3B3GA

The 2.4 a crystal structure of the apo catalytic domain of coactivator-associated arginine methyl transferase i(carm1,140-480).
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
324
structure length
324
Chain Sequence
GYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from structures of coactivator-associated arginine methyltransferase 1 domains.
pubmed doi rcsb
molecule keywords Histone-arginine methyltransferase CARM1
molecule tags Transferase
source organism Rattus norvegicus
total genus 103
structure length 324
sequence length 324
chains with identical sequence B
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2007-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 3b3gA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3b3gA01
2P3OA 4X61A 4RTLA 2E5WA 5G02A 1WXXA 5K0BA 2EX4A 4OX9Y 3G8AA 3F4KA 5DX1A 4PIMA 3X0DA 1ZQ9A 5LQJA 2NXJA 5EKUA 2IDJA 3P9NA 4HH4A 4C04A 4PGGA 3TFWA 3NVKI 2B9EA 1Q0SA 5FA5A 2IPXA 5E9WA 3SSNA 5C0OE 3VSEA 2XBMA 3I64A 3BUSA 1JQEA 2V7EA 2ERCA 3TQSA 1INLA 1X1BA 1DL5A 2O57A 2IDKA 3CBGA 5CVVA 4CTKA 4CXMA 1SG9A 5FQOA 3ELDA 5T67A 1WY7A 2VS1A 3UA4A 1QAOA 4HGYA 3FRIA 5FTWA 3LSTA 4KW7A 5ICGA 4YV0A 1XDZA 3OFKA 1SQGA 4Y2HA 5BW5A 1DCTA 4GUAA 9MHTA 2C7PA 1SKMA 4KIFA 4YMGA 4G56A 4KRGA 4AZVA 1D2HA 5LQNA 5EGSA 1ZKDA 1WS6A 2H11A 2PV0A 3BWCA 2VDVE 3G88A 3MTIA 1X1AA 4HG2A 1RJDA 4CKBA 2PLWA 3SR4A 1SVUA 1YZHA 3MERA 4RYLA 3FPEA 4ISCA 3E7PA 5K0JA 3KQVA 1M0EA 1VP3A 2WK1A 2ZZNA 4C05A 2ZZMA 2GB4A 1NW7A 4DQ0A 4M7RA 3KQPA 2AOVA 2PX5A 5HILA 3VYWA 2FK8A 3EVEA 4LWOA 5IKMA 4E2ZA 4E33A 2PX2A 3TR6A 2AOTA 1DUSA 2ZULA 1TPYA 3C3YA 2P7HA 3DMHA 3EMBA 4GOMD 4DKJA 2ZIEA 1NW8A 3GU3A 3SX0A 3KPWA 5BXYA 2AOTB 3NWBA 4E2XA 5KVAA 4HSGA 1YFJA 3OFJA 4PYOA 2JHCA 4RVHA 5T64A 3QOWA 3IV6A 2YVLA 1NE2A 3SSMA 3JWIA 3OU2A 5DM4A 3KR9A 4MHTA 4E2YA 2G8NA 5EMMA 4PIPA 2IH2A 4RVDA 3ID6C 1FBNA 3KPYA 2AOUA 3JWJA 3M6VA 3R24A 4PYKA 5DT2A 5GIPE 1G55A 3P9KA 2NXNA 1N7IA 4FR0A 1EQAA 4QTTB 5HEKA 2HMYB 4C4AA 3C0KA 3DXYA 3O7WA 4F86A 3PX3A 3G5LA 2AOUB 4GQBA 5EMLA 1FPQA 4BP3A 1N7JA 4UOEA 3PX2A 3PS9A 2IFTA 3LDUA 2PXCA 3KU1A 4JXJA 4C06A 1UIRA 3E23A 3NWEA 3G2PA 3HCEA 4M37A 3ER8A 4BLUA 4ER3A 5LQCA 3HCBA 3MTEA 1F38A 4AZTA 3MHTA 4GOND 3DH0A 2OO3A 3P71T 1KHHA 1VLMA 4RTOA 3V97A 2PT9A 4V0QA 3B5IA 1NT2A 2P40A 2PX8A 4IV8A 5K03A 1KYWA 3DTNA 2I9KA 1ORIA 2CMGA 3C6KA 3FUUA 4HRAA 4L7VA 2BH2A 4OQDA 3NTVA 5E1MA 4IWNA 4QDJA 3NDJA 2ZW9A 1BOOA 1TW3A 3FTFA 1G8SA 4E31A 5KQRA 2ZTHA 2OB2A 3LDGA 5CM2Z 1BHJA 2BM9A 5FADA 1Q0TA 2YXEA 3VC1A 3ERCA 5F2KA 2IH5A 4YUWA 3NW9A 1KPIA 4LG1A 1NW3A 4PGHA 5HZMA 2P3QA 3EVZA 1VBFA 2NYUA 3M70A 3PB3A 2XYRA 4FT4A 4EVIA 4V0RA 3RW9A 1IY9A 3GJYA 3TPZA 2Y1XA 1KYZA 1O9GA 4BY9E 2OB1A 4FSXA 1JG1A 4RTKA 5C1IA 3BGVA 2O06A 3CC8A 3GGDA 1IM8A 3HA5A 1L3BA 1FJXA 3HCAA 5EC8A 5K0NA 3T0IA 1L3IA 4PYLA 3EEOA 3KR1A 1VIDA 3U81A 3FRHA 4QPPA 1XVAA 4DM3A 3HVKA 3P2EA 5GP1A 4XUEA 4YMHA 3THSA 4PCAA 4RSRA 5E2AA 4E30A 5JR3A 3TKYA 1P1BA 2KW5A 2YUIA 3P9IA 1YB2A 4PONA 7MHTA 2AZTA 3A25A 3M6WA 4AX8A 2Q41A 3UA3A 3GRRA 5BW4A 5K0CA 1KR5A 5KYGA 5LQRA 4AZWA 5D1NA 1JQDA 1NBIA 1Z3CA 4P7GA 4QQKA 2B78A 5DXAA 1L1EA 4ER0A 2AN5A 4BLVA 2Y1WA 3EGEA 1MHTA 1EIZA 3FPGA 2OBFA 2BR4A 1RJEA 1L3CA 2CKDA 3P9CA 1UFKA 2IH4A 3UJ9A 3FPHA 4RTSA 3PLAE 3DXZA 4E70A 1JQ3A 2NXEA 2PGXA 4R8SA 4IV0A 4EKIA 5K0LA 1AQIA 4F85A 1KPHA 3EEYA 3PFHA 1JTEA 2I62A 1NV9A 3DP7A 3G8BA 2G72A 3OU6A 4HC4A 4YUYA 4RTMA 4IKPA 4KWCA 4PYMA 2C7RA 2BZGA 3T7TA 4RTJA 4X1OA 8MHTA 1RJFA 3MB5A 5K05A 3T7RA 1X19A 2OPBA 3TM4A 3B89A 1JG4A 4DCMA 3GRUA 2P3LA 1XDSA 3IHTA 3JWGA 3M4XA 2FRXA 4LWPA 1QAQA 4C03A 1PJZA 3EVGA 4GOLD 4KIGA 3HVIA 2EJTA 1BKYA 1R6AA 1XJ5A 4QVKA 3FYDA 3UBTA 4OBXA 3HNRA 3BGDA 2NXCA 5FA8A 2B25A 3OU7A 3M6UA 2YXLA 3RODA 1ZG3A 3AWIA 2NP6A 3EVCA 3G2MA 2JG3A 2G71A 5EIFA 1XDUA 1R18A 3ELUA 2XYQA 3EVDA 3FPJA 1ORHA 2G70A 1P91A 2QE6A 3B7PA 3HCCA 2ZFUA 1YF3A 1VQ1A 1L9KA 2A14A 4RTQA 1G8AA 5P8WA 5E8RA 4QTUB 1I9GA 5LQKA 2BR3A 3BXOA 4DMGA 3EVAA 5ICCA 4R6XA 3BKWA 1JTFA 4YUXA 4P58A 4RX1A 2P1DA 4CKEA 4M38A 1EG2A 3LKDA 4E2WA 2DULA 4PYJA 3DMGA 3BZBA 2IBSA 4DCGA 2VP3A 3GIWA 4GF5A 4QQNA 3PFGA 5GM2A 3OZRA 1M6YA 4GOOD 2F8LA 4CWAA 2JHAA 2ADMA 2PWPA 2UYHA 3NMUF 3OPNA 2IBTA 5EG5A 2FHPA 2AOXA 2I7CA 4F84A 2HV9A 2JJQA 2OKCA 5CCBA 5DX0A 3LBFA 2BM8A 3R6TA 4PYIA 3PTAA 2Z6QA 3REOA 3LHDA 4BP1A 3KPUA 3KHKA 4FSDA 1RI1A 3CJTA 3ME5A 3A7EA 1ZGAA 3HEMA 3MCZA 5K0GA 5CVUA 5CCXA 1T43A 3BWBA 5DTMA 5EMKA 5CUQA 5M5BA 5DLYA 1SQFA 5JUWA 2ZVJA 3EVBA 5CVEA 4K6MA 5FUBA 4YUVA 1EAMA 2EJUA 1VE3A 2GLUA 2PBFA 2ESRA 3BKXA 3FTDA 3HP7A 3H2BA 5CD1A 5D1HA 4RTRA 4R8RA 3KQTA 4CKCA 3B3FA 1JSZA 3KR2A 5LR6A 2QYOA 1U2ZA 2XVAA 3GWZA 3M6XA 5KS2A 2ZWAA 4ER5A 3CCFA 2PKWA 2PX4A 2FPOA 3KPVA 3I53A 5DSXA 5LQUA 3BWMA 3I58A 2YXDA 4KDRA 2O0LA 3DMFA 3HCDA 4X41A 2HR1A 3DULA 5FWAA 2VDUE 3UJ6A 3OE5A 3DLIA 4AUKA 3OCJA 3R3HA 5EEGA 5H02A 2FYTA 3O4FA 5DM0A 4QPNA 2YX1A 5FWDA 3A27A 3P2IA 3EGVA 2HWKA 1D2CA 1M6EX 3LBYA 1XTPA 2ONZA 4FT2A 5EZSA 3LECA 1OR8A 3AXSA 2ZBQA 3DR5A 2JHPA 5E1BA 5E1OA 2P8JA 3DOUA 4MIKA 5K0EA 2R3SA 2PXAA 5E8JA 5C9ZA 3D2LA 3S68A 2G1PA 4PNEA 4Z2YA 5ERGB 2LD4A 3ER9A 1FP1D 1R00A 3VC2A 3TKAA 3KKZA 5GIOE 2HNKA 3LCVB 3KPJA 2P41A 3HTXA 1G60A 1RI3A 3GXOA 5EKXA 3KQSA 2YQZA 2H1RA 1AQJA 3LCUA 3UJCA 1B42A 4PCLA 4ATNA 2Z6AA 3UJ7A 3ELYA 1VPTA 3TM5A 3UJBA 1YFLA 2ZBRA 1NBHA 3BGIA 5EOVA 3FUWA 4EKGA 1YZ3A 2AR0A 3K0BA 4AZSA 5ICEA 3PVCA 1NKVA 3FUTA 3MCTA 4XUCA 5E2BA 2Z6UA 5K8VA 3GRZA 5DPMA 3UJDA 3FTEA 5EIWA 1G6Q1 3DUWA 4A6DA 5CIYA 3K6RA 4PINA 2AVDA 4Y30A 2UYCA 2OZVA 5HIJA 2OY0A 1EJ6A 5EPEA 1D2GA 3G89A 3SM3A 4R6WA 4EMSA 4EQZA 3O31A 3G2OA 5EQJB 1IXKA 3WSTA 2YTZA 3B3GA 3HA3A 5FULA 2UYQA 3SXJA 1G38A 3SMQA 4KVZA 3GO4A 3P97A 2ZSUA 4RTNA 2C7QA 1JR4A 3TOSA 3LKZA 5HIKA 3AXTA 3GRYA 3T7SA 2B2CA 2AVNA 3MAGA 4RV9A 10MHA 3SGLA 1PRYA 3HCFA 5DRYA 5MHTA 3KR0A 2UZ4A 1XXLA 3IEIA 1N2XA 4XUDA 3UJAA 1WZNA 1QYRA 4M36A 2QRVA 4DZRA 3P8ZA 2PT6A 2VZ9A 3EVFA 2UYOA 3KQWA 3GNLA 2B3TA 3R9XB 4NECA 2DPMA 2IIPA 4EK9A 4ZTBA 3C6MA 2QRVB 2GA9A 4LECA 2XVMA 1RI5A 2PY6A 3MGGA 2EFJA 2CL5A 3HVJA 1HNNA 3G7UA 4P7KA 2AOWA 3JWHA 5GM1A 3KQQA 4PYNA 4RWZA 5ICFA 4QDKA 3QV2A 3A26A 2VDWA 3A4TA 5EZQA 1WXWA 5K09A 4FS8A 1EJ0A 1ZGJA 4RVGA 4GEKA 5FQNA 4FGZA 3Q87B 5DTRA 2N47A 4GBED 3IYLW 3MQ2A 3A7DA 4ER6A 3LCCA 5DX8A 2C7OA 3SSOA 4FP9A 4B17A 1SUIA 5U4XA 2P35A 4RTPA 5K0FA 5EHIA 4DA4A 1FP2A 5DWQA 2P7IA 2I6GA 5E1DA 1P1CA 4MQ4A 3E05A 5FHRA 1XCLA 3RIEA 4OQEA 3GRVA 3NVMB 3G2QA 3ANXA 2JH9A 2IP2A 1SUSA 1VL5A 5CVDA 2PJDA 3M33A 2R6ZA 3PT9A 3LPMA 4XCXA 1X1DA 2CWWA 2FK7A 3NDIA 3ORHA 3TLJA 2GH1A 3I9FA 4KDCA 4QVGA 4HGZA 5FCDA 2H00A 3BT7A 1H1DA 1UWVA 2ZLBA 4O29A 4GC5A 1Y8CA 3KQYA 3AY0A 2AN4A 3P2KA 3R0QA 4X63A 4U7TB 3TMAA 3Q7EA 3THRA 1JG2A 2GAFA 3CVOA 1KP9A 1YUBA 5E9QA 1BC5A 1HMYA 2ZCJA 3FUVA 2PVCA 5BP7A 4DF3A 3DXXA 1X1CA 4OA5A 3AJDA 1RI2A 4OBWA 4PWYA 3OE4A 4WVLA 1R8YA 1ZHFA 4P7FA 2QY6A 2WA1A 3BWYA 1AF7A 3CJQA 5EHGA 2FCAA 4C07A 3L8DA 4P7JA 3CKKA 3HVHA 4PYQA 3V8VA 4YV2A 3OZSA 5HOQA 3HM2A 4R05A 4BLWA 2V74B 2JH8A 2PSSA 2BR5A 4MTLA 4YV1A 3HA7A 4HTFA 4X60A 4H0NA 3UZUA 3NJRA 3EGIA 3KQMA 4YUZA 1VP9A 5DTQA 3UWPA 2AS0A 1I4WA 4FZVA 3TRKA 3UJ8A 1JSXA 4HTFB 1O54A 4GC9A 5B1SA 2K4MA 2HTEA 3LL7A 3I5UA 3E8SA 1QZZA 4POOA 1XCJA 3KQOA 5E9JA 1KPGA 1JG3A 3OZTA 2ZWVA 2O05A 5CVJA 3C3PA 1RI4A 3FTCA 2EG5A 2ZZKA 1QANA 3ELWA 4MWZA 2IGTA 5T6BA 1NW6A 5DSTA 5EVJA 4RVFA 2XYVA 4CTJA 1TW2A 2GPYA 1KXZA 5DRTA 4E32A 4C08A 3UFBA 3FUXA 5DM1A 3GDHA 3QOXA 3SVZA 1V39A 3G5TA 1O9HA 2QM3A 1KIAA 5IH3A 2WA2A 4U7PB 5EEHA 2ONYA 5FHQA 4ER7A 1AV6A 5GWXA 5KQSA 5F2OA 5GOZA 5HIMA 3CGGA 1P39A 3FYCA 1R74A 5DM2A 5K01A 2ZIFA 3EPPA 3LGAA 4A6EA 5GINE 2NNWB 1WG8A 3LDFA 5HFJA 2GS9A 4OA8A 5HIIA 1F3LA 3EMDA 5DXJA 3B3JA 1QAMA 2CMHA 1I1NA 1R8XA 2ZIGA 3DLCA 2OXTA 1RJGA 5F2NA 3FPFA 1MJFA 4WXHA 2ZBPA 5LQAA 2PXXA 3CJRA 2NP7A 3FZGA 3GCZA 2AN3A 2O07A 2PWYA 5EMJA 1NV8A 5LSAA 2ORED 3LX6A 1NW5A 2OYRA 2YR0A
chains in the Genus database with same CATH superfamily
5KSZA 3LI2A 2GAJA 4RTLA 4R9VA 4JJ8A 4ZCTA 1IWOA 1T2DA 4DV3B 1WXXA 3PXCX 2O2IA 3OF3A 5JT1A 4OX9Y 3G8AA 3NP9A 3F4KA 2WWTA 2XCUA 2XITA 3O0DA 3NXKA 4IIBA 3ROTA 4A5OA 4X8HA 1WZ2A 4KREA 3AP2A 1G20E 4I4TF 1W4CA 1YI0A 1J1IA 3L43A 4QLAA 2WT8A 4R1SA 3LD9A 4G2NA 4OI4A 5AUQA 2FMXA 3L6UA 5AVZA 2NAFA 2RFLA 2PAFA 4MS4B 4L8WB 1CLUA 2VS1A 3K4PA 4IS2A 4CLDA 2BFEA 1TQ6A 3D3NA 4MR9A 3WA7A 2NX2A 3K05A 3ZDZB 2CVHA 3U9SA 4EUNA 4FHCA 4GUAA 1U7HA 4Q3DA 1JLHA 2VKQA 4WXRA 4KRGA 3WKAA 4D43A 2PYIA 3DO6A 4QECA 3TEJA 5EGSA 4GU5A 5KCZA 2PUAA 4TV9A 2X5KO 1U5AA 2DZDA 3I5MA 3WHIA 2PLWA 3IVAA 2IOYA 2XGGA 1N5MA 5JZVA 1B93A 2H06A 1UJ4A 1IM2A 1QO0D 5HKOA 3KDPA 5AJHA 1HDOA 4MUYA 4UBJA 1NQ5A 1CEEA 1NQXA 3BVPA 1ZNZA 3KETA 4ZA2A 1W85A 3E3MA 1SCAA 1ZSYA 2PX5A 2VCYA 1RMYA 5BO5A 2GF9A 4E33A 3UC5A 4E94A 4N49A 5DI9A 2Z5LA 3NAQA 5JSQA 4PC2A 1MA0A 1XL0A 2W2LD 4U7WA 1YZFA 2HRDA 3GFSA 4R83A 2AOTB 5FP0A 1DWOA 1W94A 4U3JB 3OFJA 4PYOA 4BFYA 1QH0A 2QTAA 1EWVA 1NE2A 4QPCA 2WR8A 3T7KA 1E1CA 5JAZA 3R8XA 3FB1A 3WLLA 1FE8A 3EUFA 1TM4E 1CQWA 3BA6A 4V0KA 2NSLA 2Z4TA 2IZ5A 1YDEA 3I4CA 1P31A 2Q0QA 2LWIA 1T1SA 5CNMA 2O5RA 2H6EA 2WZQA 1SU4A 4FBLA 2FEAA 4HO1X 5IC4A 3O47A 3M7IA 4WT7A 3RKUA 2RGNC 4X6UA 5BWOA 2XQVA 1M54A 2I2DA 5ILQA 1K97A 3UJHA 5JU6A 3OZUA 4L4XA 4NC9A 5H80A 3R3SA 4ZKEA 4YY3B 4N0PA 4G1VA 1QQ6A 4B6EA 4PN7A 4ER3A 2ZSIA 3SC4A 3MHTA 4PNHA 1IOVA 2RMKA 3Q88A 3W1VA 4C7OB 4NBTA 4JU8A 3E0XA 3C3BA 8AT1A 4X71A 5CNIA 3H3FA 3R6WA 3U3JA 3V97A 5IT0A 1UBEA 1T24A 4CMKA 3HK2A 2P40A 2GEJA 1KYWA 2YJZA 3L3BA 2I9KA 1ESZA 3I12A 1HA3A 3C6KA 3ORSA 3Q7TA 4OQDA 4FVTA 1MTZA 4N5DA 2QRUA 2VT3A 4QFBA 5CTAA 2EFGA 4JI4B 3KD3A 3V2GA 1EEXB 4Z6KA 5CNJA 1X9IA 4DLUA 2CGEA 1VIYA 2I6FA 2Q7XA 1MAVA 2ZB3A 2PVSA 2VXCA 4EO9A 1CRZA 3QVSA 2BLNA 3ZVLA 4Q1CA 4UNPA 3WO0A 5MN6A 2WJWA 4JCOA 5J2TB 1YS9A 1XHLA 4XM1A 1R0YA 5JSYA 4LYJA 2VBGA 3T5DA 1GUZA 5AVUA 3M70A 3PB3A 3NTQA 4KO4S 5F9FA 4EVIA 2F7SA 2NYVA 3RW9A 1W581 2W4MA 3N07A 2VCEA 1DX9A 1O9GA 3DZGA 5BOSA 4FSXA 2BEUA 2VAXA 1ZIYA 3BBPA 3KKOA 3A11A 2BGMA 3WRYC 1N0WA 1DQRA 2G9UA 5EY5B 3BXPA 1ENOA 5TC4A 2R9VA 2ZI4A 3H4MA 4NCJA 3ZWMA 5LM3A 3S8MA 5KMGB 1NN0A 5TS3A 1EESA 2VSXA 1MEEA 1WV1A 2PXHA 3D7MA 3SI7A 2GZRA 4GXTA 1SU6A 4M76B 2QL7A 3CW2A 3K96A 5LUAA 5EZ6B 4JOCA 3UQZA 1ONBA 1PZNA 4B35A 3GLFE 3SOPA 3AUKA 2Z1MA 3QSGA 4KXMA 1MO2A 4MI1A 2NU9B 2DH6A 4E30A 2VZ0A 3DPSA 3U4HA 3P9IA 1O0BA 2WTUA 3R5FA 5D6NA 3R76A 3W5SA 4DA4A 1HLFA 4LZZA 2R84A 3ADDA 4FE4A 4HGNA 3Q1KA 3E6AA 2W5UA 5AVJA 1D8TA 4JNCA 2QBYA 3HGMA 5BSEA 2OO5A 2Y1GA 1G2PA 5KJFA 2VQ3A 3RT1A 4Q4CA 1L1EA 1HWYA 2W6NA 1G5FA 3CZCA 3DPUA 2CXPA 3EGEA 3FKSA 1YFKA 2GERA 2ZSDA 4Q9KA 1OLSB 3Q0TA 3ZWDA 1HURA 4JB8A 4LFAB 3W3AA 1KQNA 5KHOC 3A2MA 3T7JA 3PLAE 1I8TA 3GFOA 1YU9A 4LDAA 1Y9ZA 3AERA 4ZARA 3TW8A 3HDVA 4KQKA 4S0XA 1ADBA 2Z58A 3K15A 3WL8A 2X9QA 3VYUB 2XGMA 1J0EA 1EM8A 2OESA 3AFIA 3BB4A 5FTJA 4UBLA 4UXJA 4CV2A 2M6SA 4D3SA 1BJKA 1LGYA 1ZONA 3EDCA 1EVEA 3QI2A 5D6OA 3T4EA 4A36A 3II6X 2Q7DA 5A0VA 3WGQA 1UR5A 5K05A 3GT4A 4R0VA 2JGJA 5D85A 3A4MA 1CLEA 3EFOB 3MCVA 3R7SA 5HKAA 3BZUA 5K3FA 1DC6A 2XOKD 4FS3A 4H18A 4P84A 4ZHQB 3NVDA 3RUHA 3ADPA 1E8MA 1HSZA 1ORWA 1WCIA 1U7PA 1GGJA 1W52X 3CT4A 3L0DA 4FKZA 4LXHA 4H31A 4S35A 3SXPA 3VVLA 1IXYA 1FZQA 3N86A 4LKRA 1WQ4A 2VAWA 4M88A 2WYUA 1JFFB 2XA2A 4MS1A 4Q03A 4REQA 5IC5A 2IV7A 4DEVA 2BFOA 2IU4A 2QIOA 2R7KA 1YTLA 2Y99A 2XNHA 1W1IA 3IAHA 3OU7A 1GIAA 2I78A 4K28A 4K9NA 4AWBA 2ONJA 1T2NA 3JARA 4AMVA 4PLPA 2G1UA 3GPLA 2JG3A 1ZIOA 1C0EA 3WBFA 5CH5A 3OZWA 2G70A 4N41A 3CQ9A 5F52A 1V1JA 1MQSA 3EHDA 5P8WA 2VHWA 1M73E 1SZCA 2QTHA 1YR3A 1U8CB 3MQ4A 2HRRA 3BKWA 4LOIA 3SIXA 1BEUB 1TCBA 3PITA 4X7PA 1B8PA 1SZJG 2YICA 3T1OA 2ZI6A 2F3RA 2DY0A 3TE6A 2GJ9A 1M34A 4G26A 2I29A 4EA9A 4FEYA 2YV1A 5K3EA 3OIDA 1P6UA 3COYA 1YS7A 5BRAA 3UM9A 1TADA 4RHYA 2QJFA 1P7YA 3RO7A 3DJFA 1Y6FA 3EIWA 5A4IS 1XTVA 2WDPA 2VF8A 3VNAA 4C4ZA 2XGSA 4O08A 3UQYS 2AOXA 3P0EA 4QA9A 1A5AB 2EW8A 4OHWA 4OM7A 3WAJA 2KE5A 1NC3A 2FPPA 3PFCA 3HLKA 4Q1FA 2AEFA 3SXUB 5KNCH 5CCBA 1NJ5A 2Z6QA 1DT3A 2J3HA 4UEKA 4IHJB 3WYCA 2Z2IA 1AGRA 1OV4A 3NC4A 3NTRA 3JYPA 2RB4A 1ZZGA 4FILA 3V8QA 5CCXA 1QO9A 5M04A 3L4BA 4TRJA 4EECA 3KDSE 5EJ7A 1JDUA 1YKFA 4YJ2F 3SE0A 1QGDA 1E9CA 2XE4A 3R5TA 3ZU3A 4WUTA 1SU8A 3Q4GA 3ND8A 4QGFA 4EFDA 3PVSA 3THYA 1KI9A 1QDUA 1QH9A 1XZIA 4JC5A 2C0CA 5A3RA 1LK0A 4IHQA 3QSYA 3H2BA 1ND6A 4IH4A 2B37A 1MX9A 4NAVA 2W0MA 4GMDA 2EJVA 3HJBA 3QEMA 5A05A 4AJJA 2OXEA 1OX4A 3E4CA 4JJEA 5AUOB 5IKXA 1HFJA 1WVMA 2RHBA 2WJ6A 3R7FA 2IY8A 1Y48E 5LQUA 2YIMA 4QYSA 2X8JA 3ZZTA 3DMFA 3NIBA 2ENWA 4EDFA 3LY5A 2BGLA 2CYAA 2YMPA 4LV8B 2QF7A 3EQZA 4MLZA 3JVUA 3VZRA 4HS9A 4OQNA 1XMPA 1JHUA 1Z25A 1KERA 2Q5IA 3DTVB 2BIFA 4NNOA 1E6MA 3L5OA 4Y2VA 4BFUA 1UDBA 3RAFC 3EARA 5EZSA 4CQMA 4RM3A 4LE1A 1Z2OX 4U6NA 1KZ4A 5DBIA 4ACAA 4CM4B 4PLWA 1BDJA 3E1SA 3N7AA 5K0TA 1NTRA 2G5PA 3RTBA 3DONA 2HHCA 1YULA 1XZGA 3RK1A 1X7HA 1N1GA 2Y8EA 4ID9A 3U4DA 3BX1A 4OFBA 5CEEA 3E48A 4N7BA 1EWRA 4LJRA 2IELA 2HNKA 5CB4B 2R6CA 1OFIA 4FPXA 1SHJA 1BQ3A 1YGPA 3AY6A 1GDDA 3RVNA 1X7ZB 1EFKA 2XQKA 3O93A 4YFVA 1T4MA 1VLJA 2DHEA 3CLTC 1G7SA 3LCUA 3H86A 5ELMA 4PS1A 5H83A 2J9GA 1NOJA 4WI1A 3S29A 1FCJA 1U8EA 1Z18A 4F96A 3GVXA 3ZV5A 1TA9A 2R8YA 1P18A 4DKXA 4FJ0A 3MRVA 2PL5A 3TDKA 3MELA 1UM9B 2C4MA 1GPDG 4JSTA 3BL8A 3U7GA 3LGXA 4OKNA 4ITVA 4UCFA 3BE8A 5BUCA 3JPYA 2Z2JA 4Q5IA 5ANRB 3NV7A 1PTKA 3EE6A 5DBHX 4A6DA 4B4DA 3DLHA 5AMXA 3IQFA 4FINA 4UOQA 1GL6A 1SKQA 4AVYA 1IBMB 4BFCA 2ZANA 3H99A 2ZATA 1YDWA 2ABWA 4N3GA 4RQAA 2WJVA 4YC7A 4DQLA 2DR2A 2F8TA 2QUKA 3EZ2A 3J7AC 2JGAA 3VPXA 2PUBA 3SJZA 5L3ZA 2D62A 3AI2A 2WJPA 1H2XA 1AN0A 1L8QA 2PZEA 3R3UA 3BGWA 1UM8A 4MPJA 2JIRA 3EPRA 5H3HA 1T9CA 2DSTA 3NHYA 1TRKA 2W9XA 4FHDA 1UPBA 1Z7BA 1FUKA 2Y6UA 3UW3A 4BLPA 3A4VA 3U4QA 3ZI4A 2R11A 1RQ7A 1PQYA 4EFKA 3A1SA 3ZVRA 1S3SA 3DOHA 5G4KB 3IAAA 1V47A 3PKJA 1U1CA 3FCXA 4LISA 3OOSA 4IFEA 1PF7E 1XTJA 2J7KA 3L1KA 2GCOB 1DINA 3QVXA 2PZJA 2LP4Y 5HBRA 1Z17A 3WKCA 5MN5A 1NLFA 3TBKA 2GK4A 2QDKA 1C7QA 2E82A 3BFJA 4Q4DA 1Z75A 4GEKA 2RDMA 4GR4A 2BFFA 4CKBB 1B2LA 4U02A 1K89A 2GN0A 2Y4NA 1BG6A 3SSOA 1MNAA 2A5YB 4IW3B 4UM9D 2OQVA 1V2HE 4RDCA 5ADUS 2IEYA 3OF5A 3MWDB 5I47A 4UMVA 1DQZA 3BHNA 5FYQA 1OGIA 2R6DA 1MVLA 3BD7A 4HUJA 4D45A 4L8LA 1N9ZA 2W2OA 1VJ5A 4H7EA 3V8RA 3NBAA 4H4DA 3KJZA 3ORHA 5FL3A 3M9WA 1H8HD 1SC1A 1XEAA 2CXNA 3OE7D 4FX2A 1RYZA 1SKBA 3FWHA 4KMOA 2HF2A 1K8QA 3I2IA 4JEHA 4MGZR 4O29A 3W6PA 4D56A 5CA1A 4RETA 2O5CA 5CX1B 4XGIA 3PGA1 3PPXA 1NU6A 4HAUA 1UBUS 1JJFA 4JU9A 4W4TA 4B33A 3IC5A 1S8AA 4MVJG 4D3DA 1PX2A 1U98A 4G89A 1F6BA 3AFNA 1MH9A 2QK4A 4ARZB 3VPGA 4J0KA 2FDRA 5JO9A 1YK0A 1BFKA 2DQYA 4BO3A 1OJLA 2QWXA 1PKEA 1QYXA 1M1NB 4FDTA 1CEYA 3H2KA 1F8XA 4H9GA 4PG5A 3U7QA 4JROA 4DREA 4P7FA 4WADA 1BVHA 3B3QA 2VN8A 1YZTA 1ZITA 4MIEA 1A5SB 3ENNA 5IEJA 2V6BA 1YH3A 2BFMA 5J1TB 2OD7A 1V7ZA 2FCAA 5T41A 2MHCA 3RGWS 2JBHA 4AYXA 3U1VA 3C24A 4Z4HA 2OQ2A 5JCJD 3RD5A 1SBNE 3I2FA 1SIBE 1KJ9A 4X97A 1SUEA 4AICA 5JFTA 3IESA 3RFFA 3B52X 1BE8A 4J1NA 4L76A 4OQYA 1JIJA 3MWJA 1UT5A 1HBJA 3P7MA 1YA6A 4HTFA 1M1YA 2G5GX 3FLMA 3GNSA 4FUTA 3AR6A 3ZIAD 4OXXA 3X44A 3IAXA 3HE3A 4DLTA 4NCAA 1CCWA 4DIFA 1JDZA 4QUHA 3TRKA 3UJ8A 1R9MA 1G9SA 1QJCA 2H63A 1TIKA 4GC9A 2VKTA 2HTEA 2W37A 4UW9A 3ZK8A 4BQEA 1QZZA 3ZHTA 1IXZA 1W35A 1XCJA 2WG0A 2DUMA 2XTZA 5CYFA 5AKYA 4BFSA 5KTNA 2IXGA 4E14A 2JASA 1QTQA 2EQ5A 2LIPA 2ZZKA 3TLGB 4GPAA 3UGTA 2VUIB 1RKQA 4BAGA 5FV7A 2QRQA 3FFWA 5EUQB 4QJ3A 4C0QC 3HLYA 3VPCA 4MKXA 1GNVA 3HZHA 3GDHA 2JAOA 3AI7A 3CSDA 1MG5A 3IMFA 4YP5A 4YRJA 3T9EA 2PZLA 2GRUA 2IHBA 2A8YA 3JQPA 5GWXA 1UT8A 1C3EA 4YJDA 1YIDA 3VHXB 4I1UA 3DDNA 3WGUA 3THWB 3ZHBA 2OMKA 1AS2A 1J0AA 1ELOA 4DY4A 3NOXA 1O5TA 4A15A 5HFJA 2R1VB 3MCUA 3K94A 4TUYB 4TV9F 1HFEL 4PW0A 1JEJA 1PJBA 3K7EA 1QOZA 1KEZA 3DE7X 4M2LA 1W6UA 4XA8A 4UQLA 3K35A 4BRSA 1CP2A 1VSUA 2C4VA 3JQAD 4DJDC 2V97A 2FG6C 3EEFA 1I7SB 2AN3A 2DLDA 2XIQA 1L4NA 4HEHA 2ACWA 4LXGA 2VOJA 3BJIC 4LDRA 5DCWA 3RQIA 2HSJA 1NJ2A 5F78A 3T3HA 3PQ3A 2QD5A 1WHTB 1E94E 4M0MA 3H1EA 2QT0A 1MFPA 1J0BA 4MUBA 2P3SA 2GEBA 2DQZA 5DX1A 4GXRA 3X0DA 5LCXA 2V1UA 4D8YA 2B4QA 2CHQA 2M9MA 4FKBA 1JU4A 2XBMA 1GFSA 2AI1A 1L4KA 1T3LA 4AJEA 5JH7A 1H1LA 1KDOA 1J39A 1QONA 1X1BA 2DHDA 2FWIA 2VC2B 2XOXA 3JZDA 1NF8A 1M6NA 3BREA 3M2PA 4TVBA 4EFNA 2CEKA 3P1JA 1WB5A 1ZC4A 2OV6A 1QJ4A 3RUAA 4F21A 5CYOA 3HRIA 4B83A 1NPTO 3GLHB 3MS7A 3OFKA 3TLBA 4B45A 3A58B 4DA0A 1DCTA 4OH7A 2XVXA 4YBZA 5I7FA 1GLGA 4KIFA 4YMGA 3D4BA 3K0FA 3ES9A 1XQ1A 5KTOA 2QW1A 4JIMA 3UK0A 4DOMA 1Q0RA 4OQZA 2WU0A 1LI5A 3E15A 1EFDN 2B20A 1JG6A 2NVWA 3H84A 1AQLA 2OHIA 4KQXA 3O8RA 5HF5A 2AUNA 1JHAA 4KFRA 4PSUA 4REMA 4UEOA 4PHGA 1CUAA 3H6HA 4Q4JA 4YXWA 3EJ6A 4Z9XA 4FFLA 1O8CA 4UTXA 4WZAA 5G40A 1EUZA 3FCOA 3ORFA 2FWAA 1Q14A 3I04M 2QP9X 1TPYA 2FR8A 2QENA 2RGUA 4TL9A 3UAOA 4F11A 2Q5FA 2HL6A 2OAQ1 3PDUA 1FMFA 5D3MA 2VH2A 4BBJA 1S0UA 1S01A 1QNLA 1SVOA 2WYWA 3BM5A 2EC5A 1VDZA 3DO5A 5AOVA 4EVQA 4OXYA 5DH9A 4X9XA 3R5HA 2YVLA 1TC2A 4XKJA 2YFYA 2GDZA 1P3DA 2PL9A 4XQ9A 3PTLA 5HQ3B 3ICQB 4HRVA 1R9JA 1U2DC 3COJA 2WYHA 2LW7A 1EQAA 2WEKA 4OFWA 4QTTB 3V1KA 3FNHA 5J23A 1BX1A 4RQBA 1P7VA 2YCBA 2P2ZA 1KIMA 1Q2XA 3BCHA 2HK8A 1NKTA 5EMLA 1I4LD 2Z57A 5AKEA 5C18A 1JE1A 2FQ1A 2AEMA 2H9IA 3ZW7A 3GRKA 4QU8A 3ZY4A 2CNBA 3IKLA 3NHBA 1VRWA 3TQHA 4CF6A 4EW2A 2FSIA 1X7GA 4IJ5A 2Z2XA 5ALLA 2XB6A 1NHGA 4ZK2A 3VU9A 5KYXB 2XYPA 3LV8A 2VJMA 1DC7A 3DOIA 4TMYA 2IPLA 3HHPA 3ZC3A 3HKCB 1MOPA 5ALIA 1HKHA 3U7IA 1B0AA 1VDMA 3H3JA 1QDLB 3SK0A 1ZM3A 1BXGA 3VR6H 2DPYA 3JALA 5IUNC 4TYPA 1P3JA 3LYHA 2GNPA 3FTFA 1WMBA 2ZI5A 3M83A 4E31A 2NO9A 3H9BA 1DLIA 4TSFA 3ZCTA 3DMYA 1V3UA 1SBTA 2YXEA 2HUPA 3BHMA 2XHZA 2VP6A 4GBGA 2JVJA 5DYYA 5F2KA 3SM9A 3TGPA 1J2TA 2GT1A 1U2SA 3RYFA 4ZI7B 1FW8A 3G85A 2HBZA 3B9PA 3OUZA 3AVVA 3A6KA 4BNWA 3LWBA 5LPNA 4JLUA 1ZSNA 1HQCA 3A3NA 4BEVA 1XO1A 1YRQA 3H1AA 3M3DA 1N6IA 4EARA 1O6BA 1F17A 2ZYRA 4WCFA 1JG1A 1R0CA 4ND2A 4ZCPA 1YZUA 3RNOA 2IVFA 1SXJD 3B85A 5A3QA 5JXWA 1I1QB 3LVBA 2XD9A 4ZOAA 1ZC3A 2PT7A 3LLUA 5AM5A 2VQ6A 3TZKA 4BJ6A 4DYHA 4PSCA 4O1MA 2HA5A 5GAJA 3GT3A 3O1JC 3OHPA 4FYPA 4PZYA 3R9IA 4ACBA 2WIGA 4ARCA 2ALJA 4XPIB 4QJIA 2MR6A 3W06A 1T5TA 4P0QB 1JNXX 4UAVA 3VUEA 2YUIA 1MD9A 2NUAA 2VO1A 5D5PA 1XDBA 2AIRA 2I2WA 3OJWA 3U09A 3JAMA 2PRSA 5BN4A 4AX8A 2Q41A 2YWGA 3REFA 5KOJB 2PBLA 1XZQA 1CUWA 2XE6A 2OD2A 4U0KA 2R87A 3PCRB 3G5UA 1VRVA 3CWCA 1R7RA 4MR7A 2CB9A 1QF7A 4HH3C 4EYGA 1DU4A 5JNRA 4KVAA 2W2KB 1ODTC 4NFHA 2YVQA 2DTEA 4TMKA 3HZRA 1LS6A 3ZI0A 4RLHA 4BX8A 1KBZA 1OYVA 3H3XA 1ONPA 4QUEA 2SKCA 4GBJA 2EL9A 1OH5A 1N6KA 3IL2A 3EPJA 1JA0A 1AKWA 3GUZA 4RTMA 4A27A 5EIXA 5C3MA 1SUWA 5IF9A 5C7OO 4OHYA 3HQ4O 3MB5A 2ZQYA 4L78A 2ZDQA 2IYPA 1QLWA 2C2KA 1Z5PA 3PICA 2GN4A 4W5OA 3JASB 5CU7A 2CLFB 3A1TA 3D5QA 4K6CA 5LZ4A 1CRQA 3CRZA 4LC0A 1G64A 3MPUA 4RNCA 1QHXA 2I3BA 3G9ZA 1YR7A 4HH1A 2CLIB 3MGBA 1M2WA 2P9EA 4FFOA 3KTDA 4EJSB 5DBEX 3KZXA 5G3YA 2XWBF 1BIFA 3ZWBA 2WD9A 4MUNA 4BX2A 1ZGGA 5AIBA 4F93B 5CLLA 3T5AA 2R7AA 1V8BA 2W98A 1JAXA 1TJ3A 2PS0A 1DFHA 4WMLA 3WWPA 1R18A 3U80A 2BF7A 1XV5A 3KEGA 3HCCA 1GEEA 1D6NA 1QKIA 1T1IA 2QE6A 4ZEWA 3WP0A 5BSWA 3D31A 3Q3VA 1N36B 2XI4A 2FG7C 3QTLA 4FFMA 4D8TA 1VIVA 3QU7A 4RTQA 1NVEA 1DLJA 3CNHA 3GOQA 1FU7A 4MPDA 2EX1A 4BNKA 1FSGA 1NGSA 1P7PA 4FYYA 4O4LA 2KLBA 1T9BA 2R7NA 3CPHA 3K9QO 1BE1A 3O75A 1ZCFA 2ZJ2A 1YAHA 2JKYA 3IQXA 4OQFA 3GVHA 1H3EA 3PLNA 2JJMA 1PJAA 1J2JA 2QS9A 2V5AA 3EBOA 4H7KA 4Q4HA 3KFXA 3RT9A 2JPDA 2POCA 3LXUX 5B2EA 5L4NA 2QUBA 3GDGA 1E64A 2A7XA 1M6YA 3L46A 1T6XA 3OZRA 1TCUA 3HDTA 3OOJA 1JQKA 2OM6A 4J0QA 1N3BA 4RY2A 4NCNA 3RFUA 2RHLA 3ESDA 3FMFA 4G09A 3FROA 2RI0A 3GZ4A 3CO5A 4KI0A 5FNVB 5B53A 1GRNA 1YOBA 2I2AA 1M67A 2W58A 1SUDA 2DQ4A 4B4VA 2XCSB 4G1FA 4PXAA 2ZS8A 4F84A 5EIBD 4JITA 2ZJBA 2JCXA 1GSAA 1EGAA 1TKRA 5E7JA 2BFBA 4KWHA 4UAGA 1VXOA 2CMDA 2FSHA 2YYYA 3A7EA 1TA0A 5EP1A 1RJ9B 3BWBA 5CEJA 1N6RA 1T8RA 2DHQA 3UHOA 3UK2A 2JCBA 3ED1A 4G8CA 5ELXA 1KDYA 4TL7A 3O9VA 4HPXB 1XTZA 1J07A 5CVCA 3WKDA 3HP7A 2EJUA 4QYXA 4ZOBA 3RLFA 3AZPA 4KQIA 5CDUA 1O0CA 4PG4A 5FFNA 4MWCA 2PUHA 3OIGA 3B3FA 3K0EA 1K92A 2EFEB 5K3AA 2QL5A 3MBKA 1NBMD 1E3QA 1XMIA 1P3Y1 2B99A 5JJLA 5T8KA 3VH1A 5IZCC 1E32A 4YAJA 1PWEA 4LTMA 4X84A 4AKTA 3WL3A 1NDHA 1FSPA 2V59A 2X9GA 1W73A 2E3JA 1PW7A 1T0UA 2CMKA 2VDUE 3D4NA 3DULA 3EBLA 4R9UC 5DW3A 1FSSA 3OCJA 4AUKA 1X14A 2EWWA 3A9WA 4ZAZA 4DB4A 4ENPA 1BGWA 2OBNA 4FYWA 3EOAI 5DM0A 2XDYA 3ANYB 4G4SO 3R41A 3EGVA 4PYRA 1P7WA 5IKEA 3EF3A 2ZIVB 2ONZA 1R64A 3LC0A 2C2MA 1NUTA 1JILA 2ZBQA 2NUBA 3UPTA 4DV0B 2WM9B 5JXHA 2EATA 2AW5A 2CXUA 1QU3A 2QLMA 3KKMA 4B6JA 4OGGA 1ZY2A 3R6GA 5M29A 1ZJ6A 3LYLA 3A2NA 7REQB 4DV4B 1ORTA 3TKAA 2RGNA 1A4RA 1AK9A 3MMPA 4O2BB 5AXDA 1KH1A 4HVTA 1TTQB 3PR3A 3PJFA 5F21A 4B0PA 1KK0A 3ZE6A 5FBVB 4EI7A 1D2NA 4LTNA 4G81A 4DW8A 1AQUA 2PS1A 3O4GA 4WNAB 1OIXA 1MKYA 3NG1A 4H17A 4L4YA 3OQPA 4P5EA 1TZJA 4YP1A 4DIMA 2DT8A 1OZ0A 3CNQS 3ETLA 4TM8A 3S44A 4KXVA 1EFRD 4EG0A 4R51A 4D3YA 2OGZA 1YV9A 2FXIA 2VEOA 1J5EB 2CJWB 4U2KA 4V0ME 4CV1A 1NVKA 5ICEA 2BFCB 1P74A 3FLAA 4K05A 2Z8ZA 3BL5A 3UJDA 1GTZA 2JD2A 1H2FA 1PJ8A 5KNDA 3KSBC 4CG2A 5HVNA 1L4YA 3PJEA 4HNAA 1UKAA 2OECA 1CQZA 3AW9A 4MQEA 1PZGA 3G89A 1EMDA 3EIOA 2WU1A 5J40A 1WCXA 2Q1UA 2N3ZA 1S9HA 1WXHA 1R6TA 1XTBA 1GG9A 4F9FA 1GPUA 3E5NA 3TFOA 1IXSB 5BNTA 2ICAA 2C9MA 3DW3X 3BDIA 5G0TA 2C78A 4M9SA 3FZEA 4P4UA 1SQSA 2Q2NA 2HSZA 2JGEA 1F14A 1RBMA 4HLDA 4TLEA 2BELA 2Q9BA 1NBWB 4ZALA 2BFWA 2QI9C 3LFTA 3GGCA 3UJAA 1RPTA 5LLTA 3SYRA 5JJBA 3QZUA 3KU4A 3CRMA 2QRVA 5CA1F 2VHQA 4YP9A 3SLKA 3UV7A 2VATA 3WE7A 3KQUA 3QVGB 2DBZA 2IOFK 2D0IA 5LU9A 4ZREA 2GF0A 2O0HA 3DZDA 2ZBEA 2UVPA 3VU1A 1ZUNA 3ZZNA 1FUUA 3R23A 3NHJA 1FDSA 4FKMA 2FETA 1R9NA 2W6PA 3GFFA 3OZEA 5DP2A 2Y1DA 4OLJA 5BORA 2HA6A 3GJ0A 4XTRA 3UV3A 4CTNA 1VHWA 3NJ4A 2D2FA 1IZYA 3JQGA 1O8BA 1L5LA 4AS2A 1G4HA 3KB2A 1P17A 3D6HA 4WTOA 3HUUA 4A3SA 4M98A 3W2IA 4G4GA 5B3JC 5D8DA 4A26A 5I3CA 3LCCA 3FNGA 3PRYA 4PG6A 4LY9A 4RTPA 3TZLA 1GEGA 4B3TB 3RSOA 2B35A 3RE1A 4DUGA 2DUUA 4C2BA 2FOXA 2YYZA 1EU1A 1V5IA 4J0EA 5KYYA 1JEQA 1OVGA 3ANXA 3G2QA 4LJ8A 5TRTA 3IGFA 3SEAA 1OA0A 5TMBA 3PDHA 2XZTA 4HRXA 4KR9A 4DG8A 1FNMA 3HXKA 2QRNA 2R6ZA 4NONA 3U3XA 4MCJA 1X1DA 2O23A 2Q62A 5IDWA 1SULA 4GR9A 1GP2A 1Y80A 4JMPA 4PBTA 5DWDA 4DR6B 2AE1A 3H1TA 2ZPAA 2Q1YA 1FYEA 3DS8A 3HY3A 5CDGA 1RQXA 1MIOB 3WLEA 2Y71A 1BRMA 4HL6A 2CLHB 4EEKA 1IN5A 1KSGA 1YXMA 1USUA 2WE8A 1E7MA 1GKUB 2WWGA 3VAZA 4JI7B 3ZTWA 4PRKA 1ZJYA 2AK3A 3WNDA 4A6XA 2F3QA 4QOEA 3QPWA 5G2OA 1R6XA 1H2AS 2G6BA 4BVJA 821PA 1G8HA 3HR4A 3ISJA 3ZZMA 1J6UA 1KO8A 3PUJA 4R2MA 1LUAA 2J5RA 4I7EA 4DR5B 4X1IA 3T5CA 1ZHFA 1I7LA 4G0OA 4Q3BA 2AG6A 4GVXA 3O8BA 1K7XB 2WZCA 1RM3A 1V8ZA 3CJQA 2DERA 3OJFA 3VZSA 4YV2A 3GH3A 1ULBA 4BE4A 4EHBA 2WF8A 1ZXXA 5JHGB 2CUKA 3NRBA 2ZRPA 5CTJA 4ZI3A 3W2FA 4V0LA 2DECA 1HORA 2PSSA 5DLPA 2O52A 3NU1A 1XQWA 4MTLA 2ZSBA 2JLQA 3HA7A 2PTHA 2X42A 3O83A 5YASA 5IH7A 4B40A 2F4VB 1BCSB 2AJBA 3FXAA 3CKLA 3SDSA 4FJ2A 4NF2A 2CXHA 3S68A 4FZVA 1OC4A 4GRIA 4AJ9A 2I76A 3W3ZB 4YJFA 3ENKA 4HAWA 2QXTA 1UF9A 2Z1NA 2VYND 4Q9AA 2BBTA 3TR5A 4PR3A 1G20B 3KBBA 2GEVA 3G2KA 1U9ZA 1G63A 1Z08A 3AEUB 3GA0A 4A91A 3KL4A 3QPBA 1J24A 4JI2B 4CMAA 4JQSA 4F92B 2HNAA 3Q5EA 3TB4A 2OVBA 5JH7F 1NPYA 4R0NA 2YJTD 4E32A 4P92A 1QP0A 4GPZA 5FT9A 4J49A 5B58T 1NJFA 2W83A 3HVUA 3KL2A 2JNWA 2PQ6A 2Q4TA 2I1WA 3SS9X 1XVTA 3R3YA 2ONYA 4BOYA 4F4HA 4M8KA 1MNQA 1NYLA 4I6EA 1F7UA 3EXIA 3MMXA 4MV6A 5LBTA 3NTLA 3GI1A 5TNXA 2LCFA 3V9AA 2RHWA 4ZJYA 2GPAA 2C5SA 2ERYA 3JZAA 4KX3A 1Q7TA 2BUAA 5D3ZA 3QW4B 3G1UA 3V32A 4FLFA 4OMFG 4CKXA 2PZBA 3NB0A 3TSOA 5DXJA 3BYZA 2JFNA 3V5NA 5DN6D 4TQAA 2BDTA 2ZIGA 1Q21A 1NJ6A 4JQCA 2A9KA 4F38A 1RJGA 5KYVA 4GX5A 1S2MA 1UQUA 3AOEA 3QX7A 1H6CA 3PNSA 1J2UA 2XXJA 1SD2A 5LSAA 2NU6B 3IBFA 3LOUA 5T57A 5FXMA 3I23A 4LE2A 4NENB 2X6RA 2YR0A 2RE8A 2D59A 2G04A 1DHRA 4EYQA 3RT7A 4KB5A 1M1ZA 1KI6B 1N5LA 2ORVA 2EX4A 4FNMA 4KO8A 4YIKA 5DCUA 1MX1A 2IYWA 4CN8A 3T1TA 5F7ZA 2ZBUA 4RULA 5ADHA 2Q9AA 4GRDA 2IVZA 4OHFA 2IPXA 5FA5A 4LUCA 1E4EB 5C0OE 1W96A 5EZ5A 4KQJA 5I7UA 1CFJA 1JQEA 3EWNA 1RHKA 4F1JA 4YAOA 1MN6A 2O57A 5CVVA 5I9BA 3L0CA 2XDWA 3I30X 2GDJA 1A4UA 3E9RA 5ESXA 4EB6A 1D1TA 1SCKA 2XRFA 1PR2A 3A1EA 3FZNA 3NNSA 1WKCA 5JY1A 2VJKA 4U2CA 1SEPA 5JXIA 4MWGA 3O94A 1YQWA 1E6UA 2IYLD 1SKMA 3KZCA 4FCWA 1D2HA 4MAFA 4RV5A 3ML1A 2BEJA 4D2IA 4EHIA 3BWCA 4P33A 2FPIA 3QU2A 3AVUA 1MLDA 2H1IA 3A0UA 4OJKA 1YOVB 1YZHA 1V3TA 3WDMA 1R0ZA 3C4JA 3E7PA 3OLQA 4QGAA 3LQYA 4WNYA 4D1YA 4ONEA 2XUGA 4A8JA 2WJAA 4CV3A 3WQBA 1HKUA 4L8GA 3IBGA 2FN3A 3T3MB 1JW9B 3OF2A 4Y9UA 1S7GA 4QLOA 3EVEA 1ORRA 3C1AA 1J49A 3ROEA 2PLFA 5JV5A 1FFAA 2NZ2A 3EMBA 1OFTA 4CNBA 1QBKC 3U7JA 1JHMA 4KQ1A 4BO2A 2E5LB 3L4JA 4RD6A 5EIEA 2HMUA 1A82A 2J7PD 2JLCA 3I4FA 3OKCA 5KVAA 1VE7A 1EKXA 4CMEC 5IMBA 2IUUA 4FD2A 2Y3IA 1HK7A 3EWIA 1KJQA 2O1XA 1GV1A 3KVRA 2Z08A 4FGWA 4MYCA 5SY6A 5C4IA 1FNNA 5FRDA 4AKEA 1X8LA 3WMXA 4ZO4A 4HQLA 2XLCA 1DWQA 2AV6A 2X58A 1N7IA 1PT6A 5A4AA 5HEKA 3C0KA 2O2ZA 1OHHA 3M2TA 1N2CA 4JP1A 1IQ0A 2IEGA 4OI1A 5JEEA 3ZBQA 4DC1A 1YBMA 2DBQA 3G8DA 1PE0A 4FGSA 4NVRA 3GJQA 1JN0A 1RTKA 2IFTA 2XB8A 1DC4A 4FMCB 4OX9B 2ZJYA 4C06A 2FJUA 2HKIA 3EFHA 4XLLA 3HA2A 4M37A 2MT9A 2D2VA 1F38A 4QDTA 4DL9A 1PHRA 1XX6A 3GLFB 1HC7A 4PVDA 3SJUA 3UGQA 3ZYZA 1T0BA 2DE0X 2Q1SA 3ZE8A 1GPMA 2P8SA 5HRUA 4RK7A 3CX6A 1V11B 3B5IA 3TAUA 5B7GA 4OQQA 4GZLA 3HYSA 4S1TA 4Q66C 4HUQA 3GMTA 5GADl 2W42A 2BH2A 3OQMA 3LQ2A 3NPAA 2VBFA 1YVDA 2C5BA 5KHAA 4JB2A 1VPDA 4IYRA 2PFKA 2WNHA 4KPEC 2GCEA 2WFAA 3HGQA 3BSYA 4MB2A 1OFHA 1UPFA 2HM7A 1G4AE 2MWMA 1F9AA 3GUUA 4BVAA 4BEWA 1Z4QA 5JW6A 1H4QA 4N3AA 1XP8A 4KPUB 1NUPA 1TVKA 4EYOA 4EGQA 2R5WA 3BK2A 1XD2A 4M9XA 3LA8A 1UAAA 4RUKA 6CHYA 1CUCA 2WWYA 5KDDA 1B4DA 3Q6MA 4V24A 4XIFA 4UHHA 3OWOA 2ZUVA 5E6UB 4JP5A 6AT1A 5NLLA 3V7FA 1TTHA 3CPEA 8LDHA 1O0SA 4QTYA 4LF6B 2BY4A 3ZCSA 1APBA 3HCAA 2XUFA 4J1TA 1V7PC 1YE8A 5LZ7A 4D98A 3QXJA 2ZWPA 4CW7A 1H69A 1L3IA 3EEOA 3JRXA 3FOEC 1QGYA 2A9QA 1Z2AA 1FF9A 2NO5A 4B7CA 1NJSA 2CLKB 2AA3A 2Y1EA 3RC7A 1I4EB 1OYYA 1XTQA 2EFDB 5DHFA 1CEQA 3MWGA 5KJEA 2DFDA 3U31A 4DWJA 1P0PA 4UM7A 1R4MB 4JLPA 1Y34E 2ZR9A 4MYDA 1KDTA 1ILEA 5EHGA 2ZUSA 3WMGA 1F51E 5KYKA 1O7JA 4OI2A 3FCUB 3UA3A 4W7SA 4ZV9A 3THXB 2IS4A 2FZKA 4DHWA 5BVGA 1TM3E 2QAJA 3V4RA 1JJVA 2N1MA 3G7NA 4QULA 4N1AA 4D6YA 2GPTA 2JW5A 3IUJA 4QO7A 2B1IA 2KMLA 3DV0A 3O5AA 4UJ3A 2VPYA 2MSNA 5ECWA 1DBVO 4Z0HO 1O57A 4YAEA 6REQA 3QEAZ 2IH4A 2PMBA 2HFKA 3IP7A 4CLEA 1JKJB 4GP7A 3N3BC 1NXTA 4HN9A 4D8VA 4R8SA 1TTTA 4O4LF 3DZ8A 5BRNA 3WLKX 1SUAA 4I9NA 3OFVA 1EUDA 2JHFA 1JTEA 3CF4A 1NV9A 1QZUA 2B61A 3L82B 4JA2A 4NICA 3PUIA 3UNXA 2XT6A 2XB4A 4EJ0A 3E35A 1EGVB 2QG6A 2VBCA 1UBLS 4HYQA 2HRBA 4MUKA 4FLMA 1R50A 2GD2A 1R0SA 2I6UA 3B51X 1WPQA 4FK8A 4JMLA 1QRTA 5F7OA 1PL0A 2H17A 2O1WA 1DXHA 3RHZA 1JJAA 2B6HA 1B41A 5TQVA 4DUYB 2AKYA 2OD9A 4HVAA 3GEBA 4YCBA 4DUZB 4EY4A 3UBTA 4Z9FA 2WJ3A 2OHHA 3RGGA 1ACJA 3RFTA 3RBXA 3RDPA 2FZEA 1C4XA 2W2XA 4OU5A 3COWA 3RRXA 2BCJQ 1ZM2A 2H1HA 2HJGA 4LTDA 3P26A 1Z68A 1PP4A 1TVMA 3DAPA 4R3WA 5CK4A 3EUEA 1TM5E 1FVFA 3IP3A 5L3SB 1WMAA 1Y8QA 2QVXX 1O4WA 2NQ8A 1XDUA 2WTBA 4MUIA 4UHKA 4DR4B 3ELUA 4J9VA 4UHEA 5TGTA 3GYBA 5TX7A 1RNLA 1FRVA 1GNSA 1Z8FA 2C5LA 2GN8A 1R5BA 3IKJA 3ZQKA 1M76A 3UMBA 1VKZA 1XRPA 2WOJA 3LM8A 4IO1A 3A3PA 1G8AA 1QFZA 2GD1O 3D6TB 4MW1A 4FBGA 1S2DA 2LPMA 3OFND 5CR9A 4R16A 2BTQB 4ZVUA 3CVWA 5AVOA 3PFWO 1U28C 9LDBA 2DULA 1BE0A 2YWCA 3QF7A 4UARA 1QG4A 1TJ4A 3ZDBA 2R4TA 4TVKA 4F4JA 4OQLA 1VLVA 1M7BA 3I6IA 1GUBA 4WN9B 1DKUA 3PDIB 4II2A 1N1DA 1Z0SA 2PWPA 2FGJA 4UMDA 4XW2A 5HG0A 1T34A 1MZPA 2VUHB 2UYHA 4ES6A 4DLKA 1TF5A 2YXNA 3KTFA 4ESOA 4L73A 3CRVA 4Z9AA 3X2EA 1MAAA 4E46A 3UPDA 2E4UA 1QF6A 1UBCA 5FUVA 3KHKA 3LXMA 3HEMA 2O2GA 3IAEA 4WRRA 1T43A 3SC2A 5EMKA 3W34A 4ZJUA 1E9RA 2J9FB 2AW3A 1OXTA 1YDGA 2BF4A 1AE1A 1G2IA 2D7JA 4PSAA 2CXXA 1GAQA 5TQJA 4ZJZA 1G18A 5FUBA 2G1JA 2HJVA 3DKIA 2ESRA 2WT9A 2XECA 2O3SA 2BP7A 3D0QA 2VG8A 5LR6A 4FU0A 4JBGA 4M1YA 4DLBA 5KS2A 4HI0E 4YALA 1A5TA 1V9CA 4BKOA 4IZOA 4B34A 1P4AA 4QLBA 4QPZA 3NDBB 5JZBA 1W88A 4KDRA 3RVBA 4FNGA 4Q6WA 3IUBA 2ORWA 1FTYA 1RPJA 2HYIC 4LGVA 2HREA 2FYTA 4CUKA 2JH3A 3GPBA 3TD2A 5L95A 3CVYA 3KOMA 3W9BA 1FVXA 2HWKA 1M3SA 2Y1FA 3VDQA 4N7MA 3ANLA 1J56A 1FS5A 4FEGA 4C7BA 5CYGA 1R10A 3TECE 3SQWA 2X8LA 1FLNA 1NP6A 2PEZA 3NZEA 5A71A 1KE2A 4D99A 3TB6A 1U2DA 1S02A 4KN5A 3NUZA 1RHRA 1CU1A 1K6EA 3AEYA 1TQDA 3KKZA 1U5BA 3KYDB 2VDNB 3IAM6 3LVRE 4HWRA 4DA6A 2FX5A 1I24A 4B6QA 2HEIA 1JV2B 1HDEA 4FQ5A 2YQZA 3NO4A 3R3JA 3G0GA 4MCIA 3HXTA 3UJCA 4V3BA 1DOZA 1J9ZA 2PSJA 2Q0XA 3L7LA 1I7NA 1ZH4A 3P0RA 2NV6A 5HW0A 1HE1C 4QXAA 1QP4A 1JEAA 4R1MA 3AETA 3HU5A 4WERA 4BMSA 4LJLA 4OKIA 4PCVA 4Z7NB 1N5JA 4AZSA 3BMCA 3CV3A 3EG9A 4RIEA 1EFTA 3LP8A 3ZU5A 1PFGA 3QIVA 4XUCA 4C6SA 3KT8A 4ALMA 4CDRA 2VPZA 3F1KA 3AK4A 4YLEA 4EQ6B 2QLTA 3LPDA 1NYTA 3C97A 3KM0A 5SZKB 4A1FA 1V6CA 2CY0A 2OZVA 3FOAA 5GJCA 3RSHA 3EBPA 1OXSC 5FKJA 1G66A 1RPAA 5CH3A 3OSUA 1YVPA 1HLGA 2GRAA 5FUXA 3OX3A 5AWFC 3O8OB 2UYQA 2PZGA 1QKKA 4F4UA 3R0ZA 1RQRA 3ZE7A 3HUFA 3P97A 4RTNA 1O96A 1NF9A 1BKDR 2C3PA 1RADA 2GZMA 1RS0A 2ZRFA 1EZ1A 2ZB8A 2GBIA 3BERA 4I5DA 5T4HA 1M9NA 4YO7A 3VYVA 1GA1A 3H1GA 3JAKA 3OT5A 4NG5A 3A1FA 4KIUA 4P6VF 2QT1A 2CJPA 3BTVA 1P4SA 3TPCA 1NRXA 4MINA 2W7TA 5C8YA 4BMCA 3AZQA 3K2BA 2HA2A 1LPOA 3ZS8A 4JGGA 1XCBA 1PWZA 3C6MA 4OFZA 2F3TA 2IPMA 3A3YA 5CMLA 1WETA 3UUFA 4BAZA 1MF7A 4K40A 4F8JA 3P2YA 1R0WA 1Z0AA 1CXZA 2WHYA 4FMPA 4NCHA 3HUEA 4JI1B 4OQXA 1QLJA 2C00A 3K8ZA 1VPVA 2A84A 1LZLA 3TDNA 1VJGA 2HO5A 1IY2A 2IP4A 2JK0A 5DHRA 3GEMA 4MEAA 2X0RA 3DUFB 4ZVKA 3C39A 2ZJFA 3NHZA 1UPCA 2BJWA 2N47A 1ZZEA 2YJ4A 4N8EA 1DAHA 5KB3A 5DNUA 2H4WA 3B6MA 3K8QA 1KZ6A 4MVJE 4C0SA 2I7XA 4O0LA 1SUIA 3M81A 4L2IA 4E4RA 1KY5A 3PQFA 4GZ3A 2NOAA 2IXDA 3R5KA 4KV9A 4PLFA 4PPGA 5EHIA 6LDHA 4L8YA 4CU5A 1ZWLA 1RWQA 1X1RA 2VK4A 3JX9A 2J09A 2R25B 3IUPA 4N03A 3TCKA 1FA9A 3CHYA 1CD5A 2QD3A 3MBOA 5KNCD 4CRWB 2XDQB 5JJKA 4IEFB 2GYYA 2E37A 4LGMA 2NU8B 3TX2A 4KRFA 4MGHA 1JIXA 2CWWA 2ZYIA 2F64A 3BWDD 4HOYA 1HT1E 4YQFA 3TTWA 1WV0A 4KDCA 3BT7A 2H00A 3OEHD 4WK2B 3DTVD 3INRA 3R75A 3UAGA 4RGVA 4NZZA 4YCNA 3JQRA 2XNDD 1CUGA 3PQEA 2GPSA 3A6HA 1H8ED 3E84A 3G2LA 5E9QA 1ZCBA 3HGTA 2KWIA 3D6FA 4EGSA 4Q39A 1GXSA 1RRFA 2OCKA 4FCVA 1ZDMA 1ESMA 3RVDA 1U3UA 4H1HA 1YBVA 3DAOA 4A03A 1IMJA 4EW6A 3U48A 3ZXYA 5JCZA 4YRNA 3B78A 1DJQA 3PNVA 3ICWA 3NONA 2Z43A 3AB3A 2ZJ3A 3AESB 5HOEA 1WB6A 1W44A 1SXJC 5SYMA 1UAYA 2FPGB 3HN2A 4RZ3A 2G5CA 4Y8VA 4KQ6A 2O8EB 5LOVB 1ADGA 1E9SA 4L07A 1WOMA 5IJ0B 1IN1A 1ONOA 4ZHSA 4IWXA 3QHPA 1C7FA 1MT3A 4K3UA 4YRFA 4I50B 1GGHA 1PGOA 2V74B 4R98A 3NBXX 4BLWA 1YZYA 2DUWA 1HRKA 4OOEA 2CB0A 2PCLA 3SYNA 4YASA 3UY4A 1U31A 2IHTA 3HBLA 5AK5A 3P9QA 5AW9A 3ZOKA 4YUZA 1RLIA 3UWPA 3TAXA 1NMYA 3PJDA 2OKGA 3GCWA 3ZHCA 5JOQA 3DL0A 3QE9Y 2ZTSA 1P7ZA 3CKMA 3NRJA 4MS3A 3UENA 1TD9A 2V03A 3RS0A 1X77A 4E1VA 1PSZA 4KR7A 2OFXA 1QG2A 3TIIA 1C9YA 5LKRA 4L5CA 4ZODA 2EFYA 1CIJA 3DL7A 4S24A 1NW6A 4TT3A 3SE7A 3NWPA 2QM0A 2GKGA 2XYVA 1VBNA 1FUYB 1F6WA 4O2AA 4UNIA 3CEAA 4BZQA 4JV5B 3LC1O 1SCUB 4IHAA 1KIAA 3LNTA 5AXCA 3ZWCA 1T8PA 1GN8A 3CLKA 1PNQA 1TZKA 4EY6A 1X80A 2AN9A 4ALNA 3QLVA 2VHUA 4RPCA 1KGDA 1P5ZB 3FBWA 4RW0A 4TPKA 1G8JA 3ROGA 2IZ7A 1PR1A 1X8KA 1AS3A 2O48X 3QWFA 3STVA 1XXHA 1Z73A 5HRAA 2XKKA 1R8XA 5AVVA 1BD4A 1U7XA 3LTEA 4YH1A 3SHTA 1R1DA 3UUEA 3E22B 4JUBA 4AT1A 5LIPA 1MO3A 5KKCA 1MJFA 1NXPA 5CG2A 4PE5B 5M7EA 3RFCA 3GCZA 4BC1A 2QPOA 3ASYA 1IAVA 3NRCA 4D9EA 2AKEA 3T7CA 4XVQA 2J3LA 1EUCB 3VISA 5L3RA 1RXEA 3T1QA 4XR9A 4YXFA 3WDLA 4WKBA 1NVMB 4RY9A 5IM4A 1IN4A 2XTNA 4WDRA 4JT2A 2ZBVA 4N0MA 5IYZA 1M1YE 5IK2A 4TTVA 2PGDA 4KFCA 2CFTA 2QP4A 4M0PA 3NVKI 1GAEO 4JHLA 5TQ2A 4LF9B 4E5VA 1O1YA 3RLIA 1CJTC 5IZCA 7ADHA 4UUMA 2Q5JA 3CUKA 3V1TC 4FR5A 3WLSA 4CTKA 4EI9A 3WDSA 4AKHA 4WBNB 3IDZA 1MABA 4WY5A 4CIWA 3TR0A 4M1ZA 5C31A 2R79A 2C5EA 1KMCA 1JBKA 4I14A 4JKIA 3RKSA 1E2JA 4E15A 4EUHA 5B6PA 1C7RA 2WF7A 2YQ4A 3EXHB 1KO7A 2C7PA 3ILXA 4IICA 2UDPA 4AZVA 1WS6A 3G88A 3AHFA 3ND5A 4O33A 4DHEA 4M49A 6YASA 2IIQA 5AK3A 4AF6A 3JXEA 1RYDA 2R8RA 1ULHA 3DLBA 2JLZA 1UDXA 3IP1A 2KBFA 4WESB 1VKJA 1JAZA 2FPSA 1T36A 1YT5A 3AEXA 3E3OA 3G59A 4XM0A 2FUG6 5EIBC 4QEKA 3WYNA 3O8DA 4P53A 1DTSA 1FX0A 3KLNA 3QFCA 1JYFA 4Q4AB 5EIAA 1SC4A 3VC7A 3AIOA 4EW3A 1HPLA 3ULKA 4Y6PA 2Q27A 1MB2A 2HN9A 3GT0A 4X0EA 1E99A 2DFVA 2EVWX 2Q1XA 3K20A 4B7ZA 3SJ7A 5ITZA 4GSLA 5A1JA 4HDKB 3TE7A 1WB9A 2HLDD 1RE0A 2PRKA 3MMZA 1HH4A 3JVVA 4ZVTA 1KKMA 1ZNYA 2I71A 3GH1A 4KACA 4PPFA 1A8IA 4D9CA 1LI7A 4MHTA 4I4TB 3L7MA 1QO0A 1RAGA 1QMGA 1H2YA 1AT1A 1M2GA 2QJTA 1PFKA 2QRKA 4PYKA 5KYGA 4QNMA 2HMYB 3B1FA 1XCOA 4LZWA 2AOUB 2TMGA 1MC1A 2ZRMA 4L3WA 3UXMA 1LWNA 4BP3A 4CCYA 3EAGA 3WLFA 2JLYA 3UOWA 2IWHA 5ESWA 2R5NA 3ECSA 5KYTA 1GUFA 5E38A 2V6FA 1Q16A 2OILA 2W2LA 4B3GA 3I9MA 2VRBA 4LSWA 1U0RA 2QXYA 1M6VA 4CGZA 1PG0A 3LKBA 1LF5A 2O8NA 4GOND 5JNVA 1RYFA 3WL6A 2QVZX 4A4DA 2PS9A 3ZCXA 2XSZD 5BN3A 4BE9A 2Y27A 3QBDA 4G07A 1EB9A 4WECA 3M1YA 2P6OA 3LIIA 3R7NA 2WPNA 1AUVA 4WY8A 4A0QA 3H2GA 4NV0A 2QG4A 3ZY6A 4GVLA 4BNDB 4CPDA 3T1HB 3HABA 3HU3A 2HLHA 2WP0A 3BS4A 3JYNA 4Z0TA 4XVHA 3Q0IA 4OHOA 3VPHA 1ESCA 1ZN8A 4BO8A 4DM7A 3ROPA 2HIMA 2O8CB 1RMTA 4BMYA 3MD9A 1B1AA 1DVRA 1ADYA 2QQ5A 1VMIA 5TPZD 4ENUA 1P0QA 4XWWA 3A6PC 1KK2A 3SCZA 1VBFA 2IKSA 1KJ8A 5BQ5A 4TKUB 4DLYA 2QVBA 4HGQA 1NWHA 2IT1A 3CF2A 4RQTA 1L4HA 4YMVA 4M8SA 1MH1A 1QHIA 2OOSA 4GZMA 1YR2A 4IJUA 1Z6GA 1UOEA 2A4MA 2G4VA 3BGVA 4YP7A 2BZ1A 3K9CA 1ZN2A 2FSGA 3AVWA 5DTJA 3LT2A 1T2FA 3ESAA 1SCIA 3AR8A 3OWXA 3FSGD 4DCSA 2NYRA 2I3AA 1WX1A 1QIGA 3KKKA 3AF1A 4QPPA 3GN1A 2H5LA 4DJEC 1JMKC 1NUQA 2XLBA 2B8EA 3ABQB 4N7RA 2ZI7A 2BSXA 4TLMB 4Q01A 2QRGA 1UBMS 3COSA 3PWSA 2WRZA 3QQPA 5BPHA 3ZWWA 5BSFA 2QJWA 3IP8A 1WXEA 4O4IA 1D3AA 1QK4A 4LA4A 3C3KA 3F96A 5TQ0B 2ZETA 4ZDJA 3GLSA 1XRRA 4LOLA 1AN9A 5C7LO 2GLXA 2JGFA 3WJ2A 4AXXA 3DCJA 1DKMA 1E3WB 1TYZA 1YRYE 4GE0A 5EZYA 4AZWA 4BVFA 4HWSA 4A5SA 1K0FA 1JAHA 2H1WA 2DHRA 4WGFA 2AN5A 3HH8A 2IZ6A 3FPGA 2HJRA 3GLIE 2QTVA 1WBDA 1BSVA 1QO7A 4GPBA 5ALZA 4LGYA 2Q5HA 5TGZA 1XOIA 1CUXA 1NN3A 2XYGA 3AHDA 4B7UA 2SBTA 1RCUA 3K73O 3KSUA 1Q6ZA 3AHJA 4MX8A 4XLTA 3TSWA 2V7GA 4DZZA 1MT0A 1XZEA 2QYTA 1AQIA 2FW7A 5K0LA 3TLZA 3F7NA 5KYWB 2RGRA 3AFGA 1KPHA 1HG0A 2QGZA 3A36A 3HKDA 2GJSA 1XTSA 2IYTA 4YUYA 4X95A 3ZQ4A 1Y9JA 1T2UA 5IJZA 2AX4A 2HF7A 3UUWA 4Z4FA 2ZPUA 4UHDA 1Y1PA 3TUZC 2PZ8A 2JGKA 1A9PA 1OASA 2QPLA 5BSGA 3F9CA 3IALA 4ZFNA 1JSCA 4BIIA 3EXG2 4R5HA 3C7CB 2FRXA 5EJGA 1ZUWA 1R12A 3R6LA 3HVIA 3K70D 4JJ6A 2O7RA 3QWHA 3CPJB 2PL3A 1T6YA 4H1UA 2HA0A 3WJ7A 3OICA 1UJ6A 5FA8A 2CLCX 2WJGA 1NMEA 1YJQA 3QE4A 5DGHA 4DIEA 3FOFC 3KCNA 5BXQC 4DR2B 2OORC 1U0FA 5C35A 4L4RA 3LRPA 4JY7A 4UASA 1JHOA 3K9HA 3NHAA 1SVSA 3F90A 4JX8A 4TKMA 2KHZA 5EPOA 4MB0A 1JKXA 2EKPA 3T94A 3WLRA 2JS7A 1AU9A 1DJNA 1PFYA 2FCRA 2H5EA 1L9KA 3TVTA 4DDKA 5JFGA 3SS7X 2C58A 2FJPA 4LXXA 4RO0A 421PA 2H59A 3DBRB 3C3WA 2XOKA 4EHHA 3UKOA 5IF3A 2CLSA 1ZXBA 3KOYA 1E9VA 1BD3A 1I9CA 2BR3A 2VJCA 2BBWA 3GY0A 4RKWA 3TL2A 4GM4A 3F3KA 3JQFA 4AMBA 4JUAA 4CKEA 1T5SA 4M38A 3R7BA 1PU2A 1QM5A 3ESZA 3OPYA 4E2WA 5L45A 2OZEA 3KSZO 1PX0A 3K53A 4A73A 4G37A 2AK2A 2HBQA 1XEWX 1XZAA 3GNTA 3OIFA 4LWZA 4PZDA 4BLTA 4CUZA 5TF0A 4DMKA 2ENUA 4RMNA 4WKGA 1O94D 2FWRA 5C3UA 5CAEB 1QHHB 3REQB 4Z4CA 3FGPA 1DOAA 1SBYA 4GXNA 3JD3A 1P6QA 3L6CA 3TZQA 3MXOA 3WNBA 2B0JA 1JPNA 1WXQA 3HYNA 4G3XA 2OYCA 3EA0A 5KWVA 3I1YA 1I0IA 2P6PA 3H5WA 3HYRA 4Z2AA 3MM4A 1CJVC 4JJGA 4Z3KA 1E6LA 4GPIB 3VR6D 3HJUA 5DX0A 2ROQA 1CF2O 3IP5A 3U61B 2C8LA 3I83A 1CR6A 3M3PA 1WDKA 3ONFA 4MWBA 2QMYA 3CJTA 3S2GA 5CLGA 5DTMA 3D6AA 2PRZA 1HEYA 4J76A 1XD8A 4WNCA 1CRWG 5HQTA 4ABYA 2EHJA 3HBAA 1R15A 1SD5A 2GWHA 1QPGA 1X9GA 3ADOA 2PKQO 2JBAB 1SQFA 2GPNA 4HWKA 2A4KA 4QNNA 4X6XA 3WJ1A 4AO8A 4GMXA 4BO7A 4EKDA 5KYUB 2ZDGA 2QMOA 1EINA 2GI4A 3N2KB 1FTQA 2NZXA 1QB7A 3BKXA 5K0ZA 1H5QA 3O6VA 3QYJA 5AH0A 1RRPA 2X9NA 4YCAA 5D1HA 4ANFA 1OYWA 2C2OA 3HJRA 4L0QA 2ASEA 5I51A 3OCXA 2ZT5A 3V80A 4CKCB 4TTQA 3WV4A 3I58A 3O2NA 4LMPA 2XT9A 3LWDA 3HCDA 3ZU6A 3RSLA 4X41A 1V26A 1RRVA 4Q3AA 3U0BA 3BZWA 4WZBE 2R2GA 3IPRA 2LDXA 3OX2A 1XQXA 3R3HA 3I2HA 4FMDF 2QTTA 4QPNA 1A0OA 1LJUA 3PGLA 3STYA 4PHHA 1D2CA 4R7ZA 1HE3A 4ZEMA 1G1AA 4FFPA 1U4NA 1IHPA 1VLQA 1WMDA 2V8BA 4G5FA 3RFXA 4CMBA 5AESA 621PA 4LHWA 5ULLA 4MAMA 3RQSA 4RJTA 4LHZA 2DGDA 2DM6A 2X0JA 3SZOA 2PXAA 4KHZA 3DYIA 4PNZA 2XZPA 4MDHA 1RKVA 5JPIA 5KNBA 5LQDA 1M33A 2MU1A 2GETA 5C8YF 4EG7A 4CEJA 3DAFA 2BH9A 4E22A 5KQLA 4AURA 1I33A 3RADC 2GFHA 3KJIA 2VSQA 2QX8A 4NOJA 5KQPA 1FFXB 2RHTA 1PVDA 4O5AA 4HB4A 5AXAA 3HR8A 4YJ2B 4NMXB 5T7BA 5K8UA 1N2OA 1D5CA 2P75A 2NSDA 3TW4A 4AD8A 4WBXC 3I09A 4LSZA 1HDGO 2Q2QA 4ML3A 3QVWA 3VU0A 4FHZA 4QFDA 3PVCA 2VTKA 3WNCA 1C7EA 5JANA 5AW7A 2Z6UA 1WUJS 1GNQA 2RJOA 3ZBUA 1FW6A 3FTEA 1P2TA 5I9NA 3BQMB 3DEKA 4LMRA 1N3LA 3M1AA 1SM4A 2AVDA 3ZCRA 5AVXA 2OY0A 3RRYA 2ZE7A 1D2GA 4YRPA 3MMSA 4GLFA 2ETVA 2F9FA 4WPGA 4P9NA 2YTZA 1NYQA 3A9VA 1PYDA 2R96A 3DZFA 2CFOA 5DV9A 4AP9A 5ARBA 5JSZA 2HOQA 4EG3A 3SFTA 4B8WA 1JQBA 5HJ7A 2Q2VA 5KWEA 2P0YA 3OZAA 4YO8A 4F2DA 5ERXA 4R31A 2V7BA 4OLBA 1VE5A 1A8HA 4G6ZA 4PHFA 1DXOA 2I3ZA 2ODBA 2V7QD 3MA0A 4XJSA 3FYSA 1CRLA 5CYPA 4RA6B 1Z4MA 3S0JA 3HXQA 4X92A 3ZR4B 2G08A 2X8AA 1EVLA 3RUDA 2HBRA 4LV6A 1CT9A 3X43A 4JDUA 4IBOA 3QOYA 4JN6B 5LU8A 4WZ6A 1EHIA 1JHVA 1NI3A 3AIMA 1E2UA 1J8QA 2WILA 4NBVA 1UOOA 3OY2A 1HOTA 3BILA 4OGLA 4MMYB 2E4XA 1CQJA 1XG5A 5KDLA 4MITA 1ZMXA 2Z6VA 2FW1A 1TAUA 3WY9A 3A26A 4G1MB 4RFSB 2VDWA 2XCLA 5H70A 3N0TA 1ZGJA 5TLSA 1TAHA 1YZNA 2IUFA 4KSBA 3CWQA 5ALVA 4BDSA 4K9LA 4ER6A 3L6BA 4QT4A 4H3SA 4YMIA 2UZ1A 1C30B 2A0XA 3K2EA 3TVYA 3NIFB 3WQRA 5E1DA 1EQ2A 1P1CA 2CYCA 3ZNOA 1N6OA 1KYIA 3EHEA 4HFRA 3U39A 4IUCS 2W00A 3DZIA 1XRMA 2WTNA 2WSIA 3UK1A 4NYJQ 4AO7A 5FR1A 1L4MA 2NO0A 1NSFA 2VSFA 4FFVA 1PJCA 1N32B 2B2NA 5G0WA 2GH1A 3AL2A 4KCGA 3ZIDA 2ZT7A 1JWAB 4G9GA 4RJIA 3C85A 4E0BA 3G0HA 1IY1A 1P61B 4U8HA 3U1TA 4O2AF 1JG2A 2GEDA 4YDRA 4AB1A 4QYIB 1G8MA 1HMYA 2J33A 4ID3A 4IGEA 2V98A 5HE8A 4GMFA 2APJA 1A2BA 1DIGA 2QX9A 3OZCA 3W5JA 4NK4A 5A6SA 5EJ6A 2VYVD 3J80A 3FGOA 2VJYA 3HDQA 2IW1A 3LHKA 3OM9A 4Y67A 4DMMA 3QNMA 3W5VA 4GZ6A 1GKIA 4M1WA 3F97A 2VJQA 3MHPA 4H1TA 2WINI 1K7SN 4N3CA 4RK4A 1KDVA 2C61A 4PYQA 3GXBA 3V4SA 3FD8A 3WK5A 1EVYA 4KKXB 1H8HA 3TOZA 3V34A 1KO4A 3V7YA 4XCVA 3ZHOA 1U0TA 2JEOA 4LRSB 3TOVA 4JASB 1P0MA 5L51A 3PA6A 5IU6A 3ZV4A 1MAUA 1JHDA 1I4WA 2WSLA 1OH6A 1YJ8A 4A2WA 5IN4A 3W4JA 4DFDA 4OQ4A 5IM4F 4PLVA 3TIXB 2A3NA 1S1CA 4L74A 2RCNA 3I1JA 2QU8A 4WZZA 3WQHA 4Y2PA 3KQOA 5IYZF 1K66A 4DDMA 1E4VA 1KI8A 4DNFA 2HPAA 3U17A 5FL7D 1VLZA 1GDTA 4PZZA 1SC3A 1YONA 3ELWA 4LSMA 2ZM6B 5COBA 5EVJA 4M9CA 1U28A 1TW2A 2DBYA 5EPUA 3AVOA 5D2CA 3S3TA 1PR0A 1BYIA 1NVWQ 3ZDEA 1V39A 3OIWA 4YAFA 2VF4X 3KLBA 1SVMA 1JXQA 3S2IA 2RD2A 2HCRA 3EXEB 3UMFA 3ZNPA 1WO8A 1S89A 2C7VA 5DM2A 5HFAA 1IQRA 1GR1A 3SYKA 2HHAA 2K87A 5DWVA 1CHNA 4GDFA 2ZJOA 1J42A 3IILA 5SZHB 3BSFA 3EMDA 4DNQA 1N0IA 4OBEA 3DLCA 2OXTA 5C8VA 1P8JA 4KMMA 5KTRA 4TWRA 4BQIA 3TZHA 4CFZA 1BE6A 1FXUA 1U4SA 3FPCA 3RARA 1CY6A 4O1HA 2O07A 3H5IA 1A9XB 4RIHA 3X1XA 1NV8A 5KVVA 2VUTA 1IBRA 2ORED 1CHDA 4XWKA 3N0VA 3FETA 4X61A 1RAAA 1AKNA 3GD5A 2VP9A 1EVJA 2X9LA 2Y68A 3C70A 3I01M 4MGIR 2BHTA 1JLRA 3QMMA 3T9CA 3L4SO 2FKNA 3V4PB 5H4GA 5E6SA 2K5UA 3AG6A 1PNVA 1XPRA 2R8XA 3BRCA 3DLTA 4DN6A 2B9EA 3CEPB 4GEGA 3CZ9A 1VJCA 4R41A 3I64A 4KGVA 3RSCA 1I2BA 3PZBA 5J2UA 2BAGA 2XRMA 1PR4A 4MRPA 4IO0A 3TIGA 3AONB 3LPLA 3PYMA 4HQFA 3LT0A 3V8NA 3NETA 3GJRA 1SN7A 5HZGA 5A02A 3VU8A 1ZOOA 3SHQA 1GGFA 2VL7A 5FTWA 3JQAA 2GTIA 4ZCSA 4FHGA 1GPNA 3L0BA 2QJOA 1E98A 1N1EA 1HG1A 3E53A 5BW5A 1ISHA 9MHTA 2BFEB 2IUEA 2CLMB 3K92A 3KUDA 3W5UA 4XWOA 4MR9B 5E4TA 3ZGZA 2Y2UA 1TPZA 3BDVA 4GYYA 1J5PA 3GEDA 4HYEA 3AB8A 3FVVA 4DMLA 3CRRA 2G0NA 1VP3A 1MRNA 2VK1A 3RYIA 3IIEA 4TV9B 3CZRA 5DVZA 1ACMA 5COAA 1EFCA 3QTTA 1O5OA 4XWTA 3F5DA 2AOVA 3GLKA 4LWOA 1Q0UA 2IUTA 2PNFA 3R20A 3O3MB 2LTAA 2BRUC 4DSTA 1SOVA 5LZ2A 1CKEA 1GPBA 1T8SA 1UJNA 2RJNA 3DMHA 1W85B 1L5MA 3G79A 3R3VA 4TXMA 3ZE2B 4FI3F 4DQDA 2Q99A 3GU3A 4B0OA 5I7VA 2I7VA 4G0VA 5IWAB 3CW9A 3GGPA 4NCKA 5I7WA 1MW8X 4RKFA 4OXRA 5EESA 4HSGA 2IYSA 2W2VA 2YHAA 4UULA 1DUIA 1H4TA 4ZAFA 4GMKA 2O2DA 4R9SA 3SSMA 3VNVA 4WA8A 5DTIA 2QM8A 2K2WA 3D3EA 1T15A 2GBLC 1LFAA 4MP6A 3ZK7A 4DV6B 1YTUA 1XZCA 3G0IA 2ZU6A 4RH3A 3C87A 4BUJA 5C37A 1JGTA 5DT2A 1SEVA 1E1CB 3I9KA 3IDOA 3P9KA 1VJ0A 1F06A 2I6XA 1ZVJA 3DHYA 2W6ID 1PW5A 4FR0A 3UICA 3WSWA 2H7XA 3ZHQA 4RVCA 4GXQA 1XRSB 2I03A 3ANSA 4AJHA 3CYFA 2QVLA 1A8PA 4LJ9A 1Y7LA 4RJJA 4UQPA 3EPKA 3V3TA 3I3OA 1KJIA 3BB3A 8ADHA 1V3QE 3T9DA 1CNMA 4F45A 4NJMA 4EF5A 1ES9A 4P3PA 5BSTA 2FW9A 3AKCA 4LVOA 3WV5A 4BLUA 5LQCA 4XX0A 2PH5A 4B1FA 1JF8A 5FUQA 2R48A 2AEEA 1UKZA 1GRCA 1CUZA 1AMNA 3GAFA 4FWIB 1SU7A 1GCGA 2H2DA 2OXRA 3IBTA 4O4IF 3RC3A 5AVTA 2P5YA 4XFDA 3M49A 1P7CA 4DPMA 2HXYA 1QTRA 2HU7A 2W2QA 4OHPA 4FDAA 2YWEA 3WA6A 5EZYF 1EP9A 5KNLA 4EFLA 1VMKA 4LCEA 2G0TA 1RC8A 4YDQA 2ZYGA 5IKPA 2GXQA 3JYLA 2X4DA 4IUYA 4K1LA 5E6RA 4Q24A 2IHZA 5IBPA 3V8BA 5B30A 4CI9A