1X97A 2FVLA 3V0SA 3UZWA 4AUBA 4LBRA 3WBXA 3LUTA 4DBWA 2ALRA 1MRQA 3WG6A 5LIXX 3CAQA 1ZGDA 4GA8A 2IS7A 3R6IA 4JTRA 3WBWA 4ICCX 2ACQA 2FZDA 4MHBA 4EXAA 2FZ8A 1XF0A 2ISFA 1AH0A 5JH2A 4LAZA 3LENA 1K8CA 3ONBA 4IJRA 3UP8A 3CV7A 1VP5A 2WZTA 5AZ0A 4GACA 4WEVX 4H8NA 2J8TA 1ZQ5A 4H7CA 2C91A 3LN3A 4JIHA 4HMNA 3G5EA 2R9RA 3G1RA 1EF3A 2IKJA 3N6QA 3CAVA 4JIIX 5AZ1A 1XJBA 4XZNX 3BURA 3V35A 1HQTA 3M4HA 1R38A 4RPQA 3RX4A 1S1PA 3BUVA 1YE4A 3H7RA 4XZHA 2DV0A 5HNUA 2F38A 2PDQA 1OG6A 3LD5A 3N2TA 2P5NA 1PWLA 3VXGA 1US0A 2PDJA 4GQ0A 1S1RA 1FRBA 2IPFA 3M64A 4EXBA 1PYFA 1RY8A 4QBXA 2PDUA 5LIYX 2INZA 3BCJA 2BGQA 4WDUA 3MB9A 1C9WA 3UWEA 3GHTA 2NVDA 1AZ2A 1EKOA 4PRTA 3ONCA 4JQ3A 3R43A 2DUZA 4IJCA 3ERPA 4LB3A 4JTQA 3RX3A 2ACRA 3LQLA 1SM9A 2FGBA 3UZYA 2PEVA 4GABA 3UGRA 2PDIA 4Q3MA 3GHRA 3LZ5A 3LZ3A 4PUUA 3QKZA 5LIUX 4GQGA 3FJNA 4JQAA 1Z9AA 2INEA 3UZXA 4ASTA 1A80A 3R58A 2PF8A 2I17A 1MZRA 1Z3NA 1LWIA 4DZ5A 2PDFA 2PDGA 2IPGA 1LQAA 4JQ4A 2PDCA 3DOPA 1RY0A 2PDYA 4NKCA 2PFHA 4XZIA 1AZ1A 1Z8AA 2HE8A 2PDWA 2PDNA 1IHIA 4JIRA 4FA3A 4GCAA 4L1XA 3M0IA 5JH1A 3CASA 3R94A 2BGSA 2PDKA 3DN5A 3GHSA 1PWMA 2HVOA 2CLPA 2HE5A 3R8HA 2R24A 1T41A 5M2FX 4YVPA 3D3FA 2PZNA 1YNQA 4PUWA 1UR3M 3CV6A 4ZFCA 2VDGA 2DUXA 3FX4A 3R8GA 3COTA 1X98A 4JTCA 1PZ1A 2PDLA 2ACUA 2PDHA 1HW6A 4JQ2A 4FZIA 1YE6A 2F2KA 1VBJA 5C7HA 4PRRA 3EB4A 2NVCA 1MI3A 1QRQA 4R9OA 4LAUA 4G5DA 4YVXA 4PMJA 4FAMA 2I16A 2IKGA 5HA7A 2AGTA 4QXIA 2WZMA 1M9HA 4WDTA 4PR4A 4WGHA 4XZLX 2PDPA 4XO7A 4YU1A 2QXWA 1XGDA 3WBYA 3B3DA 4XVDA 2IKIA 4HBKA 3NTYA 3P2VA 3RX2A 4QR6A 4JTDA 3S3GA 2A79A 3CMFA 4DBUA 4OTKA 4WDXA 2IPJA 5DANA 5HNTA 4F40A 3LBOA 3WCZA 4GIEA 2BP1A 3T42A 2IPWA 3V0TA 2IKHA 3UYIA 2FZBA 2IQ0A 4XK2A 4XAPA 1AH4A
chains in the Genus database with same CATH superfamily
4RDVA 3QR1A 2Y85A 3VMOA 4FLSA 1DHPA 3K4WA 2GGEA 4HYVA 4RLIA 2PWDA 2QCDB 4O0KA 4WF7A 1FCQA 1WDRA 4AZHA 1TFVA 3N2CA 4Z2KA 4M82A 3BLIA 4W8LA 2DT0A 1KCLA 4IQLA 3NQGA 3AIVA 4MUZA 2VRQA 2HXUA 1I0DA 3SCQA 4IMGA 5E1QA 3UG8A 4TU1A 3FS2A 5CPLA 4C7GA 2Z0IA 5G4HC 3T4WA 2VJXA 3VIHA 3B8SA 3EOEA 3O0KA 1DWIM 2Y1HA 4WY0F 5FESA 1J5TA 3IK4A 1CB7B 1H2JA 2TPSA 3BZJA 3LCHA 1HO1A 1EC8A 1KBLA 1EWEA 1HJVA 3AS0A 5JMUA 3RNDA 4XWUA 3U8GA 4Z0JA 3KCOA 2P88A 4GWEA 3A22A 3QV9A 4YTTA 5FJOA 3KX6A 1D8CA 3PULA 2BLEA 3W83A 4XBKA 1UPPA 2YOCA 3VNMA 1D9EA 1NQ6A 2CXEA 3KM8A 5H91A 5I23A 3T8LA 4UTJA 1S2VA 1FDJA 2E3ZA 3WDIA 1PL9A 2XDFA 3S1XA 3QH2A 2A5HA 2VOTA 4IICA 1JDAA 2HJPA 4DELA 4CVUA 2E1WA 3B0UX 4ICCX 1XKJA 1ICSA 4MHBA 3VCNA 1NTHA 3GR4A 3CHDA 2CHNA 1RCXB 3II1A 3SJ3A 3MTWA 4FXSA 3SY5A 4DWDA 2PGRA 2QQ6A 1FHDA 3LERA 4GACA 4H8NA 2OODA 4IX2A 3VIPA 1TZ9A 2GJPA 2J8TA 3PUDA 4WKAA 2GDUA 4ZFMA 4WD0A 1DWFM 3WJZA 3H2CA 4MADA 2WVVA 3QY7A 2PTZA 4I7UA 3G1RA 4LY8A 4JHZA 1YXCA 1CGYA 3O63A 2RH9A 2BOFX 1AQ0A 1XQKA 1W9VA 1XJBA 2XZ7A 1FWTA 5HJYA 4NU7A 3W2KA 2G3MA 3TJIA 3KRZA 3CIXA 4UNIA 1TV7A 3M4HA 1K9FA 3O06A 3ZYZA 1WUFA 2EJAA 3MUZ1 4XUYA 2XGIA 4MGGA 1YDYA 3KS5A 4US6A 2XVLA 1RCOB 2Y2WA 2OXNA 3ORWA 3OVPA 5HWNA 3N2XA 1NFBA 1EA9C 1OYCA 2PDJA 3UU0A 1W8GA 3VMPA 4R7WA 3TJLA 1XW8A 4AX7A 2Q8LA 2P0OA 4NZ1A 3HTWA 1B4KA 4MYAA 2PA6A 1YMYA 3SEPA 6TAAA 3V1PA 3U7VA 3HQPA 3MP4A 1SR0A 4GKLA 3L2MA 3F4WA 3WYZA 4ACZB 4JEQA 3KOXA 3S9IA 4GUJA 1EJRC 4KMQA 4JTQA 4UWMA 1Q65A 3UJSA 4AC7C 3AQUA 2I14A 4LC8A 3W2NA 4HK6A 3QLLA 4PCNA 2GDQA 5FJUA 2NSXA 4AIUA 1H7PA 4A2SA 4CD6A 4ML9A 1QOPA 3WNMA 3MANA 3RFAA 1UD8A 5DMMA 1BEUA 2J9ZA 4ZO6A 2INEA 3AHXA 1BD0A 3VDBA 4JTSA 2D2JA 1OSEA 3H2OA 4Q8MA 4WY0B 3DECA 1L2QA 3LMZA 2BWGA 2PTDA 3SRKA 1AODA 3DZ1A 4NKCA 2PFHA 2A1YA 5JU6A 4P7LA 1U1JA 4MB5A 1YW1A 3W7DA 1K6AA 2QUTA 3NQ2A 3PZTA 2XJ7A 1W5QA 1JDEA 1PE1A 4JIRA 2VZVA 4FA3A 4GX9A 3DYOA 1E56A 3CASA 4A2RA 3I3BA 3H70A 1RUSA 5TD4A 3LHYA 1DJXA 5CSSA 1FWAC 3QW4B 4LAKA 3SCOA 2Z4GA 4HVXA 4WIWA 1V3IA 3PZIA 3ITOA 1UR2A 1Y5XA 3UW6A 2X1RA 4O17A 4GE8A 7REQA 3HMCA 4AQLA 1CIUA 1ZBVA 3M1ZA 3CWNA 3AALA 3D6NA 2CETA 4NRSA 1FWHC 3RLHA 4OV4A 2Y62A 4S3EA 3ARVA 4EAMA 1NWUA 4BI6A 4F66A 3SRHA 5I06A 4C6KA 3W9ZA 3ABSA 4UMBA 4J4KA 2BY1A 2GSHA 2JKAA 2WC7A 4I3GA 1XLBA 3GQYA 3HFYA 2V69A 3DBNA 3BK0A 1WPCA 4XO7A 1VJIA 4HOXA 3GNRA 2PRLA 4R7OA 3RCMA 1H1YA 1MNZA 3TQ0A 7ODCA 1UQYA 4LAOA 3ARYA 1S3HA 4YTUA 4JHOA 1TE6A 5HATA 3RDKA 4O16A 3S3GA 4GQBA 5LNRA 1GT8A 3ITYA 3U4FA 3UXAA 2JIEA 4K68A 5CZTA 3G6MA 2QJMA 3WQCA 1ECQA 4NX5A 3NL2A 1XC6A 2H3BA 1M7JA 2XH7A 4LUSA 4EP8C 4REQA 2J78A 3S6DA 1EOKA 4JICA 3HJEA 1JPDX 3SW6A 5DXXA 4B2DA 1A3XA 1KFLA 3HZ3A 1MO0A 1XBVA 4KS0A 5HQEA 4XVEA 3TU9A 1FTXA 3EB3A 4U28A 2R1MA 4Z1CA 5A6SA 1XDJA 6A3HA 2Q02A 5G2IA 3L67A 4F9DA 3FEQA 4IP7A 1DIOA 1MVYA 1POKA 1NY1A 2PU0A 4FHAA 4BF5A 4LUTB 1PX8A 1IXQA 4EPDC 1KLYA 1XSKA 3SQSA 1OC5A 4UXDA 5AYIA 3H4GA 5DN1A 1RALA 4C60A 2D22A 1ADDA 5IBXC 4H6QA 4TV6A 4M8UA 4PN2A 1EJWC 3TWAA 3AIQA 1XP3A 8XIMA 3B04A 3OO2A 2WMIB 1TKKA 3ELFA 1E15A 3C3UA 3GRIA 1W1YA 2X0SA 3BSGA 4N6EA 4CNTA 1UH2A 5I02A 1EJSC 4RV3A 5J8LA 1TB3A 2J74A 4RZ5A 4P8XA 4NX0A 3SY8A 4KT2A 3HV9A 4H1ZA 3QGVA 1DIEA 1QW9A 3GSMA 1EL3A 4S23A 4AUBA 2QW5A 3IIXA 1JAEA 2PWVA 1A5AA 2GL5A 3HPXA 5FOOA 3LHVA 4B3ZA 3ES8A 3QPYA 3MMWA 4G7EA 4C6LA 6REQA 3QTGA 2YFOA 4O1FA 2FZNA 4G8TA 1OYAA 2MUCA 3QKEA 3GXMA 2ACQA 1BYBA 4DWSB 4S3AA 3UT0A 2V5CA 1UD4A 5G1MA 3VIOA 1T96A 1E9LA 3UXKA 2P50A 1JFHA 4MKSA 2GPTA 1CNVA 2WZTA 4TX9A 1RR2A 5JBFA 4KPLA 3UR8A 2OWXA 2CBVA 1US2A 3UY7A 4DJDD 2FIQA 2ZRXA 3QYSA 3ZJKA 3LN3A 1EXPA 5GVJA 2XTKA 5CJNA 2WMJA 1V77A 3LPGA 3WJXA 1OD8A 1GTHA 1HJSA 2QPUA 3LLXA 3V18A 3CHVA 3T2OA 1SZEA 1TIMA 4ONVA 5AZ1A 4MMWA 4KFPA 3ITVA 4Y96A 1JUEA 3D0CA 3EDFA 2PLMA 5DEZA 4LV4A 3O6DA 1E1CA 4MNKA 1MUWA 3STPA 3GYEA 2AGKA 3W7PA 4XZHA 4Q4SA 2YDQA 5K9DA 1KO0A 2O7SA 4JIEA 3VOJA 4TXEA 3LD5A 1RP8A 3TQPA 3M47A 1DHKA 3GVWA 4UNKA 4LC6A 3QEZA 4DF1A 1KFCA 4IQEA 1MSSA 1TPB1 2EPMX 3UNTA 6XIAA 4AMCA 4UFIA 4XSLA 1RBOB 3UG4A 3B06A 3W6YA 4IJBA 3UWEA 1Q7QA 1G4TA 1NOWA 2J88A 1W32A 1Q85A 1RLDA 1V3MA 4JL2A 3NXFA 2BVTA 5HUOA 3PZNA 3EMQA 3OP2A 3TAKA 4PTMA 1LWJA 2NWSA 2VR2A 5HK4A 2PBGA 4X60A 4JFSA 5IFTA 2OLAA 5IBXA 3WLNA 1A4LA 3RYSA 2WJDA 3QQWA 1FHLA 4DO4A 3CYVA 3IVSA 3NIYA 3O0FA 3EWZA 4IT1A 1KKOA 2I17A 3ABQA 2D24A 1LWIA 4DZ5A 2CESA 2P76A 1TE1A 4AZ6A 2XWDA 1Z42A 1JCMP 4JQ4A 4UQ9A 3VCCA 2VDIA 2ZADA 3NZ1A 2WC3A 5I2UA 1K7FA 2EG7A 1GHRA 1R5YA 3GVVA 2JKPA 4QJ3B 3N9RA 4URIA 1K8YA 1DXEA 4XQ6A 3QC3A 2Z29A 4S3FA 4M6VA 4ZQMA 3H54A 5JUVA 3AUOA 2RDWA 4Q8VA 3JRKA 3SGGA 3TW9A 1VFTA 4MJZA 1VCFA 4Q6XA 4X2RA 5M3WA 3CMGA 3UYCA 3ZOAA 4AX6A 3DH7A 2ZUWA 2Y7FA 3FDKA 3PWGA 4CD8A 4LS0A 4I9AA 3NQMA 1E73M 3USZA 4AD3A 3FW6A 1TUFA 1VFFA 1NF0A 3EMCA 3SIZA 1NDYA 1REQA 4O52A 3BSMA 1OFRA 1HP4A 1EC7A 4E38A 3FYYA 5M5DA 4G5DA 4AD0A 3W82A 2TMDA 2WZMA 1HKJA 4FX6M 4XZLX 4N6FA 2OEMA 3GIYA 2GUUA 3G1VA 5DY2A 3V5CA 3IJ8A 4CKQA 4PUJA 2GUBA 5MF5A 5A6BA 1UPMB 4DEFA 1GPFA 2J4GA 1XLHA 1VBRA 4IL2A 3KDNA 4Y6GA 2RUSA 2FTYA 3TV8A 3IJIA 3VM7A 5I7GA 4B5UA 3AWNA 4HSOA 2OZTA 2XG9A 1LG2A 2AL1A 4RV8A 1MW2A 1BLIA 1R85A 4UQBA 1MEHA 1W1A1 1A5SA 2RDXA 4ERIA 3RLVA 1EBHA 2I5QA 2WVTA 2A7RA 4GZ7A 3UPMA 4QQUA 5C5YA 4XISA 3M16A 4XO6A 2VEMA 3B05A 4ILSA 1VYSX 2AKMA 4JTGA 1W54A 5G4EA 3TW6A 1MUMA 3JVAA 2NWRA 4MB4A 3BICA 4L4PA 4UMCA 1RD5A 2QGYA 3QC0A 1R9YA 3PG8A 1S2CA 1XLGA 1RD6A 1SJBA 1OFDA 4DUXA 3W71A 1K6WA 1LOSA 2NXGA 4M5PA 4O8RA 4A29A 4RZ4A 3LV5A 3FK4A 1S3TC 1IEIA 3J7HA 1T5AA 1LYXA 1LBMA 3BCDA 3A4XA 3PPGA 4LW7A 3FYPA 4X0VA 3TNBA 3GTFA 3VFLA 5AN7A 4ZO7A 4PTVA 2IQDA 4MSSA 2DZXA 4YVVA 3M7WA 3S6OA 4DM2A 3K1GA 3Q67A 3PJTA 2CIPA 2ZQ0A 5CJMA 3M0KA 1ITXA 1R47A 3F5LA 4GYPC 3V36A 4X2PA 4B90A 2CNCA 3IS4A 3A6OA 3BV7A 3LI1A 3AISA 1KFJA 3OIHA 5CZSA 4S3CA 4N9EA 1XSIA 1IE7C 3MC5A 2O9RA 3KRBA 4RNFA 5SWUA 1HIZA 1XV8A 3LXCA 3R5EA 2F6KA 3P62A 3IACA 5FEXA 3B0PA 2V81A 1XDMA 3R10A 3G1SA 2WB5A 4CD7A 1F07A 1KRCC 1LQ2A 3N29A 4H6EA 1P4CA 3MV11 3WF0A 3HM7A 1C92A 5F2IA 3KRSA 1WAUA 1QI3A 3RJXA 1W31A 2D3LA 3BAKA 3WBWA 3PUGA 3F2DA 3PP7A 2ISFA 2F7FA 4RNJA 1YDOA 1CX9A 1V0LA 8A3HA 2YYUA 1W37A 4XD5A 1AVAA 1M03A 5AZ0A 2CCRA 4LAMA 5CSUA 3S1VA 3PBUA 1F7BA 2WM0A 2O9TA 5H2ZA 3DFNA 3TJXA 3PPHA 1MEIA 2Z6JA 4N0RA 3IV8A 3VNDA 2GQ8A 4OBSA 1C8YA 1Y65A 3PFRA 1GZJA 1F73A 3W1AA 3S9ZA 3GFYA 5FAJA 5M03A 1ZPTA 4PGLA 2BVDA 2UY4A 4RDWA 3BXWA 5C70A 1UYQA 4GO9A 3AJXA 4G1KA 4M1BA 4C6PA 4IMDA 2PLJA 1SO3A 3H12A 4RCXA 1LG1A 3FGCA 2QV5A 3A4JA 4QJ4B 3UA3A 1TELA 4WDUA 1P7TB 3QJAA 4PODA 3EDKA 2OEJA 2FVKA 1MXSA 4IX0A 2PPGA 3PVFA 2AOSA 2XIMA 3W70A 2YCIX 4GO8A 4XD6A 1Q63A 2CHRA 1JXJA 1E40A 4PB4A 2AAAA 4B5SA 1IXPA 1MUCA 4QAWA 2CKRA 2BZNA 2J6VA 4YHGA 1GQNA 4QE1A 4PBEA 4UCFA 4DF2A 2E9BA 4RW5A 2VO5A 3FXGA 1VJSA 5AYBA 4PUUA 4O1DA 1SSGA 3EDDA 4GVHA 1AUSL 4NY2A 2OSWA 3SFKA 1S2WA 4X9YA 1R7AA 5EMUA 3S6TA 3KFTA 4OUEA 3R4IA 7XIMA 1BVWA 3JW7A 1DQUA 3BL3A 3C0LA 1W3TA 2VC5A 3BW3A 2HPMA 1TZZA 1X1OA 4B2DD 5F2GA 4GYPA 5EYWA 5D04C 2PDFA 3DFHA 3LRKA 5IDIA 2PDCA 4ACYA 1OG0A 3IJ6A 3W37A 4AZCB 2WCGA 5I3GA 1OBAA 2WLYA 3MO4A 2PDNA 4AC1X 3CUZA 3RIKA 3T07A 2CLEA 3OGSA 1I8JA 4UQEA 4UC5A 3SCWA 4U4MA 1EGMA 1SQ7A 2PDKA 1QK2A 1OYBA 3CUXA 2GZXA 1JYXA 1JCXA 2WKGA 1QUMA 3C52A 4H3DA 5LXXA 3T9PA 4IPIA 4U3CA 2KX9A 1PZ1A 3WLQA 3ANYA 4FI4A 5KTLA 3I10A 1IEXA 3UQNA 3DKJA 2CXGA 5C7HA 4PRRA 3ATYA 4Y7EA 2I56A 4GRSA 2BXVA 3A47A 2HZGA 4JYFA 2J7DA 4B4FA 4ZXLA 2BY2A 1UIPA 2QJIA 3FCPA 4JFWA 4IFKB 4J27A 1GCYA 1L0PA 1VGAA 1GZGA 4JBRA 1TWWA 4EK7A 3ANUA 1ZL1A 4Y9MA 4UBPC 3WUGA 5CPNA 2EGZA 4E4UA 1JJKA 2C1HA 3OLEA 3ZT5A 5DBUA 3ZWTA 4YTRA 2QXWA 5KZ6A 3L65A 4DO7A 1FOBA 1GPWA 4PB3A 2VX6A 4JTHA 4IFRA 2Y63A 3M44A 2YBUA 4IIDA 3G0SA 4RZ6A 5DMNA 2YBTA 1E4NA 4NJJA 5CZKA 4W4QA 4GCXA 5E70A 3QR3A 3QW3A 1A4MA 3NOEA 4LSBA 5AOUA 2YA1A 3WCZA 2P3ZA 5FJPA 1EO7A 3V0TA 1R3TA 3P84A 2O9PA 2F9RA 1HZYA 2PP3A 1FWDC 4NZ3A 3CT2A 3MUCA 4R7JA 3QVQA 4L4LA 4FO4A 4XK2A 3D5HA 4BY3A 3VK5A 3P0XA 2IXUA 2VGGA 1OK6A 4B15A 3W81A 3N13A 3NL5A 3HB9A 1PDYA 3E3HA 3UJRA 3SCSA 2D73A 3PWIA 3W24A 1DV7A 4XZMX 2OELA 4XD3A 3RO6A 3MVIA 1ISVA 4O0QA 4GI4A 4PEKA 3B8IA 4NZFA 4Z2JA 5EMLA 1EQCA 3E2VA 3G2GA 2BHZA 4CUCA 1VBHA 3DYMA 1WBJA 3AYTA 1QATA 3HURA 3WQ6A 1BTCA 1GG0A 3EX2A 3F4DA 1QBBA 2VM8A 3AMGA 1NELA 3E49A 4TIMA 3W26A 3ZT7A 3AUJA 1QVBA 1UOZA 4QROA 4IGSA 3KWSA 3W1UA 3SSJA 3SI9A 2CC0A 4AXKA 4P61A 2ZUNA 4O1BA 1QBAA 3NPVA 4C7FA 4F79A 1EX5A 3SO7A 2PD9A 2OO0A 4F2UA 1WQ5A 1U5JA 1UJQA 3L4ZA 1LDCA 4X0NA 2VRJA 1UA7A 2Y88A 1E1EA 4JQ1A 1FCBA 2PGFA 5A6AA 1SZFA 1UC4A 3W1LA 3VNLA 2NQLA 1VCVA 3S2JA 3M0HA 1JCLA 4Q7BA 4FALA 4UTIA 1OD0A 1Q13A 2G3NA 2ESCA 3KCJA 3ATZA 1Z44A 4W7UA 4C6BA 1SZNA 2YW4A 4KWVA 1W2PA 3TC3A 1M6JA 3ZLGA 1KRAC 4XTIA 4GA8A 3UR5A 3GFXA 2O56A 4MVAA 1TVLA 3R6IA 2FPVA 3WLTA 3VYLA 2HISA 1WKDA 4P8VA 1C9DA 4LAZA 1X8FA 2QCFA 2GWNA 4QTGA 2Q71A 1DJWA 1CW2A 3P5ZA 1HP5A 2QT3A 2AKZA 1JF5A 5F2LA 3GDMA 3UD6A 1GOXA 3SY1A 4IPJA 3UVIA 2FTPA 4GPNA 2VWSA 3GKAA 4PYSA 4HMNA 3LBMA 3U2OA 3UR7A 3WL0A 1POJA 3WELA 3PG9A 5FSDC 2XSAA 3N34A 3DGBA 1Y7VA 5TBOA 3BLFA 4IG2A 3CUIA 3OYXA 4FXJA 1R9XA 5AHNA 1ADOA 3WH9A 1W3JA 3WD3A 2QCGA 5IM51 3URAA 1EYWA 3TN5A 3GW3A 5C0QA 4MKNA 5A8QA 3K13A 2PDQA 3KL3A 3T2QA 2CERA 1JZ8A 3R0KA 3N2TA 2HXTA 3I68A 1XIFA 3LCLA 2Z00A 2VGBA 3GZAA 3SRDA 2CZDA 3URQA 1RY8A 5A8PA 5C9RA 3W7HA 4ZB0A 3OQEA 4PCFA 3GU1A 1C9WA 1JDFA 3B4YA 1FH9A 3MI3A 3BZGA 1W3KA 4H9ZA 3FLUA 4F9JA 3HJZA 4W85A 3K8KA 4V27A 3RX3A 1P1XA 2ZA3A 4TUFA 3W23A 4GABA 1AD4A 4DPPA 4Q22A 2WMKA 4QE5A 3I6TA 4WKFA 1MWOA 1KM0A 1UA3A 3VUSA 5CGMA 3SDOA 1CTNA 4AY7A 5REQB 2R94A 1ZTVA 1YXYA 3VO0A 3IAQA 3QRHA 1BG4A 3ZFHA 1D7KA 3BMWA 2JIWA 4PMYA 2IPGA 2Z1KA 5D05A 1XXXA 3NM1A 4ML4A 5EB8A 3ME3A 1UR1A 3VM5A 2YZRA 3EWWA 5D2WA 5I00A 3OOQA 3AAMA 3C8FA 1A0DA 5HMDA 5A6KA 4IPPA 4HYWA 2Z26A 1W0MA 5LYRA 3BAXA 2YL6A 4GY0A 1KKRA 5JH1A 1C90A 5CC7A 3QR0A 3G1DA 3MSRA 3P6LA 1JZ3A 3IJLA 4LXFA 4J28A 5HDRA 3CPUA 3OZOA 3GIPA 4A8NA 1ME8A 2BFGA 4HPJA 2V2DA 2QR6A 2QGHA 3WFZA 2VDHA 2PDLA 4O13A 5I3DA 3CJPA 1Q6CA 1JL8A 1SW0A 2Y61A 2B7NA 3GXPA 3IIZA 2DH3A 1FA2A 5GNZA 1QTWA 4S1FA 1MXDA 2CZFA 4AVFA 4UZSA 5K9CA 2UV8G 2PTYA 3KVLA 1SUXA 2ZX8A 4PSPA 1PHQA 2V5JA 4PBFA 4HNNA 3GDTA 3SZ8A 5EMKA 4BQ2A 4QXIA 1QOQA 4MNLA 1DXFA 3QZAA 3HG3A 4PMQA 5I78A 5AHMA 1BRLA 3EWUA 3RLGA 1DP0A 1R3SA 4IFOA 4HPHA 1YDNA 2OYLA 1JYWA 1OWQA 1TPH1 4AW7A 1UB3A 1G4EA 1IXNA 3BG3A 4R53A 4ZO9A 1NQKA 4QR6A 4A8IA 5DELA 4K36A 1B3YA 4D6FA 3TN3A 1RQEA 2Q3OA 3BW4A 2QIIA 4PB5A 2D2OA 2Y5SA 4IIHA 4WSKA 3NFUA 1WBHA 2ADAA 2ABAA 1OFAA 2WCAA 4ZQNA 2A3EA 5K4XA 2VNCA 3INPA 1TQJA 3OVQA 3GYCA 1JVNA 1RVKA 1RJRA 4JNZA 1VZWA 2BOEX 2WBKA 3PAJA 1A5UA 5L6UA 4W86A 5HMSA 3K8MA 4J2PA 3WJWA 5AYZA 1WNOA 3GU9A 1XD1A 4YS1A 1BTMA 4Q8TA 2WVVB 1GQKA 4UOZA 2J6XA 3LEPA 1EIBA 3MKKA 3L5AA 4QGCA 4Q4PA 4LS2A 1EP3A 4K38A 2FZ9A 3EOSA 3F5JA 4FF5A 2BY3A 2X09A 1W5OA 3W88A 2DT1A 1E6ZA 1UP2A 1S2AA 3BLLA 2HV5A 1XBXA 1HKKA 4AZ5A 1DJGA 2VZSA 3R13A 4KQNA 5DXYA 3WF2A 2POTA 1FHUA 4IIBA 2FQIA 3IVTA 1QO2A 4W7WA 3VKAA 3W1TA 4CN1A 3WK2A 5E0CA 5GNYA 3CUHA 1OFPA 3L5LA 3IPWA 4FNPA 3WQOA 3RU6A 3A13A 2X8RA 3BAJA 3CS2A 3TMLA 4BZYA 3A9IA 1PHWA 3DC8A 1KCXA 1J0IA 3UJ2A 2ZWYA 3CM4A 1AL8A 4HN8A 3ARQA 3NNTA 1MRQA 4E2OA 2OR2A 3LSCA 1FCUA 2E68A 3TWBA 3MUIA 1RQBA 4UIOA 3WENA 1GEHA 3EX1A 4XX6A 3VGHA 1DWGM 4L64A 3MMDA 1TTIA 3BGJA 3R12A 1XPYA 3VGDA 1UWUA 2I7GA 1JAKA 2CKSA 2AMGA 4EXAA 3E74A 3TCSA 3UR2A 4JFVA 4RK8A 1RBAA 1N8FA 3N15A 3IUHA 4LTSA 1IIHA 4UFKA 3FKRA 2HCVA 2E8YA 1H0IA 3G24A 4OKDA 2YX0A 4FF7A 3MPGA 3DG3A 1NDZA 2E28A 1R30A 3WY1A 3IIVA 1EJUC 1WZAA 3USBA 2A3HA 3CV1A 2C91A 2CLFA 5D2XA 2HBXA 1XIMA 3BQ5A 4UTFA 1O68A 2WOQA 3FA4A 5XINA 3KVMA 3CAVA 4UOJA 4M0XA 3ENLA 4KWWA 4JPGA 3C2YA 3A5FA 1VFLA 1R38A 3RX4A 3RU8X 4AD1A 4EXQA 5AC8A 4J3TA 3KRUA 4TV5A 3P93A 4EF9A 3CXOA 4OE7A 2WCSA 3VDAA 1DPMA 2F38A 5IOBA 3U4AA 2EEXA 1HO4A 1YTEA 1NWSA 4ZTXA 1HVQA 4LUYA 4LY4A 2OCZA 3JZUA 3MVTA 4QEEA 4JTKA 4IGHA 4TTGA 1XLJA 2CZVA 1WE5A 3TVAA 4H9XA 3KXQA 3GNNA 1FDZA 3UA4A 2GJLA 2FFIA 1BYDA 5LHEA 1F3XA 2E6FA 3WF1A 5HPCA 3AHZA 1W1PA 3FA5A 3S5ZA 4HPNA 3CIVA 2ACRA 2QVNA 1DTNA 4EWND 3FDGA 2B31A 4HMDA 5K9XA 4A4AA 2PEVA 1QO5A 5CSRA 1YNYA 4YNGA 1TJ1A 3G8RA 1E4IA 3SB0A 4I9JA 4IPNB 5TIMA 3S5SA 4R5EA 3UZXA 1V3HA 3E5BA 2PWGA 2WM1A 1B2YA 4GQQA 3CHCA 3BG9A 3AXHA 2F84A 5H6HA 3SADA 2OSXA 4LUSB 4REQB 2PDGA 4W89A 4KKXA 3IWPA 1J0HA 3B9OA 4LUIA 5E0KA 4ZEPA 1U30A 3B8UA 1L8PA 4ES4A 2NQ5A 1JIBA 4JCMA 3W7KA 1V6VA 4X61A 2CLIA 2OLHA 1TR1A 2Z1BA 2B7QA 1J5SA 3QFWA 1O1ZA 2PWFA 3UESA 3KOFA 4IWWA 4GC3A 4RE2A 4ZQRA 3R8HA 3LGEA 1BF6A 1TPUA 4C1KA 3BGAA 4MKVA 1D2KA 2CBJA 2VC9A 4HJFA 3CUJA 1UR3M 4NF7A 3VINA 3T4CA 3GNOA 3R8GA 4EPKA 1I2OA 3WJSA 5M17A 4FEZA 3T78A 3BTNA 1DIKA 1DYSA 1VBJA 4RL3A 4LVBA 4ZBCA 3WQWA 4JTFA 2NVCA 4CLMA 5H1WA 3QV8A 1NFGA 1W3IA 2QLYA 1IGSA 2Z24A 1QRQA 5ECUA 3DG6A 4UOQA 4JTTA 4PEEA 4YVXA 2BXYA 5CCZA 3FVDA 4Z2IA 3M0MA 1AJ0A 4FSAA 2HK1A 1JPKA 4WDTA 4QCFA 4AD4A 4PR4A 5D30A 4GVIA 1QI2A 2VEGA 2NT1A 3W2MA 4YU1A 1ZFJA 1QR7A 1GEQA 1AQHA 2D0GA 4XVDA 2VRKA 3PJWA 1FWWA 3TXVA 1NOUA 1JPHA 1R2TA 4FR6A 3SN0A 4G7EB 4HCHA 3K5XA 6REQB 2AMXA 4XZWA 4OGZA 2V2HA 1SR9A 2A6LA 5JBDA 2C18A 4UNLA 1LM1A 5A8MA 1C8QA 4PA8A 1G7UA 5AHFA 2NSOA 4FOJA 5A2CA 1EP2A 4DI9A 1W91A 2YCJA 3U2EA 3P82A 2LLEA 2DU2A 2PGWA 4CQDA 1J01A 4XAPA 5C7VA 3TROA 1UD5A 4QG8A 3VCRA 1PIIA 2ICSA 2WQDA 3VIKA 3PSVA 3G22A 3MY9A 4XAFA 2BODX 4KIRA 4M7TA 1BKSA 4DBSA 2A6NA 5CXPA 1WXZA 4HOZA 3AXKA 2ZUSA 4AFYA 1ITQA 4IGNA 1K3UA 1JG9A 3PTMA 5I24A 4O53A 4CNUA 1PS9A 3VC5A 1DWAM 2ATSA 3BCFA 4AVOA 1MMFA 2UWFA 1FKXA 2GQ3A 1V3JA 1BG9A 1AH3A 2HNEA 4KWSA 1E1CB 3EA3A 4L1WA 3W1MA 3NL6A 4A8LA 3UZ5A 1UJPA 2DZUA 3EB2A 3FHAA 1WZKA 3W7CA 1RLCL 5F1UA 1KTBA 1P48A 2CHOA 5G2WA 2Y70A 1UZDA 4HSNA 4HU4A 1XLMA 2WPBA 3UJEA 3GBDA 3GTIA 3GUGA 1Q6DA 1VPQA 3IRDA 4UB9A 3QOMA 1FWCC 3NYZA 3RHGA 3SUVA 2X1TA 3N17A 3TMQA 2ZRYA 3CHEA 4EANA 4A3UA 4XSMA 1UHVA 2QF8A 4ROPA 3V0SA 1B57A 1A49A 1BYCA 1C93A 2PSNA 3HV8A 4J7RA 1VRDA 4MDPA 1TO3A 1T0OA 5HNRA 2NUYA 1YYAA 2WJFA 2J79A 3CZEA 5LZLA 2WPGA 3CAQA 4Q8WA 3NQCA 1P5BA 1IGWA 3MU7A 4LF1A 4B3LA 4DQWA 5KMYA 3T0CA 5H8PA 3OGVA 3PFMA 3VDCA 4JTRA 1WOAA 4PRWA 3GNDA 3EYPA 2QUUA 4EPEC 3W38A 3AU2A 2C8NA 2FZ8A 3PZVA 3H6OA 4M7SA 2VQUA 3N4AA 1VEMA 4TOQA 1PX4A 3UP8A 3LPPA 1IZCA 4NQ1A 2EG6A 1R3QA 5CAKA 2GOKA 4JOMA 1QASA 5AHLA 2FFCA 1WKYA 1ONXA 3GG8A 1B3XA 1KTNA 3LM3A 2GJRA 5ABTA 2JKEA 2YDRA 1GTEA 4KEVA 2VD9A 1QPRA 3WK0A 1A47A 4FOUA 2DSWA 2R6OA 1FWJC 4JIIX 1PPIA 4AD2A 2VVNA 5JQ9A 1Y0EA 2I9EA 2PURA 5JBEA 4FNTA 4PMNA 1S1PA 5FJIA 1L6GA 3ES7A 4NASA 4FIRA 3LK6A 1F4HA 3W86A 1V02A 1SW7A 2WKJA 3VUPA 3E0WA 2OZ3A 4KW2A 5CAHA 3ALFA 1I1WA 1REQB 4MZ8A 2INZA 5TAOA 1PKLA 3YPIA 1XUZA 9CGTA 3PZMA 2VR5A 4BWLC 2DJLA 5BW6A 3CAWA 3BOLA 3QMRA 1H0GA 1DWHM 4DLFA 1F6PA 2CW6A 3PJUA 1M7OA 3ARRA 3CZKA 3GDBA 4LQ1A 4CCDA 4ZOEA 1O5QA 5KEZA 4WJXA 4LB3A 4EE9A 3LQLA 4GJJA 2YCLA 2YB1A 3MZNA 4NI3A 5BU6A 4KGLA 5D2TA 3OQ8A 2WSRA 3PM6A 3T7VA 2HNHA 5EPDA 3DIPA 3S2NA 3OGRA 4B92A 4LT9A 3BLKA 4I7VA 2HPIA 4IHCA 1FX6A 3WUBA 2OYKA 1LROA 1QPKA 3IV3A 1YEYA 5LA2A 4AZ7A 3W7JA 4NYYA 3E2QA 4Q4KA 3S42A 3CAKA 1GKPA 1K02A 3AXXA 4AWSA 1XBYA 3W2LA 3M0IA 2P1FA 2VEFA 2XIOA 3LMYA 5CPMA 2HMCA 3WQVA 3QQ1A 4AD5A 4F0MA 2G96A 1V02E 1BKHA 3D3FA 4XBJA 3OB8A 2WK2A 4FB7A 1EEPA 2RKXA 3G3DA 3QSRA 3VOFA 1WXJA 1H61A 2BASA 1D7FA 2H90A 4X3ZA 4HPGA 2B7OA 1D3GA 1E5NA 2XGZA 1TIWA 1MXGA 3PUEA 3ARZA 4NJKA 4DUVA 1GQJA 1KGXA 4HGXA 1FBAA 1IZJA 5DFAA 3CBWA 1HN1A 1KCZA 3N19B 1ZY9A 4UTTC 4Q7NA 4AMAA 3T40A 3KCLA 1DJQA 2MNRA 3MCNA 3AS3A 4M1RA 1M7PA 3I3EA 2FLIA 5HXMA 3AMDA 4LWWA 1LF1A 2J47A 2WANA 3QGKC 2X1SA 4L9ZA 4KWOA 2BXZA 2DZAA 1FWNA 4TR9A 1KFWA 1HL8A 3W53A 3B9EA 3BJSA 1OK4A 2J7FA 3HG5A 1SZRA 4W93A 1V8EA 1VFSA 3WIJA 4YXGA 2WJEA 3WF3A 4F40A 4C90A 2Y8UA 1GJPA 4I6KA 2OQYA 2VMFA 2Z2AA 3VDGA 2FPYA 4HU3A 4YTSA 3BLPX 1VPYA 2XIJA 4YWSA 5A6JA 2FHCA 1HJQA 4IXHA 4DI8A 3NZGA 3KUMA 3N9KA 4QISA 4ZOCA 3VIGA 2Q8XA 2J75A 2BHUA 3QV7A 4B5WA 1XIHA 1G69A 1RAKA 3GXDA 2YGYA 1ONRA 1YPIA 2GSEA 1UD2A 1XH2A 4AEEA 4QEHA 1Q2SA 2XU2A 4CQAA 2WKLA 4D8LA 4AHOA 4C5YA 3QZEA 4AEOA 1NOFA 5CC3A 4MY9A 4RR4A 7PTDA 1N7KA 3OEXA 4AVNA 1V4YA 5AC5A 3H2FA 4IUOA 1G6CA 4WDWA 4ZMGA 3NGFA 3C2FA 1XCFA 5DMLA 1YNPA 1IR1A 1XLLA 2YSWA 4O57A 3FGCB 4CCEA 4AU0A 3LLDA 1J0JA 2INFA 1UUMA 3W85A 2C71A 4UMAA 5I5RA 3NPXA 1PZ0A 3T81A 2DVTA 3ZR5A 3P80A 2ZUVA 1QMLA 4N4QA 1VC4A 2CYGA 4M24A 1ZENA 4H7ZA 1RPXA 3D46A 2OYMA 1E70M 3I65A 3W25A 4R88A 1B4EA 2VFIA 2ZBTA 3B0VC 1KR0A 1E0WA 4DBWA 3L0GA 4MF4A 1A3HA 4FIQA 3WG6A 4DXVA 2ZKMX 4DY1A 1A5CA 3TFXA 3VC6A 1J79A 4IISA 1BHGA 3H4XA 2ZCGA 2QNEA 2D0FA 4ZB2A 2FYMA 4PMDA 1K8CA 1J6OA 9RUBA 3T0DA 3B8DA 5I0DA 2ZX5A 4GVGA 4UTTA 1LL4A 2ZXDA 4D72A 2HBVA 1C3FA 3CIWA 1ZRQA 4PTXA 5HR7A 1C7TA 4J3VA 3V5FA 4AH7A 3UCDA 3SCPA 3NOYA 4N4PA 1EF3A 2PGEA 1AG1O 4BEUA 1SGJA 3Q2DA 5FJRA 3AJ7A 4BR1A 2QPSA 3GM8A 4RPQA 1XCXA 3TOYA 3CTTA 1FWFC 2W62A 1K9EA 1TREA 4P8UA 1HJWA 1R9ZA 4DWSC 2TYSA 3A5VA 1GOQA 3EWCA 2IXVA 2PODA 4AIOA 4K8EA 4D6JA 1OABA 2F8QA 3VXGA 3WH5A 1RK5A 1PSCA 3NQFA 2ZFAA 4MUPA 2G3JA 2WSKA 2X0HA 1TPEA 4IOTA 4F0LA 3BLOA 3ZO9A 2VGIA 2BVYA 4PTDA 1E1FA 1BF2A 3MB9A 4OBRA 2QAPA 6ALDA 5DRIA 4CN6A 1UG6A 4NZ4A 3KE0A 4MZ1A 2DEPA 4JEJA 1XFBA 4F3HA 3BG5A 3ZLFA 4G1NA 4INFA 1NARA 4E4FA 5D37A 1WCGA 4ZB5A 4NP7A 3UZYA 3AZRA 3NQ6A 1YADA 1XHGA 1M04A 1KGWA 4GX8A 3LTPA 1DIDA 4IH3A 5BXTA 1SJCA 4YN5A 2DSKA 5F7UA 1UWAA 2ATMA 4B9YA 2QVHA 3TN6A 4PUKA 4H6KA 1MNSA 4C7DA 4BI5A 4D1JA 2PF8A 5CQ1A 1MZRA 4AF0A 2V68A 2CLMA 2A3BA 5FCZA 4BQ4A 4WGXA 1KQZA 3QGAC 1OVDA 1B5TA 3PJXA 2HVMA 3L0NA 2V82A 1KXHA 4GHRA 4OU1A 1OX4A 2C7FA 2YA0A 4IPLA 3WQGA 3W75A 2AL2A 2A0NA 3VGGA 2VCAA 3GHSA 3GDLA 5LNUA 3G1YA 2QUMA 1KWKA 3DERA 2BMBA 3GG7A 3FSUA 5A6LA 4OHQA 3CH9A 4V1XA 1QI4A 5FKYA 1DL3A 5BROA 3GD6A 1X98A 1NP2A 4R34A 2ACUA 4XB3A 3JZEA 3FV9A 4C6MA 2W63A 2DZVA 3QBUA 2J24A 3CZJA 2BB0A 5EFFA 3BGGA 2Y7DA 3BAIA 3N14A 3VIJA 3W73A 3O2LA 3L4VA 4IMEA 3UVAA 1XINA 1F2JA 5DY3A 3KL0A 4BKNA 1QNVA 1RJPA 3TQKA 1OZQA 3P81A 3KW3A 4CN4A 1ZJIA 4QS6A 1S5WA 1CGXA 5T26A 4LNCA 5C2GA 5I03A 1GVQA 1GOOA 2FHBA 1XRFA 5FACA 1ECEA 2ZUTA 1M9HA 3CYJA 1OCNA 3IUIA 1BQCA 3G77A 1GW9A 3MT1A 3B9AA 4GNKB 3B0YA 3EX6A 3W27A 3WMBA 3U3HA 2OB3A 5E6ZA 3GTXA 1JXKA 1XGDA 1AJZA 3WBYA 3WQEA 1H7OA 1QHZA 2I5IA 2IKIA 1VIWA 4MPKA 1H60A 1VEPA 1EHAA 2XIBA 3RX2A 2KZHA 3GXIA 3WUFA 3OZYA 1TMQA 3OZPA 5G1YA 1W1VA 6PTDA 1YX1A 4BI7A 3LY0A 2FMNA 3CC1A 5CLWA 3A3XA 3F4VA 2Z1WA 3TR2A 1JZ7A 3T42A 1GK8A 3SCVA 1PCKA 4H9MA 4K37A 4AXNA 2ZRUA 1H50A 4Z1BA 2ZRVA 2F6XA 4MIMA 2DW7A 3LS9A 1GQIA 4AZGA 5C71A 4KERA 1OCJA 4CQCA 1F4AA 4ENLA 3QSTA 2DZSA 4P7RA 3U48A 3BAYA 1YIXA 3TIMA 4K3ZA 1GOMA 4R3UA 4ZZ9A 1ZSXA 2DVUA 3SM0A 4A3HA 4M6QA 3LTYA 2D0HA 3LHUA 4LBUA 2W4XA 1JYNA 4IG2B 4M80A 2CU0A 1NP0A 1JPIA 2PD5A 2DGAA 3NVDA 1WB0A 4AY1A 2KAUC 4R27A 2NX1A 3O3RA 3OLDA 1IR2A 4JFUA 3FNDA 5F4XA 5HJXA 2ZIDA 5CGQA 3EBVA 4BQ3A 2PLCA 1V5XA 1YTKA 1UP0A 1GVEA 2DZTA 1KD0A 3VNJA 5IHSA 4EPBC 4QSHA 1G67A 3DI1A 3IUDA 1HFBA 4LB4A 5GJMA 1XLKA 1JD9A 3L4TA 3M0JA 3NJ3A 4P2VA 2FGLA 2A21A 1TTJA 3UWQA 3WKZA 2DPEA 1UMLA 4P5UA 4AIEA 3TA9A 2VZOA 4JTIA 2J7EA 3TFCA 1NDVA 4NZCA 2DORA 2VFHA 2W5FA 4WUIA 1OX5A 3RRAA 2VP8A 2E4TA 3NEVA 1UH3A 1K9TA 2YL8A 4P7OA 2ZE0A 2ZZ1A 5BCAA 1OC7A 3AMCA 3M46A 5D32A 2ISSA 1TTQA 2TAAA 3VOIA 4AISA 1KQYA 5E0FA 3GG0A 2Z1XA 1LBFA 2D1ZA 3C0JA 5I3FA 2VX7A 2JE8A 4UUIA 2CBIA 4IP4A 3N04A 2TSYA 2GGIA 4AZIA 3VIIA 3T08A 1TPDA 4WLCA 2GWGA 1FP8A 2VEPA 2V38A 2Q8ZA 4E8DA 3I3DA 1F3TA 4BF9A 1BSIA 1LRQA 5C2XA 1O5XA 1XLCA 5A8NA 1JQXA 4GC4A 3OG3A 1ZQ5A 4B5NA 4H7CA 1P0KA 4L80A 4F48A 2OG9A 4DJFC 3C0QA 1M7XA 1IXOA 3I4EA 2XZ9A 3IEBA 2GGGA 3MYPA 3RILA 1WDPA 2RGMA 2Q3RA 1Q3NA 1G94A 1AMKA 1FWEC 3ZJ7A 3RPDA 4UTUA 2Y8KA 1EWDA 2NLIA 3L2IA 1M65A 5KZMA 1MDLA 3B0XA 2RAGA 5GPRA 2ZDRA 5D9OA 4CEUC 5BXRA 3S1UA 1VR6A 4A3YA 5BXSA 4ADSA 4XV0A 2RJGA 2VUNA 1C8VA 1OX6A 1R2SA 2UBPC 1MFUA 3MA8A 4YL2A 2AQVA 3VX1A 4C5ZA 4I5UA 1ZBKA 4RXFA 4WHBA 2ZXAA 2NZLA 3GVRA 3DHPA 1LL6A 1EA0A 1Q6GA 3EPMA 2XM2A 1XD0A 1ZB5A 2EF9A 5HBFA 2EO7A 4ZQPA 1ZU8A 3CEUA 6XIMA 2VC7A 1OFBA 3CH0A 2UZ9A 1KBIA 4QRNA 2DUZA 3AYVA 3RJYA 2ZX9A 3A9BA 1BRLB 2CLHA 2E9MA 3EOOA 2DZWA 4S3KA 2GQ9A 1GKRA 5T8GA 4HU0A 5FF3A 1TTPA 3H2NA 4I7WA 3P5YA 5CEWA 4HTBA 1KB3A 3OODA 3LZ3A 3U2ZA 1EPVA 4W7VA 1X6NA 2X7VA 2OT1A 4IF2A 4UQDA 4YWIA 4JCLA 3WQPA 5K3VA 4ASTA 1ESWA 5AVHA 2WHKA 4PUEA 1IEQA 5PTDA 5HAOA 4D8AA 1HGWA 4Y8EA 4MG4A 2XINA 4Y2WA 1I2PA 5I09A 3KTSA 4OJYA 4JAWA 1LTDA 4KRZA 5AYYA 3FVMA 4QQ3A 1N8IA 3M0ZA 5HJLA 5XIMA 4GY7A 3KBVA 3AI0A 1E0TA 2XVNA 1JCJA 3QYQA 4S38A 3B9DA 4O4VA 4GMEA 1DWJM 1PWMA 4C6QA 2VXNA 4IMAA 3VE7A 3NQAA 1YNQA 3KEHA 1BVNP 4Q6JA 2VDGA 1RVGA 1QNOA 2PDHA 2G50A 2XH0A 2BG5A 4IQDA 4C6OA 3PB0A 1S5MA 3PTQA 3XINA 4LPCA 1W5PA 3W7NA 3P14A 3Q4DA 4WJEA 5C2CA 2WAGA 4JL1A 3ARWA 3ANVA 1EUNA 4CNSA 2I16A 3CT7A 2AGTA 3N4EA 4WZHA 1UD3A 4DJFA 1EGZA 1FY6A 3E1F1 4K2SA 4ZODA 3QHOA 1LP6A 1RV8A 4RNHA 3VILA 5BWFA 3WQ4A 3WQ5A 1RK6A 1PJ9A 2A4AA 1B3VA 3WMLA 3BJFA 4HBKA 3NTYA 5HWJA 3THQA 4CU6A 3ARSA 4P8WA 4HPXA 3OYZA 4JTDA 1ITUA 4H7VA 1E4MM 3UWZA 4DBUA 2B7PA 4GVFA 3TH6A 1P0DA 2G3FA 3QPZA 5E5CA 2B4GA 3WEMA 1W1TA 3E96A 1EZWA 4PMUA 1Q4WA 4RE3A 1DEDA 4H9TA 2TODA 1TVNA 1Q6LA 1U22A 2C14A 1SFTA 1XSJA 4DAFA 1TWZA 5B7ZA 1V0NA 1QNSA 4Q8OA 3EX3A 2H9AA 3WMCA 1WP6A 4PTWA 2VCBA 5D33A 1E0UA 2ODOA 1J18A 1Y5VA 4LANA 3NZPA 1ODZA 4NHVA 1UWRA 4E5TA 3AYSA 1TV2A 5F2MA 4QM1A 1H5VA 1DE5A 4C6CA 3L2LA 4LCRA 3R89A 4K1WA 3SGZA 1CLXA 4ZCWA 4KFNA 3TSDA 1JZ2A 3CNYA 2YPIA 4ZL1A 2YDAA 3ABRA 1QJWA 2PDMA 2RDUA 3TP4A 5J5RA 1UR8A 2SFPA 2YFNA 4JTEA 5ABGA 2XIIA 4TO8A 2QUNA 1G4SA 3HN3A 2YXGA 4NYUA 3HMJG 1O5RA 2W0UA 2HEJA 1J8VA 4XKMA 5CJ5A 3SCTA 5A95A 1AD1A 4D6IA 3W7EA 3NURA 2WYSA 1X38A 4AG0A 4OBTA 4GYJA 3E0LA 4RUBA 5LA0A 3T44A 4EOUA 4PC8A 3O7UA 5I3KA 5KETA 3NL3A 1W3LA 1QNQA 1X96A 3RR1A 2G3IA 4CQBA 1O5KA 1H09A 3BE7A 1OT1A 3WD0A 4HNVA 5HMFA 4AWEA 2JGYA 3NG3A 4MY1A 1QK0A 4PMVA 4FNUA 3ZWSA 3W1NA 1FFRA 2Y0FA 1JULA 2R1PA 4CQ9A 5CG7A 4LNYA 1CB2A 3LRLA 4WOZA 1KM4A 3ZR6A 2FKPA 3R8RA 1ISZA 4GY1A 3O6CA 3LCGA 4M81A 2ONEA 4IP5A 1TJ2A 1VP5A 3VKDA 4N2YA 3ZVIA 4I6VA 3UJFA 2RDTA 3LOTA 3K46A 4PL2A 4DUOA 2EHHA 4MM1A 3O9NA 2HTMA 5AB3A 3LXBA 1CEOA 4NUWA 4DPQA 2G97A 4XBSA 5KZDA 1E9YB 1W1IE 5HINA 3WBAA 4AEFA 4G6CA 4I9MA 3I7RA 1GYNA 2RHGA 3AMKA 1S38A 2OGYA 3MI6A 1CXLA 3QMSA 3KOZA 2L5HA 1XLIA 4UFJA 5DO8A 3I6EA 2PUZA 1LT8A 1G9HA 4L65A 4WOQA 3G8EA 3IJ9A 2VEKA 3DCPA 2XH2A 3H7RA 2ZE3A 3O1NA 4MOZA 3UXIA 1OG6A 3LYEA 3QY6A 1LBLA 1OF6A 2VKZG 1S39A 1J12A 4HKPA 3UGVA 1Q6QA 1MQRA 4ORIA 3GNXA 2ZDSA 2P0IA 3T0TA 2E5BA 1OCQA 3TLLA 1ONWA 3PBWA 2WBGA 1BAGA 3SCUA 3IGUA 2QCNA 4DJDC 2NV1A 2VL4A 3VGBA 3CL6A 2XGBA 3ERPA 3AO0A 2DIKA 2VWTA 3LHWA 1KR1A 3NO5A 3S1GA 3N4FA 1TJRA 4KIEA 1JUKA 4M29A 3THDA 3MCMA 3EDEA 4L9YA 1KV8A 4K6AA 1K70A 3OPSA 1NDWA 5B80A 1LQ0A 3H7VA 2ZXBA 2JGQA 4GYKA 3TYBA 1Q7ZA 4KETA 1BPLB 1DXIA 1HKMA 1OC6A 3LTSA 4O54A 4ALDA 1DQXA 4JNMA 2WNQA 3VZXA 5A2BA 4CU8A 1Z3NA 1ZS2A 5CC6A 3LCIA 4JD4A 4ZGYA 1ZJAA 1K7XA 4GI6A 2FHFA 4YCOA 1FWBC 2BTMA 1LOQA 1UWQA 4XIAA 3M5ZA 2QDEA 1CZ1A 3SQLA 2OPJA 3MW7A 4LF2A 3DHUA 4FX7A 3THUA 3M6YA 4GFSA 3TSMA 5DRCA 2X42A 3C56A 1IQ8A 1I1XA 2EAWA 3N2BA 2XN1A 1TWDA 1A5MC 4H01A 1CLVA 3MQTA 3LLFA 4Q8NA 3F1QA 4F4RA 3GTHA 5M2FX 1RPKA 4KCUA 4HNTA 3WLLA 2OQLA 3FX4A 3AWOA 2XUCA 3VD5A 1BYAA 3FIGA 3M07A 4IUGA 3BOXA 4JQ2A 4Y90A 4NNBA 5GJPA 1IWAA 4XZ9A 3SIMA 1OQFA 2WV8A 1SFSA 4O1AA 3HFTA 1JUBA 1KBKA 5I07A 4G7FA 3R1ZA 1K9DA 3VNZA 4N9CA 3RMJA 2DVXA 2OVLA 5FF0A 3A12A 2ISDA 4GLEA 3MBDA 2Z2BA 4KEMA 3W4RA 2V6AA 4HHMA 3SCNA 4DXKA 1DOSA 3MO7A 2YXOA 4S2BA 1OT2A 3IJ7A 1LZOA 1M01A 4D9PA 4L1GA 4GG9A 4S39A 2YBVA 3TYUA 4ZVJA 1E6NA 5CGTA 2F61A 1DVJA 3NSXA 5LXEA 3P2VA 1GUVA 2WMGA 3UXLA 1XL9A 4HHLA 2FZMA 4EACA 1WUEA 1UR9A 4QNWA 3B8TA 3L4YA 3CMFA 2Q6ZA 3IK2A 4HU8A 4JGDA 3W01A 1BXCA 3LXAA 1NF7A 4K7VA 8CGTA 3WNOA 4AHPA 3LBOA 1OINA 2BP1A 1V51A 3N9SA 5MKGA 2OZ8A 3VDHA 1JCTA 2IKHA 4Q4OA 4IIGA 5D9NA 5EGRA 3F5KA 2FZBA 3PZOA 4UTHA 3RITA 1AH4A 3TYDA 1F3EA 3ZM8A 2FB3A 1J11A 4QLLA 3FYOA 4LJ3A 3LCWA 1AMYA 4GKTA 3WK1A 2GVJA 1AK5A 2PP1A 4DJDA 3EOUA 3M0XA 3ITGA 2ZTJA 3VE9A 1EP1A 2WJZA 3B8VA 2VFEA 4NAFA 3GK0A 3E0VA 3L4XA 4HZ8A 3EAUA 1JRCA 1Q8AA 4GGBA 3VI2A 4TX8A 3NCOA 5LIKX 1HL9A 1GG1A 5DT5A 3RK8A 1ITCA 2HVNA 4NNAA 2ZZ7A 2W92A 4AB4A 3WDPP 3MCOA 4GFIA 3W76A 2WHLA 1CXHA 3FY1A 3UWWA 3EWBX 3ABXA 3JUGA 4UFMA 4UTMA 1KFKA 2GSJA 1SW3A 4PCPA 4WSHA 1XRSA 3MV01 3FA3A 5FA5A 5LIWX 3WD2A 3FXYA 3Q65A 3AIBA 3EWDA 2CITA 2W79A 3U2CA 1J96A 4PH6A 1TPFA 2X1UA 5C6MA 1ODUA 2W9MA 2H6RA 4ZSTA 3IIOA 3KZSA 4JY8A 5ABEA 3G3MA 3EZ4A 2VI0A 1WAWA 3WMSA 3LNMA 3UZWA 4LBRA 4AHQA 4D71A 3W7OA 3TW7A 3E2RA 3CEPA 4H2CA 4L6HA 3PANA 2DQXA 1X7IA 2ALRA 3NA8A 4XD4A 2YCLB 2P53A 1OF8A 1ZNNA 4Q7IA 1V6UA 4B5TA 3CL7A 4QCEA 3NO1A 2PS2A 4WX2A 2ZA1A 3D3AA 4V33A 2D23A 1W8SA 1JNDA 5EKYA 2FZDA 3M0YA 4ZA0A 2QDHA 2G95A 4O12A 3WNKA 3QY8A 3W7RA 4DNHA 1LWHA 1TRDA 3GDRA 1XX1A 6ENLA 2PBOA 3UG3A 1PAMA 1Q6EA 3DI0A 4UTKA 1WO2A 3P74A 3NQDA 5BOFA 3ID7A 4E3VA 5A8GA 4O14A 1TJPA 2ZZ6A 4NNCA 1EH9A 1EJVC 5KITA 3PN8A 1EQPA 3RCYA 3V4BA 2GJNA 3VIMA 3VGFA 3U0HA 1XLDA 1TQXA 1HQTA 5EMYA 3B8WA 3MJMA 1GVOA 2YW3A 4B5XA 4J3WA 3H2EA 3BUVA 4BFAA 4D6HA 1A0EA 3KOYA 7TIMA 4GI8A 3T2PA 3APGA 4HCLA 1GZ1A 3C61A 3SSZA 5GQBA 2QV4A 4V2XA 3E0IA 2J13A 3UY8A 3M0LA 4GQ0A 1FDYA 2VELA 4DJFD 2J9YA 4DB7A 3M41A 5A6MA 5TF0A 3VU2A 3W29A 2CZ5A 3SQMA 1RXOB 1KXTA 2CLKA 4MTVA 4LX4A 1W9DM 1VFHA 1QHOA 3IGHX 3GHTA 3UERA 1GYMA 1UROA 3ZZ1A 3GR8A 4LRSA 4QJ1A 4DYKA 3WH7A 3R43A 3SUTA 1A5NC 1L6YA 1XYCA 1ONEA 1XH0A 2NX3A 3C2EA 3W00A 3ZVHA 2WSPA 3HPSA 1KM6A 5FIPA 5E93A 4OIFA 2FGBA 4GIRA 3AFBA 3K1DA 4S3JA 4LVGA 4CNOA 3W7LA 4DYJA 1VHNA 4J40A 1MFVA 3B03A 3EPOA 4HT3A 4H8UA 1Z9AA 1LUCA 2XSXA 3N12A 4O18A 4V1YA 4B4HA 3R58A 1ZAHA 3BLDA 4QS5A 1IIGA 4QE4A 1E0VA 1TX0A 5A1AA 4KBXA 3H22A 1ENUA 4L9XA 1EYEA 4B5VA 3IANA 4XIMA 2DSVA 2QHAA 2QJGA 4A22A 3S8HA 7CGTA 4Y9OA 3ZS4A 3VMNA 3WLHA 2W66A 1OGBA 3SUSA 4L1XA 3MUXA 1SFJA 4GZEA 5U7SA 3SN4A 2J7BA 2VFFA 2OX1A 5D02A 3EXSA 1QPNA 4IL0A 4XAYA 1W1B1 4G2DA 5HULA 3SURA 3ZLHA 2DDXA 1XQLA 1V79A 2O7QA 4PULA 2QDDA 3LV6A 4D2JA 1K7EA 1LT7A 1FWRA 1L8NA 1QI5A 3WDJA 3UXDA 2F6UA 2ZUMA 4DZHA 2DUAA 1B90A 1RJQA 1MI3A 2Q09A 1VKFA 3CQKA 3SJNA 2IQTA 3DEQA 4R85A 1T8XA 3RCNA 1CXFA 2DZPA 3M0VA 4R9OA 1O7AA 3UEQA 5HA7A 2X2YA 4TX6A 3KZPA 4PTNA 4I8DA 4NJGA 5F4SA 3RRXA 2YJQA 5EY5A 3B40A 1XIGA 3K4DA 3OA5A 1QW7A 1P1MA 3JR2A 4L4MA 2HQAA 1PTAA 2HS8A 3N25A 4D1IA 1Q7MA 3QMTA 1WDWA 1XWYA 1H1NA 3B3DA 3FN9A 4JDYA 2EPLX 4EX4A 3T0BA 4HQVA 1UZ4A 3AMLA 3GVGA 2B81A 1A3WA 3EKLA 5AHEA 1EGVA 1UC5A 3P7YA 3L68A 4RXGA 1WKFA 4G56A 2Y7GA 3URBA 1VEOA 1WV2A 2J25A 4NG3A 2QULA 4OTKA 2IMRA 4V28A 4Q32A 3LRMA 3UCQA 1UBSA 2XM1A 2Z1SA 4GIEA 2DH2A 3TONA 1DJZA 5HR6A 3NQ8A 1KM3A 4DJEC 1TWIA 1BWLA 1KWGA 1QPQA 2ZXQA 3UYIA 8RUCA 1ZHAA 3M5XA 3FSTA 1BVZA 2WW5A 1O94A 5C8BB 3BJTA 1YBQA 2G5WA 2XH4A 4UCGA 1CXIA 4H41A 5BOEA 2V63A 1K03A 3VGEA 3V1HA 1OHLA 4TVDA 2XPKA 3VAVA 3NR0A 4E4PA 2AQOA 4WRHA 1TJ0A 3EA1A 3BOFA 1UKPA 2DSZA 4RX0A 3R2GA 3RG6A 5C9WA 3H7UA 3VOHA 3HQ1A 3R25A 4WXZA 5RUBA 4WCJA 3PTDA 4PUMA 4POCA 3WUEA 3AC0A 4EWJA 3AHYA 1B3WA 2ISWA 1EFZA 1V6XA 3GBEA 3HQNA 3C2VA 2OZ0A 3DG7A 3KBJA 3DENA 4NT0A 5DQPA 3EX4A 1KV5A 4B16A 3C2OA 1X6LA 3N3TA 3POHA 1EF2A 1Q5MA 1R7OA 4XUGA 4A21A 1SZGA 4KEUA 2ACSA 3GDKA 4YHEA 1UWSA 5LGZA 2REQA 4FLQA 1ZUAX 2GJXA 3BLEA 1PO9A 3I6RA 3M5YA 4D6CA 2QS8A 1CENA 2VC6A 4XAZA 1OFEA 3BDKA 2FTWA 5G5IA 3GE7A 1QPOA 1B0IA 4LBSA 1EDTA 2YYTA 2FVLA 2ZZ4A 4FPSA 5A6BD 5FF2A 1ZAIA 1R0MA 1R3VA 3O8AA 3DFTA 2YR1A 3NDOA 5EMJA 1KBJA 1Q6OA 2IS7A 3HG4A 5CBJA 3WNNA 1TPWA 3E0FA 3H55A 3A64A 3BV4A 1EBGA 1PKMA 2OT0A 4E6MA 2NQ9A 4O1EA 4QLJA 3M6DA 1NVMA 4HA3A 3BC9A 4Z2LA 4NI8A 1UKQA 1TA3A 2XVKA 4AF0B 4KWUA 2OFJA 1ZLPA 2CLLA 2EJ1A 1SPQA 3PZUA 3GY1A 2VR4A 3DBPA 4GH3A 1GVIA 3PZQA 4QHRA 4F0KA 2P8BA 2YLLA 1NWTA 1OX4B 3NM3A 2Y5EA 1E9ZB 3KLLA 3W07A 1SO4A 3G5EA 5CPSA 2R9RA 3EA2A 4HA1A 2GGJA 1ZCCA 2R8WA 2FMOA 5FI8A 3RF9A 3K30A 4RE0A 1RQHA 2AL2B 3AZSA 1V3KA 4JKKA 1HG3A 4XZNX 3VKJA 1JF6A 3WJYA 3TTQA 3N18A 4BS0A 1I45A 4GJ1A 5A8OA 4J9JA 1Q45A 3W02A 2Z2UA 1U83A 3G6LA 2C79A 1B1YA 3BPWA 5HNUA 2I57A 3S5NA 2P5NA 4DJEA 2VCCA 4M6UA 2XVGA 1GVYA 1US0A 3SGUA 1JQVA 4J3ZA 1AW1A 3V5OA 2C16A 4HMCA 4MDOA 4EXBA 5BRQA 1PYFA 3GXNA 3A21A 4CQ8A 1MEWA 4ZENA 1HF6A 5DT7A 3JU2A 2CPUA 3QTPA 5ECVA 1P6CA 2YLAA 4C91A 3Q37A 1JCYA 1GVRA 3WLMA 4HHPA 3P67A 3LM7A 3ONCA 1YTDA 1BSLA 3E6EA 3O6AA 1N55A 3FAWA 4MAVA 3A23A 2Z7KA 1VPXA 2A3LA 1A53A 3MWCA 2WSQA 5EA9A 1J2BA 4JKMA 1CECA 2J62A 5E9AA 3DFSA 3TOPA 3BANA 2UY5A 3GU2A 3VA8A 3M9YA 3TZFA 3RAOA 3CGTA 1PV8A 2A2IA 3FJNA 3RXZA 1H41A 4AIBA 4Y9AA 4Z08A 1V93A 3D47A 3CPRA 3W3OA 4ZQOA 2GK1A 3R0DA 1VBGA 3HPAA 3SECA 1R2RA 4PMZA 2EPOA 4Q4RA 3E2SA 4IIFA 1AZ1A 1LJYA 4U2YA 2R91A 3I7SA 2OQHA 1VJZA 1E6SM 3V7PA 1XIBA 4LYPA 5C9XA 3CL8A 3VD3A 4D8ZA 4NVTA 1XGZA 3KP0A 1U5HA 1W17A 4GUHA 3L5MA 2DY3A 2DP3A 1E4LA 3ZJ8A 2HE5A 2EKGA 3GVQA 5G2HA 1IZKA 1K4GA 4JYEA 4UR8A 1V3LA 5FEPA 1EZ2A 4QG6A 4YVPA 1Z69A 3W7MA 5A3HA 2YL5A 2CFFA 1JZ6A 4GIAA 1P43A 1H7WA 1HW6A 5LNWA 1PBGA 1B9BA 1PDZA 5DF0A 1GJUA 4DLMA 3I4KA 3W0KA 1HVXA 3CWHA 3KBNA 1Q6RA 1DQWA 1NAL1 3LI0A 2D2GA 5DLCA 1XI3A 5BMWA 7A3HA 3ZJ6A 4LAUA 1K1DA 4PMJA 2ZX6A 1S5VA 3GNPA 4KESA 3NWRA 1THFD 1O12A 3CV2A 3WLRA 3OLIA 2HROA 3KTCA 4GXPA 3PR2A 3L12A 1J93A 3PPCA 3OG2A 2PRHA 4DAIA 3S2MA 1W9PA 1UQZA 3W2JA 5D38A 1LCOA 1FWSA 1PEZA 1PIGA 1QNRA 3H24A 4LGXA 4DXXA 2XHYA 5T9CE 3IAPA 2XFFA 1R6WA 1S46A 4LVAA 3PNUA 4C6FA 4S3BA 4JN7A 1H49A 1E0XA 3WNPA 1ZAJA 3GTNA 4FXRA 3MUY1 4AZBA 1H5YA 1HKWA 4N9BA 2W67A 4HTYA 1B3ZA 1E3XA 1A50A 4UR9A 1XS2A 1XM3A 3M5VA 3MSGA 1RHCA 4QSFA 3IJDA 5AFDA 1T40A 1TV3A 1UBPC 1I6NA 4FMVA 5ABFA 2FPTA 1O95A 2WZEA 2A7PA 3Q45A 3MDUA 2PP0A 1J6PA 3MP5A 1KC7A 5GNXA 1PIFA 3UZZA 4GXMA 1DORA 3PUOA 4A3QA 1ZJBA 1B31A 1QOXA 2WVSA 2E8ZA 4W5ZA 3NEHA 2NQHA 4HK7A 4HNOA 1Q2RA 3B97A 7ENLA 3PSWA 3DGRA 2I1OA 1SO6A 3WN6A 1VLWA 5DMYA 1Z89A 5LNVA 1U1HA 1NWRA 1ZCOA 5D03A 1KA9F 4WVXA 5D9PA 3NZQA 1MQQA 1KXVA 4OT7A 4YMZA 3E5PA 1ICQA 2HRWA 1W5MA 3U5YA 4FLRA 2XN2A 1XYBA 4Q4QA 2HDJA 1AFSA 4FNSA 2WXDM 4JYDA 1OY0A 3KBWA 4W8BA 2HWGA 4D6DA 2XYLA 1KBBA 1EXBA 1R46A 4Q8QA 4H8VA 3NDYA 2BY0A 2PWHA 3VX0A 1K8XA 1I75A 2O0TA 3TTOA 3VNIA 1OB0A 4L5ZA 3H23A 3WQDA 6TIMA 4I8YA 3F7JA 1WKEA 1BWKA 2P8CA 4CVWA 2WNWA 3T0AA 1V0MA 3QFEA 3A3WA 3VFCA 2XN0A 3MJYA 4E8GA 3CK5A 3W7IA 5J5DA 4PE8A 2OO6A 4MFDA 1T8QA 4K8HA 4H8HA 2WVUA 3E9AA 4DN1A 4W84A 2DIEA 3MMTA 1EIXA 4C1NA 2A7NA 4C6NA 1XF0A 1U33A 4NXKA 3MUAA 1QCWA 1F8MA 2F2HA 4GISA 1S5TA 2J7HA 1H62A 3CV7A 4BA0A 5GJNA 2V0TA 3KS6A 3OJGA 1O6IA 4O50A 3UPBA 1TV8A 3C2RA 3C86A 5ENLA 1UIOA 1YLVA 2C1GA 4F0RA 1S2TA 4H2HA 2AQWA 3LDVA 4BF7A 2OTDA 5FJTA 1E5JA 1Z41A 3BWWA 3P3BA 3ABOA 1JR1A 5KSWA 4ADTA 3WSUA 5F4WA 1OFQA 3QOKA 1H7XA 1X39A 1C29A 2FH8A 1XIDA 3EPNA 5ABHA 1XPGA 1QAPA 3RM9A 4ECLA 3Q58A 4Y8FA 1P0NA 4GXWA 3LPFA 1S5NA 2C0HA 1PWLA 1DE6A 3CLMA 2CZEA 4IIEA 1L6SA 4F0SA 3M64A 2IPFA 3KTXA 1UWIA 2Y8VA 1YRRA 1AW2A 3S5YA 4R9XA 1J9YA 1YDVA 4LS1A 2YIHA 1D3HA 1JD7A 3THAA 1V7YA 4DBEA 4PRTA 4DRSA 3NQEA 1ZBWA 1O66A 4DZIA 4QDWA 4LYKA 2NX9A 3TC7A 2ZA2A 4OZOA 3CWOX 2UY3A 3C5QA 3RGTA 1FUYA 1YQ2A 3TYAA 4Q3MA 3LGGA 3SUUA 3WD4A 1JI1A 4D6GA 2X1IA 1W56A 2J8FA 2QCCA 3IRSA 5CBIA 1M68A 3OVRA 1N8WA 4JQAA 3HPZA 1RCQA 2OOGA 3H21A 3REQA 1XG4A 4FLOA 1FXQA 2J8GA 3STEA 1SFLA 4N7QA 1IT0A 4NIRA 3CUGA 1Q4NX 2X7WA 2H9AB 1JZ4A 4BJHA 1WDSA 3UWVA 5TQLA 4CU7A 1VHCA 3GC2A 3W1QA 4RW3A 3XIMA 3VPLA 5LA1A 1XH1A 2ZC8A 4O10A 2R24A 4NAEA 1SVDA 2PRMA 1ZALA 4WXYA 2GOUA 3BMVA 2RGLA 2V8ZA 1NU5A 3CB8A 1LL7A 3CV6A 3RO8A 2OX4A 2PI6A 4E2VA 3WLJA 3W2UA 3NZRA 4U33A 3W28A 4MZYA 3VD4A 1QXLA 2WNZA 4PMOA 3ARUA 4H19A 5KINA 3EB4A 3O16A 2NW0A 4AY8A 4J2MA 2VGFA 4OWGA 1E6QM 3RPTA 1HKVA 3C8NA 2PC4A 3G1HA 1TZ7A 3WX7A 2E67A 4MWAC 1TV5A 1BGGA 4Q4MA 1NSJA 1WA3A 2Z7GA 3H2AA 1E43A 3VZYA 1VENA 1IT8A 4CD5A 3CLWA 1K77A 1QDSA 1HT6A 4DO5A 4JXCA 2ASHA 3FHQA 3GS6A 1NEYA 4V15A 3OHMB 1AQFA 1UKSA 2XIQA 4LFYA 1NJJA 1GGOA 5HWMA 1XDLA 3MBFA 3RMEA 3S2LA 2D69A 4Z1DA 3T09A 4HYRA 1E9IA 2X2GA 4AYGA 4DVOA 4LYRA 4ATLA 2FJKA 1IYXA 2WWDA 3WLIA 5JVLA 1YHTA 1WOBA 2FB2A 1UZ1A 4O19A 1QW8A 4NL1A 1UWTA 3K8LA 1PZ2A 3QQ0A 1KLZA 3WQFA 2ZWZA 2QUVA 1AL7A 2PWUA 1G7VA 5FL1A 3LQGA 2EPKX 3DC0A 2J27A 1UKOA 4DM1A 1FVPA 3LX9A 1I2NA 5CZJA 4C6DA 3WLOA 4GZJA 3UFYA 3VD9A 3XISA 1H4PA 4ROQA 3LPOA 3P61A 3PBGA 4XKYA 3MI2A 1GOWA 3MP3A 1KFEA 4DJED 1C7SA 1SSDA 1J2WA 4HA4A 1UW9A 4N9DA 3PZ9A 1SO5A 3WD1A 3MSDA 4CEXC 1GOIA 2OKOA 3IJQA 4KGJA 3WH6A 1EOMA 4YYCA 5A94A 4L4OA 1LOLA 4GUFA 2E5CA 3KOWA 4KEZA 5CG0A 3CQIA 3AIEA 3NQBA 2PTXA 1X8CA 5B7YA 1TWSA 4TTUA 3TA6A 4GBUA 1H7NA 1A5BA 1JEZA 1UUQA 5HNNA 4IGMA 2WNNA 2DFAA 5EBAA 3ITCA 2C0AA 1SMDA 2VYOA 1VYPX 1L9WA 3C0SA 1B9ZA 1ZJHA 1EJTC 3DU0A 4QITA 4YTQA 3ZQ9A 3T6CA 1JNEA 3BO9A 4TVCA 1XYAA 3L21A 4Z17A 2NXHA 1O60A 4LCQA 1KM1A 4ZR8A 4HD5A 3ONBA 4MWAA 5HQMA 2WLZA 4QLKA 2Y6ZA 2OLSA 1W3NA 1XYFA 4LH8A 4WEVX 1GOKA 5HUPA 3ITLA 4ZE4A 2QCDA 3TQVA 1UMYA 3UWUA 3NO3A 3TZNA 2EKCA 3THCA 6CGTA 1FH8A 2WWCA 1ISYA 4J3SA 1Q6FA 4D6EA 2IKJA 3PK7A 2WMHA 3H26A 2FDMA 1UD6A 3V35A 4UZUA 1PZ3A 3R11A 4YJ5A 3U7BA 3MSYA 1M1BA 3S9YA 3PBMA 3M7SA 3EWXA 5CSYA 4UFHA 4US5A 2J9XA 5AVNA 1G01A 1GW1A 4L61A 2NUWA 3N2MA 3VVGA 1AJ2A 4PMRA 4TMCA 2W3ZA 2DV0A 3MZ2A 3PWAA 1FQ0A 4PMXA 2VVSA 4Y9PA 3CZ8A 3VOGA 3TN4A 5CPOA 5FF7A 4UTLA 3W6MA 1R86A 3F03K 3MHUA 1DBTA 2ZOXA 4U10A 3P8JA 3PPFA 3P60A 1EPXA 2Z6IA 4UTWC 3W72A 3H8AA 3P0WA 3G0UA 1ZP4A 2WZHA 1UOKA 4HJWA 1I4NA 2GVLA 2NV2A 2DT2A 1H63A 4FP1A 2WHMA 2D2HA 3CUFA 1TPC1 1U5VA 3R0UA 5TNVA 1G0CA 3ZXWA 3GHRA 4NJIA 4JX5A 3PAOA 3L4WA 1BXBA 1V7AA 3MS8A 3ALGA 1KGUA 3VKCA 1EC9A 1I2QA 3A4WA 4GQGA 4MWAE 1FH7A 3S5OA 5IDZA 3NSMA 4GJIA 3K4AA 4PL1A 3APYA 3CHFA 4BHYA 4LOCA 2OWWA 1XFCA 1P6BA 5MKGB 4Q8UA 4OUIA 2BDQA 2VZUA 3OBKA 3STGA 1TSIA 4BQ5A 1LLOA 3TYCA 3DOPA 2PDYA 4I5RA 3TR9A 2VX4A 4A3RA 1KFBA 5BXPA 4E2BA 2B0MA 1KW1A 4BWLA 4ERGA 2PDWA 4CNPA 2WHJA 1VH7A 3PC0A 3GC5A 1KXQA 1BGAA 3PBYA 1V08A 4GCAA 2BGSA 4O1CA 1L6WA 3DN5A 5AYXA 4NAFB 5I6SA 5FEWA 3QLDA 3GH4A 2CLPA 3WBEA 1T41A 2H8XA 2V3EA 4MYXA 3W22A 3W7GA 3BW2A 3DDMA 2YB4A 1CGWA 3SAZA 1P0EA 5G4WA 1EO5A 4H4IA 5CBBA 1C8XA 3AU6A 2DQWA 1CT5A 3ITTA 4A6GA 3COTA 3QF0A 5A6TC 3AXIA 4JTCA 2V5BA 5H8UA 3LG3A 1RP9A 4JTJA 1AA1B 1WDQA 4FZIA 3GG1A 4B9ZA 3N1AA 2GVEA 4A8RA 3GX9A 4ZOBA 1XISA 1P6WA 1XKYA 2Z28A 4JNYA 2JFEX 4H6RA 2W27A 4H04A 3OTRA 5BMXA 2J77A 1TV4A 5JXQA 1CPUA 3GC4A 1RSCA 2H8ZA 4MJ4A 1J0ZA 1YPXA 2IKGA 3APTA 4JDBA 3TDFA 1TUXA 3TTSA 1QT1A 3PTKA 1RA5A 2JF7A 1T7LA 2ZRZA 4ACZA 5FSEC 2PTWA 1PKNA 5DBTA 5AC4A 4GINA 1S2UA 4DUWA 3NXLA 4Z2GA 1MW3A 5D9MA 1VRXA 2ZX7A 4K39A 3EEGA 1E71M 1TYGA 3KWXA 2JQXA 4OECA 2GDVA 3SUWA 1I0BA 4WDXA 1Q66A 4X63A 4HZMA 1RA0A 4HNCA 1DJYA 2DSUA 5D09A 4FNQA 2O55A 4HP5A 1LLWA 5BOOA 2Z25A 3RN6A 1OADA 4GD0A 4WY0A 2EPNA 2CLOA 4JIQA 2E6AA 3KAOA 4NSBA 1GJWA 7TAAA 4RKAA 4ZO8A 4UTWA 3WEOA 2RJHA 4W87A 1NIUA 1E55A 3S2CA 2YCEA 3HPFA 1XLFA 1UASA 1IWPA 3CZLA 4E3TA 3RLUA 1EB3A 3EKGA 3V75A 3SR7A 1R3RA 1TRIA 3AS2A 3TKFA 4JR5A 3HA1A 4GOAA 4QX4A 1KNWA 3QZ6A 4GUIA 3KBSA 5CLTA 5FJJA 5BRPA 2PDXA 4OFCA 1XRTA 3UWYA 5KZEA 1FHVA 1JPMA 1MZHA 2ZC1A 1QWKA 5HANA 3SBFA 4FS9A 3UPWA 3VKBA 1FXPA 3TJ4A 2IW0A 3BMXA 5D4YA 3T55A 1PYMA 4FOKA 2QPXA 4GI9A 1XYMA 2DIJA 5DCEA 2JF6A 1CLKA 1JI2A 1ELSA 1W3HA 5CH9A 5FF4A 4Z1YA 3NAVA 2J66A 3LCFA 4RPPA 1XLEA 3EDJA 1XRVA 3PF3A 1H3GA 1QU4A 1IV8A 4LVDA 4HOWA 5K7JA 3KP1A 4M56A 3WBXA 4ZSUA 1J4EA 1I9CB 3NPWA 2QCHA 1OM0A 5D8WA 4QFUA 2FH6A 3H53A 3ZVHB 4QIUA 4HNLA 3GXTA 3HGSA 4CNNA 4CD4A 2JBMA 5LIXX 1CGUA 1XYZA 1ZGDA 2HK0A 1XR2A 2G41A 1B54A 5HPOA 1C91A 1E72M 5LGXA 5D2YA 3TTEA 3C6CA 3W87A 1TG7A 3U9IA 1LUCB 5FD0A 5JH2A 3LENA 2E5DA 2XISA 2A3CA 5LSMA 3AIUA 2JALA 8TIMA 4LUJA 3VABA 1XG3A 4HK5A 3IGSA 1J0KA 3BH4A 1E6RA 2G4JA 2BX7A 2TRSA 1J0YA 4H9UA 2IUZA 1W1ZA 4JTUA 3WLPA 4W8AA 4LUTA 2ZZ3A 1XICA 3RUBL 2E6YA 3U57A 3OA3A 3VZZA 3O15A 2EPHA 4JFTA 3G1AA 3E12A 2E1DA 1A5LC 4NZ5A 4MJ2A 1BQGA 3N6JA 3BAWA 2J7GA 1X6UA 2OSYA 4M19A 2WMIA 4GQRA 3QV6A 3TC6A 4NILA 4RZBA 4C1LA 3FEMA 4E8CA 1OGSA 2PDUA 5LIYX 1SMAA 3HBLA 2VT0A 3KVKA 1XBZA 1KM2A 3MDWA 3MMUA 1OJXA 3W84A 4GIYA 2GLKA 4N02A 3VNKA 4GNJA 1EKOA 2I5GA 4JQ3A 4MJMA 4H9YA 4IJCA 1ISWA 4M3PA 4TMBA 2DZBA 5D2VA 4G9PA 1AW5A 4DYEA 1VB9A 2RFGA 2QCMA 1ALDA 4WR3A 3UGRA 4X9SA 4OOUA 3ITXA 3LZ5A 1U1UA 1QFEA 3QKZA 4JN8A 2VENA 4WK9A 2ZYFA 4JZ5A 2FGZA 3B4UA 4DWSA 4MB1A 2GFTA 2V5KA 1A80A 4JY9A 4U2ZA 2G8ZA 1VYRA 3SFWA 3WZ0E 5HQLA 4LU0A 2X0YA 1VFOA 3VOCA 2BGNE 1IT7A 4AYSA 3O6YX 3PBVA 4GK8A 3HOJA 4XZIA 4LVFA 1Z8AA 1YBQB 3TCEA 4C6EA 4QNEA 2HE8A 4HCDA 3ECQA 5CPQA 4JS3A 5I3JA 2R82A 1EX1A 4M6PA 3W6LA 3BVJA 3UCCA 3BQ6A 2XFRA 1R87A 2ISVA 2VQTA 2Y89A 3NYDA 3WEZA 1ME9A 3QHMA 2QDGA 2NUXA 4NZJA 2PZNA 1NH6A 4PUWA 1V0KA 2YL9A 4F8XA 4ZFCA 4S3GA 1UCWA 1WX0A 7REQB 4GYFA 1W2VA 1UKTA 2VURA 3ZMRA 2VUYA 3VKKA 3KVJA 3F2BA 4HB7A 3G18A 4CCZA 2G37A 1B3OA 4ZE5A 4ZOAA 1XC4A 5LHFA 3P8IA 1EHNA 5XIAA 4F0HA 3TX9A 5T91A 4MPQA 3S0CA 3UBPC 2R1KA 2REQB 1VQTA 2GJXB 2OGJA 3T05A 4HMEA 3PNZA 1SJDA 3BSHA 4WGHA 4GBDA 1GVFA 3S47A 4I90A 4W88A 2QZRA 3W1XA 1X1NA 1D8WA 1QWGA 1JGMA 1KM5A 1VD6A 2ZICA 3LU2A 2R1LA 3W74A 1GORA 1F8IA 2YDSA 4W9TA 3KL5A 1Y5WA 1CYGA 1CDGA 2ZTKA 2FVMA 4HN4A 4O4WA 3VD7A 3T8QA 3V3WA 4DO6A 4MWAD 1TMLA 3TLQA 3ICJA 1F6KA 2IPWA 3HQOA 2PAJA 3DXIA 3ARPA 4WJ8A 3HGRA 4UQCA 5L9FA 1GWJA 3DAQA 3H2MA 1A5KC 2IQ0A 4GZIA 3HF3A 1TA3B 1XUUA 3Q94A 3MWAA 3TTYA 4FR1A 4A05A 1UUOA 1OIFA 2Z27A 1ZBCA 5BYWA 2VFGA 2Y5JA 2ON3A 3B9NA 2BSLA 3HU7A 4IQJA 1E3ZA 2PCEA 1BXNA 5K4ZA 1H7RA 3STCA 2Y24A 2X41A 4XTDA 5EU9A 3WLSA 4US5D 3LGDA 1B30A 3PY2A 3TEVA 3WDQA 4I9TA 3GLCA 4HZ7A 3CO4A 4O8AA 1M5WA 3NDZA 4AAJA 2W61A 2UY2A 2VHLA 9XIMA 3PS7A 2QJNA 1HUVA 1TVPA 3OLGA 5AC7A 4ZTYA 1PCWA 3FFSA 1SYTA 5I3IA 1DTUA 5JIPA 2GQAA 1O4UA 1M41A 4ORMA 2WC4A 3ARXA 4I5XA 2WQPA 1CWYA 1KCKA 3MKVA 2PDBA 2JEQA 1OFOA 3KDOA 3GR7A 2CBUA