3B3GA

The 2.4 a crystal structure of the apo catalytic domain of coactivator-associated arginine methyl transferase i(carm1,140-480).
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
324
structure length
324
Chain Sequence
GYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from structures of coactivator-associated arginine methyltransferase 1 domains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Histone-arginine methyltransferase CARM1
total genus 103
structure length 324
sequence length 324
chains with identical sequence B
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2007-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 3b3gA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3b3gA01
3OE5A 4C08A 4QTUB 4GC9A 5HIIA 5LQKA 5DRTA 5EPEA 3HCEA 3DMFA 2PLWA 4CKCA 5FCDA 3DOUA 5E1DA 8MHTA 4FS8A 1NW5A 3FZGA 3G2OA 3HVIA 5DLYA 5EEHA 2XYVA 4GC5A 3OU6A 2XBMA 2B78A 3HCFA 2OXTA 2ZLBA 3IYLW 4PIMA 5EHIA 1AQJA 5FQNA 2Y1XA 3OFJA 4YUYA 4G56A 3EGEA 1RI4A 2AN3A 4QDKA 1ORIA 1L1EA 3BKWA 3EVEA 2AOUB 4GBED 4M7RA 3UJ8A 3PS9A 1ZG3A 3MHTA 3FTFA 2IIPA 4XCXA 2ZVJA 4YV0A 2YXLA 1UFKA 1HMYA 1JR4A 3TFWA 1SQFA 5HIJA 3KR9A 2IDKA 3ID6C 3NWEA 3UJAA 3H2BA 5EMLA 3BWCA 4CKBA 4YV2A 2UYCA 1B42A 3SVZA 3FTCA 4K6MA 3PX3A 1RJEA 2G71A 4P7FA 5DRYA 3V97A 4OBWA 4O29A 5K0LA 4ATNA 1QZZA 5EMMA 1NBIA 1NE2A 3PFGA 2FK8A 4B17A 4YV1A 4F84A 5DTRA 3DXYA 4HGZA 3TM5A 3UA3A 1R6AA 2ADMA 2ZIGA 2A14A 2ZCJA 1I9GA 3EGIA 3FYDA 3LCCA 3CBGA 4PGGA 1JG3A 1KPHA 2ZWAA 5FULA 5E8JA 3OE4A 1L9KA 1VLMA 3GWZA 2H1RA 3BUSA 3GDHA 3I9FA 3O4FA 1X1CA 2ZSUA 3I5UA 3K6RA 3P9KA 4U7TB 2PX4A 3E05A 1FP2A 1N7JA 2JH9A 2PJDA 2PGXA 3BXOA 2JJQA 1WXWA 3OZSA 3NJRA 4Z2YA 4EKGA 2OBFA 4AX8A 1ZQ9A 3CKKA 3BGIA 5CVEA 2FRXA 3EVZA 4RTMA 3FUXA 5K0FA 3K0BA 2CMGA 1KP9A 2AOTB 5EKUA 1JSZA 1R8YA 3HCAA 4RTOA 2EG5A 3A7DA 2H00A 4M36A 3HVJA 2NXNA 5HFJA 4E2YA 3FUWA 5FA8A 4R8RA 5HILA 2H11A 1KPGA 3HCBA 2ZWVA 3C0KA 4IWNA 1EAMA 4PINA 3THSA 3IEIA 1R8XA 3P9NA 4KWCA 3UA4A 3AXTA 4PONA 3OU7A 4FR0A 4F86A 3NW9A 3EEYA 3PX2A 2YUIA 3D2LA 3OPNA 5P8WA 4E70A 5D1NA 2YR0A 2PWPA 4RYLA 3FUUA 1WG8A 1R00A 3TM4A 1VQ1A 3B5IA 3TKYA 1BHJA 1BOOA 3EVGA 5HIKA 3UJCA 2BH2A 1EIZA 3CGGA 5DSXA 2HV9A 3P2KA 2ORED 4R6WA 5DM0A 2QM3A 3SSOA 4FT4A 2N47A 3FPFA 3B3JA 4C03A 3A7EA 5K05A 3HA7A 5DX0A 4EQZA 1BC5A 1H1DA 1JTEA 1VPTA 3LDGA 4HTFA 1QAMA 4PYQA 5DM1A 4ER3A 5KQSA 3ER8A 2I6GA 4P58A 10MHA 1ZGJA 3KQMA 3SSNA 3DUWA 2B25A 4LG1A 5ICCA 1FP1D 2P35A 2BM9A 1N7IA 5EEGA 2AOWA 3P2EA 5IH3A 5K0JA 2PV0A 2EJUA 3LECA 5EQJB 1JTFA 4IV0A 5M5BA 3KQYA 5GIPE 2OY0A 2YX1A 5FQOA 2FCAA 5FWAA 2P8JA 5LR6A 5HEKA 3P9CA 5E9QA 3P71T 5FWDA 2B3TA 3FRHA 3GRYA 3VC2A 3KR1A 4OA8A 5HZMA 2UZ4A 3B3FA 1NW6A 3C3YA 1KHHA 3ELYA 4E31A 3T7TA 4DZRA 1X1BA 3UZUA 5LQUA 4L7VA 3BWYA 3HP7A 5GM2A 2P3OA 2Z6UA 4RTQA 1VE3A 5FUBA 1X1DA 3DLIA 2CMHA 2ZZNA 4A6EA 2B2CA 4WXHA 3KQWA 4FZVA 4CKEA 1VP3A 2VDUE 5LSAA 4QPPA 2ESRA 2IBSA 3MQ2A 5CVDA 1M6YA 3KQPA 3NMUF 3EGVA 3NDIA 1TPYA 5E9JA 3TLJA 5DTMA 2PT9A 5EOVA 4P7GA 5EC8A 1NBHA 2NXJA 5K03A 2C7RA 3T7RA 1ZHFA 4XUEA 3MTEA 3SXJA 3UBTA 3A27A 3KPUA 3LX6A 1SUIA 4M38A 3CC8A 3DLCA 4FSXA 5ICEA 5GINE 4E33A 1AF7A 2ONYA 2PSSA 3O7WA 1ZGAA 5HIMA 4GOOD 2FHPA 2IFTA 2UYHA 3B3GA 3FUTA 2NP6A 4E32A 2P41A 4PYMA 2ZZMA 3DXZA 1YFJA 3FTDA 3LCUA 3BZBA 1SKMA 3LKZA 1U2ZA 3I64A 1XJ5A 3SM3A 1JG2A 4BP1A 1XDUA 5KQRA 2I62A 4C04A 2ONZA 5C9ZA 1QANA 1PRYA 2AZTA 1KR5A 2ZBRA 4PCLA 2ZIFA 3CJTA 3KQSA 3M33A 4ER6A 3EPPA 1YUBA 3KQQA 5CVUA 3R9XB 1V39A 3IV6A 4X60A 4GUAA 4RTRA 1RI2A 3M6WA 4YMGA 3KQOA 2QYOA 5ICGA 3EVAA 2EX4A 4RTPA 4HTFB 4Y2HA 2DPMA 2F8LA 3UJ7A 4DMGA 4PYJA 3G7UA 5BXYA 4QVKA 1D2HA 4PYIA 3RIEA 4C06A 3SSMA 2IGTA 4F85A 4QQNA 2PX8A 2XYQA 1M6EX 4DF3A 3UFBA 5KVAA 5LQJA 3KQTA 4EK9A 2P1DA 4RSRA 4QPNA 2O05A 3DULA 3OCJA 3GRUA 3TRKA 5DXAA 3EEOA 2O57A 3G5LA 5C1IA 1M0EA 2Z6AA 2OKCA 4QDJA 3BKXA 3CCFA 2P7IA 4RTSA 1RJDA 2PWYA 1SG9A 3GJYA 3R0QA 1D2CA 4EMSA 3GGDA 1Q0SA 1IXKA 1NT2A 2P3LA 3GU3A 4GQBA 4KDRA 4NECA 5CD1A 1DCTA 4HGYA 3EMBA 4PNEA 4AZWA 3T7SA 1T43A 2G8NA 3E7PA 1I4WA 1QAOA 5DT2A 5EIWA 3B89A 3KR2A 5EZQA 3AWIA 4CTKA 3GIWA 4RWZA 3ERCA 5DWQA 2CWWA 5FA5A 4GOLD 2PT6A 3EVFA 1TW3A 4JXJA 2IH2A 1XTPA 2ZZKA 3DR5A 3PTAA 5KYGA 2GLUA 1KIAA 4X41A 4RVDA 3ME5A 4RX1A 1INLA 1G6Q1 1JG4A 4PIPA 1R18A 1VP9A 1RI1A 1YZHA 1JG1A 2HTEA 3T0IA 4AUKA 3UJDA 4E2ZA 5LQCA 5H02A 3EVDA 2R6ZA 5E1MA 4LWOA 4R05A 2JHPA 2IDJA 2I9KA 2PKWA 3JWHA 5MHTA 1P91A 3NVKI 3UJBA 5LQNA 2GH1A 4A6DA 1Y8CA 2AOXA 5EKXA 1UIRA 4U7PB 4EVIA 5ICFA 4FSDA 1G60A 5FADA 3ELDA 3SMQA 4XUDA 5B1SA 5C0OE 2PXXA 4OA5A 3M6UA 4ER5A 3GRVA 2WK1A 5CCXA 4DCGA 4HG2A 2B9EA 2QE6A 3U81A 3TR6A 1EJ0A 3DTNA 3G89A 5CIYA 2NP7A 3G2QA 3AJDA 2G72A 2O07A 5BW4A 2QY6A 3BGVA 2KW5A 4GEKA 4PWYA 2HNKA 4C4AA 3R24A 3NWBA 3LCVB 1N2XA 1WY7A 3LPMA 5K8VA 3GCZA 9MHTA 3LGAA 3QOWA 2CL5A 3E23A 2OYRA 1NV8A 3ELWA 4GOMD 1TW2A 3KR0A 3FPJA 4XUCA 3DMHA 4YMHA 4C07A 5ERGB 2Y1WA 5F2NA 2AOTA 1FBNA 2DULA 4KVZA 3FUVA 3FYCA 1UWVA 3TQSA 3DH0A 3KPWA 2C7OA 2I7CA 1F3LA 5HOQA 3CVOA 1X1AA 3G5TA 2QRVB 5K0NA 4BLWA 3LKDA 1XCJA 3LBYA 5BP7A 4RTKA 1XXLA 5F2KA 2ZULA 4LWPA 1VIDA 3MGGA 2O06A 4P7KA 2ZTHA 3TOSA 5IKMA 4P7JA 2OO3A 5K0GA 1FPQA 1G55A 1F38A 3M4XA 3I53A 5DM4A 4DQ0A 4QQKA 3DXXA 4AZTA 2PX5A 5DX1A 1QAQA 2NXCA 2YXEA 3BWBA 5F2OA 5GWXA 3KPVA 2WA2A 1QYRA 1L3CA 3REOA 1G8AA 2AN4A 2UYQA 3HVHA 3NDJA 3S68A 2Z6QA 2JHAA 4FGZA 3GRRA 1JQ3A 2OB2A 2FYTA 5E2AA 2VDWA 4DM3A 3DP7A 3OZRA 4KW7A 3O31A 3R3HA 2AVDA 2E5WA 5DXJA 5CM2Z 5GP1A 1NKVA 5JUWA 5EMJA 2OB1A 2YQZA 4RVGA 1NW8A 3G8BA 3FTEA 4HH4A 1Z3CA 3L8DA 5G02A 3HCCA 5EMKA 2AOUA 3SGLA 3WSTA 4RTJA 3HTXA 4M37A 3ELUA 2AVNA 3E8SA 1JSXA 3HCDA 2OZVA 3EVCA 3EMDA 2EFJA 1AQIA 1WZNA 2XVAA 1D2GA 5CVVA 2WA1A 4E2WA 2YTZA 3CJRA 2JG3A 4KIFA 1ORHA 2P3QA 2R3SA 3G88A 3THRA 3LL7A 3PB3A 4BY9E 5T64A 2AS0A 4CWAA 1YFLA 7MHTA 3QV2A 3G2PA 5KS2A 5DM2A 5D1HA 1JQDA 3P2IA 5EHGA 2P7HA 4BLVA 4MIKA 1X19A 4X63A 3NVMB 3KQVA 5EVJA 5GIOE 5FHQA 2JH8A 4YUZA 2G70A 5E1OA 5JR3A 2ZBPA 5K0BA 4BP3A 2GS9A 2FK7A 3FPGA 2IBTA 2QRVA 3UWPA 4PGHA 2AOVA 3UJ6A 2O0LA 3TPZA 4QVGA 1XCLA 4DKJA 4MHTA 5DTQA 2GA9A 1RJFA 3GNLA 4OQEA 4V0RA 3G2MA 3V8VA 1MHTA 3G8AA 1KPIA 5DSTA 4ISCA 5DPMA 3KKZA 4H0NA 3GXOA 3PVCA 1NW3A 4KIGA 5GOZA 1SUSA 3JWGA 3HNRA 3MAGA 5DX8A 3M6XA 3FRIA 1YZ3A 4ZTBA 3OFKA 3A4TA 3PFHA 3KU1A 3JWIA 3C6MA 4AZSA 3BWMA 4R6XA 4C05A 1AV6A 2AR0A 4YUXA 3NTVA 2ZIEA 4RVHA 3VYWA 1PJZA 3MERA 4KRGA 4KDCA 4DCMA 1XDSA 3SX0A 1YF3A 4OX9Y 2XVMA 1EJ6A 3HM2A 3R6TA 3BGDA 4QTTB 3P9IA 2V7EA 1RI5A 1WS6A 1ZKDA 1OR8A 3IHTA 2BZGA 4YUWA 2YVLA 2HMYB 4GF5A 5LQAA 3FPHA 4OBXA 1BKYA 3GRZA 4LECA 3LSTA 1VL5A 1XVAA 3P8ZA 5E1BA 1JQEA 2BM8A 4PYLA 3LDFA 1O9HA 1L3IA 3Q87B 2IH4A 4E30A 4WVLA 3ORHA 4R8SA 5EZSA 2PBFA 5GM1A 3M6VA 5E8RA 1P39A 3VC1A 3BT7A 3CJQA 5LQRA 3I58A 3HVKA 4PYNA 4RTNA 3X0DA 4IV8A 2ZW9A 3Q7EA 4X1OA 5FHRA 3RODA 3C3PA 2LD4A 2PXCA 3LHDA 4EKIA 3UJ9A 4Y30A 4HSGA 4PYKA 3RW9A 3VSEA 3GO4A 2FPOA 3KHKA 1KXZA 2PX2A 4OQDA 3TMAA 3KPJA 3JWJA 3MCTA 1MJFA 1RJGA 2IP2A 1O54A 1O9GA 4FP9A 3FPEA 2NXEA 3AXSA 4PYOA 3B7PA 1P1BA 5EGSA 1XDZA 1YB2A 4MTLA 2G1PA 2Q41A 4E2XA 3P97A 5CCBA 1DUSA 1NV9A 2K4MA 1P1CA 2BR4A 3PLAE 1SQGA 5U4XA 2PY6A 3TKAA 4HC4A 2P40A 5CUQA 2V74B 2VDVE 1NW7A 3OZTA 3KPYA 2ERCA 3C6KA 3M70A 1DL5A 5T6BA 3LBFA 5E9WA 2VP3A 2NYUA 4AZVA 5K0EA 3HEMA 2PVCA 2ZFUA 2UYOA 5K01A 1RI3A 3F4KA 2HWKA 2IPXA 2JHCA 5BW5A 1KYZA 1G38A 2YXDA 4POOA 3AY0A 5FTWA 3HA5A 1EG2A 1IY9A 2GPYA 1HNNA 3A25A 3HA3A 2VZ9A 4DA4A 5E2BA 2VS1A 2BR5A 2GAFA 1I1NA 5EG5A 4CTJA 4GOND 4UOEA 3ER9A 4V0QA 5CVJA 1G8SA 2HR1A 1L3BA 1IM8A 2GB4A 4PCAA 3QOXA 5EIFA 4BLUA 4RV9A 4IKPA 2C7QA 3OU2A 2BR3A 4ER7A 5K09A 1R74A 2AN5A 2EJTA 3DMGA 3EVBA 4MWZA 3PT9A 3MCZA 4FT2A 4YUVA 3A26A 4MQ4A 4CXMA 2CKDA 4ER0A 1SVUA 2OPBA 3ANXA 1KYWA 1VBFA 2ZBQA 5T67A 3SR4A 2PXAA 3LDUA 5K0CA 3MTIA 4HRAA 2C7PA 2XYRA 1EQAA 2NNWB 1Q0TA 1FJXA 3MB5A 2IH5A 1WXXA 4X61A 4RTLA 4RVFA
chains in the Genus database with same CATH superfamily
2GJ4A 2YY5A 4OUDA 4E14A 721PA 4WMLA 1UBJS 3IDSA 4IGIA 3G3EA 4MQFA 5TARA 2FZGA 3M6LA 4CN8A 1U7PA 2VJDA 1W44A 4EPRA 4LXGA 4CKZA 4X62B 1AKMA 3E53A 1F9EA 1P61B 1F7UA 3KZXA 3GCDA 3AJ9A 3LFTA 3H4VA 4PF1A 1AQJA 2PH1A 2P9TA 3ONEA 4LYJA 2JIZA 5F73A 4Z4FA 4CU2A 2AJLI 121PA 1L1EA 3BKWA 3Q7PA 3V7FA 1P8AA 1TRHA 5KU7A 4DR6B 4WRRA 2A5JA 3OF2A 3NTOA 4URWR 4Q02A 4F38A 2YXLA 2HBQA 5HBGA 4MW5A 1LDBA 4YMUA 2EF1A 1PJLA 3J81A 3S1LA 4A5OA 4CKBA 2B3DA 3P9XA 4OXXA 2IYLD 3F7OA 1A0OA 4MAAA 4R8MA 4DUZB 2O5VA 4FLMA 1K86A 3OM8A 3PNKA 4L07A 4DSOA 3U19A 1ILEA 4DPMA 1R12A 1C7IA 2FSVA 4G0YA 4WXYB 2A8YA 4OQXA 2O2GA 4F84A 4MS1A 1JB1A 4B7XA 1OLSB 1ZX1A 4F06A 5DM70 2CMDA 3BGWA 4N0EA 4AP9A 2XCRB 1T5IA 4EDFA 1X39A 3OZCA 4UJ3A 1TXGA 4M76B 3DVRX 1ZU5A 2WE8A 3Q5GA 2OD2A 3PNBA 3V2GA 5AHRA 2QJOA 4N82A 1BFUA 2A59A 5LXTF 2XUGA 1SBCA 4LXUA 1RLMA 1ULHA 3HB9A 3BXFA 5KTKA 2N42A 2FRXA 4Z4QA 2HSGA 3KTDA 3PGXA 3UMSA 4RZHA 1U7DA 1V1MA 4KX3A 1X77A 3A7DA 4DPLA 1KI3A 4OYLA 3ORSA 4RZ3A 3AINA 2UAGA 4TS1A 4IJWA 3E5MA 5F1KA 2ZQYA 5HILA 4BZPA 3Q4GA 2Y1DA 2ID8A 5BQFA 5BYJA 2LUOA 2PUAA 1KFCB 2CCKA 3EQ7A 3ZDEA 2J0SA 3NHPA 3MJRA 5HF9A 1X3LA 3BIWA 4PAQA 3WYDA 4FR0A 2APJA 1RZVA 3HZHA 1RFLA 1CFZA 2IPLA 1CY1A 3A1WA 1VA5A 4WK6A 3V8PA 1USIA 3WI7A 3LLCA 2H8GA 4DSTA 3D3JA 5D85A 4FOOA 3O9VA 4Y2UA 4PCVA 1TU0A 4HRVA 2QAGA 2IPNA 4TRJA 4ZU1X 1XC7A 1J2EA 5B1EA 1JBKA 1HFJA 3O92A 1QTQA 2CDAA 4JL8A 2ORED 3UBMA 4E1BA 2QM3A 3BSWA 3BEDA 3LQYA 2VR1A 1EX1A 4FT4A 3B3JA 1E8MA 1ZD1A 2LIPA 4ZOLF 3CX4A 1RDFA 4RESA 1HYEA 5AKKA 2MR5A 2Q45A 3NHMA 5TGZA 3CF6R 4P3XA 4E22A 3KLNA 3C6QA 1RACA 2PKQP 1T3HA 3EPLA 4MLDA 2PVSA 1S8NA 4C0WA 4LTDA 3PXDA 3RUHA 1DC6A 4HYYA 1EFPA 2GM4A 2MINA 4I1UA 3R76A 3M3DA 1X8XA 1R0YA 1PFUA 3M6FA 5LMCA 5J2UB 4ZKEA 5FQOA 2PV7A 4QGGA 5FWAA 2FUEA 1WZCA 4DB4A 5ALEA 1FVHA 1LSOA 1MX1A 1T0HB 4M7WA 1A9ZA 1KEWA 4P3PA 3CSDA 4R54A 4UAJA 2I03A 5BORA 3HKCA 4GKBA 3GRYA 3ZHSA 1EWQA 2CZCA 1RADA 3AHCA 4CEJB 3USCS 1TUGA 3FR8A 4HEJA 3L6OO 3E1KA 3PXCX 5EE3A 2DF8A 3P1JA 3Q85A 3T4PA 3H9UA 4IYJA 1DG9A 1G0OA 2P8SA 4TMKA 4TZTA 2WTXA 5K0TA 1E0AA 3H1EA 2A0UA 3GH3A 4B3GA 1S2IA 1NOJA 5F5XA 3LD9A 3TCNA 1G8HA 1JVBA 3DF7A 1Y1TA 3VHQA 5ALGA 4O6VA 2NNLD 5A5FA 1KEZA 3CWQA 1Y7HA 5C8XA 1KK2A 1RLIA 4CIYA 4CGZA 3DBHB 2BVNA 3A31A 4WCVA 2P4SA 2L42A 3I8XA 5GJWC 3T1HB 1NXXA 3MA0A 2BEKA 4ZOBA 2AZ4A 3OOHA 3GEEA 3LUCA 3GZNA 2C42A 1ZHFA 1PT5A 4XUEA 3AI3A 5B3KA 4I4NA 5GINE 1MT0A 3Q7TA 2QZJA 4RLFA 5IG2A 3ETDA 1GZVA 1WVMA 2YCBA 4E33A 1Z35A 3BL6A 3GEDA 3CPEA 4OHRA 5BN5B 3G9TA 1NNLA 2GBGA 3ZS9A 3CX7A 4J7UA 2WI8A 3L79A 3VOTA 1NBEA 4JASB 5HR5A 3BTOA 3SVLA 5IXYA 4ZZ3A 1DDGA 4HPWA 4V0MA 4PY2A 5HK8A 4OP2A 4B87A 1XDUA 2HJVA 3R7DA 1JF8A 1LQTA 1I2MA 3AL3A 3GRPA 2BDTA 5I7UA 4MLCA 3H9EO 4A8JC 3L8HA 1G20B 2ZIFA 3M33A 5BVHA 3Q8KA 3EPPA 3QY0A 1QYXA 4IGFA 1AZLA 5FV4A 1W36C 1P0FA 4CG2A 4QWMA 4D1YA 2QS9A 4NF2A 1OKKD 3FCCA 4QOHA 4Q9KA 2H85A 2QVZX 2EL9A 1PSZA 4Y2HA 2FPLA 3RBVA 1FOEB 1RYNA 2PGJA 4NU8X 2Q9BA 2QTFA 3G7UA 4HDRB 2QX7A 1SQ6A 3TFOA 1TIBA 1KC3A 4O0LA 2VRCD 4F5WA 1CUWA 4K7JA 4QQNA 2WB2A 2WMNB 3L3BA 4GRIA 2HGSA 2PUTA 3UN1A 4CUKA 3A3OA 4QTYA 3ROKA 1MRNA 4HO1X 4EA7A 3T6KA 2J3QA 5LKRA 3QX3A 2PL3A 1ULBA 3DJFA 1EFLA 1ZRSA 2KBEA 5AH0A 3K73O 5JQGF 1G8MA 3LKVA 4CI0B 3UHOA 4WK4B 1MQAA 1IEQA 1SCKA 2GXSA 3SX4A 5CX1B 1T43A 2G8NA 2Q4EA 3K4QA 3ROQA 1NVTA 1P8JA 1C9YA 5D5HA 4UW9A 2G08A 4MRVA 2BFBA 2CWWA 2XUDA 4GOLD 1R9MA 1T29A 3E8MA 2ZS8A 1U3GA 3DVAB 1XD2A 2CFIA 4LE0A 3EAFA 5JPDA 1QR2A 4YRDA 3ET5A 4X41A 2P4HX 1Y80A 4RX1A 1IMJA 3K53A 5AHXA 4A0FA 3HDGA 5IFLA 1KJ9A 2CNDA 4D9HA 4KSCA 3LPAA 3W5HA 5BY2A 5E1MA 2ZXUA 4GL2A 2X6QA 1GA6A 3N2GA 1EXNA 4RGVA 2G09A 3VKUA 3ZU2A 3UJBA 4P3NA 4S1WA 4G5HA 1NMQA 1D0VA 4FX5A 4LQCA 4GICA 2C88A 3KVNA 1K7FB 1GZDA 3EW9A 2ANBA 5FADA 1SELA 1B1CA 1GO2A 3GCGA 1DT5A 2Q2VA 3JATA 4U6NA 1E7MA 5AYVA 1HE3A 2PMEA 4O4LA 4MINA 3W1EA 1N1GA 2ODNA 3N07A 3NOXA 3W8EA 2MTBA 5BNFA 2ATCA 1UBCA 1F4LA 5BNZA 2FSHA 4S05A 2HL6A 1NJ8A 3K7EA 4KJXA 1J97A 4FW8A 1S2LA 2G9NA 4YJ2B 3WRXA 3LTEA 3L4KA 4PZCA 5DCWA 2GR9A 4KLRA 4ENQA 1QLJA 2ZRJA 2FMUA 1RWVA 2G7ZA 3NVAA 3EZXA 4BKPA 4NMWA 4IJVA 3DKVA 9MHTA 3A1SA 1U5BB 1JEYB 3T3EA 5K8TA 3E23A 3HXOA 1JXOA 1X80B 2BELA 1EEXB 2NT4A 3BMQA 4MLPA 5DWDA 2IUYA 1RXEA 1E4OA 4JELA 2Y1WA 3U7HB 1FBNA 3U4GA 4AK9A 1TVKA 4LFBB 2V0CA 1XLTA 2OYSA 1G7SA 2YC4C 4M1YA 4PSAA 2H2WA 1L7RA 3GJ8A 2AXPA 3BRQA 3QKUA 3RDPA 1XMQB 4D80A 3VKHA 4MVJE 4NJEB 2B36A 3FYUB 2ONCA 4OGGA 3K0SA 3A4VA 1QLWA 3H4MA 1FYEA 3TLGA 1NWCA 1PX0A 4BGDA 3I2JA 3HP4A 4HQ0A 4UQOA 5L3VA 3FDFA 3L49A 3DM5A 2F64A 7ADHA 1MBZA 1UC9A 1THTA 2E4VA 3DXFA 4MV4A 3BBPA 3KXIA 1NNSA 4DQ0A 1CF9A 3MLBA 4KWHA 4ZT2A 4LMBA 4WUTA 4J2TA 1TM7E 2H4HA 2AJCA 3CUWA 3RFUA 1MVLA 3RVPA 2H3HA 1U3FA 2PKXA 5J4LA 2CYBA 2OCLA 1E66A 3HVHA 1WXEA 2CDNA 2CZQA 2HJWA 2YY7A 1AX9A 3A58B 1OI2A 2NM0A 3FLBA 4HJXA 4M49A 3RM3A 4EH1A 3TLAA 1PDOA 1TF7A 2E89A 3OLCX 4IG4A 5I47A 1K6XA 3ZNQA 5DXJA 2V3WA 4BUCA 4OHUA 1A98A 1XV5A 3VYUB 1ZS9A 2OB1A 4BIMA 3DDZX 2PR7A 4R7GA 4E5PA 4YAOA 3L8CA 1QRSA 1T0BA 1WL8A 1CDZA 3QE4A 1SCUA 2AOUA 1CQZA 1PJ4A 4K6GA 1GSOA 3ZWDA 5COBA 5LLDA 3VH3A 3BMOA 2FOLA 3ROGA 4L5YA 2C59A 2QA5A 4ZAYA 5T57A 3TNLA 5ALXA 3NI2A 1MG0A 1NVVR 4RD3A 4PGMA 2QQGA 2R3SA 3AFNA 3MBOA 3CQ9A 2WUDA 3OUZA 4EI9A 1B2RA 5I3CA 1BH2A 3MWYW 5D2CA 1ISGA 1ZINA 3AG6A 3L7OA 3C3KA 2DQSA 3P2IA 5IK2A 3WRYC 2RH5A 2W4IA 4YP6A 1C4XA 1UPFA 3CXRA 4HDSB 3SDSA 5CA1B 4H3KB 1ZVMA 4P4NA 4JXXA 3U6KA 1CEQA 1VKHA 5G4KB 4DYVA 2EX1A 1ZJ4A 1XZJA 2FJUA 5EPUA 3T1NA 3C24A 1V7QA 4NBLA 4UD2A 3SEZA 1YGYA 2H1HA 3C3CA 2TECE 4YLGA 4FFRA 1JE1A 3A9TA 4J6FA 1B8PA 4LKRA 4DQKA 5C8YF 4DKJA 4R2HA 4Q4HA 4DYHA 4NCAA 1CDEA 3PDWA 3ZDZB 3I6BA 3NT5A 1NVDA 3T3NA 4LQLA 4FQ7A 4NHOA 2ZRDA 4HQNA 5GOZA 2JAXA 4RDXA 3NCHA 2QTLA 5G2OA 2XXBA 1MB0A 1SZCA 4LY0A 3BVPA 1H2EA 3HCPA 2WPNA 4BPBA 5LMUB 2I6UA 4N6GA 1FFGA 1HDXA 4G0MA 4DV3B 3QBEA 1ML4A 3DZGA 1E5TA 5MN4A 4QQ8A 4I1PA 2RI0A 2DUUA 2QSJA 4OJNA 3ZKWB 5JFOA 1H6AA 2CJXA 5AKEA 1U0EA 3W5SA 2LCIA 5A6SA 5JH7F 1A9PA 1GR1A 1OX4B 2BF4A 3N0XA 3OJWA 4IHJF 3VYRB 1LFDB 4BDSA 3BG5A 2PQ0A 5EN4A 4CVNA 5LQAA 5DHTA 3DEFA 1TE2A 2AK2A 4XIYA 1AKVA 1NLYA 1S2NA 3HUDA 2XRYA 5BR8B 2J7KA 1SVIA 4M8KA 5F77A 1V3TA 2JKVA 3Q72A 4TMVA 3RT7A 4P35A 1ODLA 2VT3A 4E4TA 5LU8A 1B0PA 4GAEA 2F00A 4B2IA 5INTA 1VE9A 1P9RA 4GEGA 1BRMA 5TF4A 3BHJA 2I6QA 1K6IA 5EIOA 1YONA 1W0JD 4UMDA 2AJTA 5AVRA 3RODA 4FC6A 1XDDA 4UU0A 1JPUA 4EX6A 4ALNA 4X8HA 2I6TA 2HQ1A 3JWEA 3UJ9A 3SJ7A 4M0UA 2IY9A 1JN0A 4HNRA 1TRKA 4RANA 1LPNA 5JJLA 1PIWA 2OGSA 2ZRFA 1N4AA 2FP3A 4DTIA 1GN8A 1C7JA 1MJFA 3FLEA 3L02A 2A67A 2GF0A 1FX0A 4D5GA 1JHZA 3BIJA 4XRGA 4ZV9A 2G1PA 2P3SA 1O9BA 1QORA 4MROA 1OWOA 2GCPA 1TO2E 1DJQA 1QU2A 1VB3A 2WFMA 4EA8A 1O57A 5C3MA 3DD5A 3EFOB 3LXRA 4UCFA 3B13B 2K7ZA 3U4DA 4JYZA 3EXAA 1EZ4A 2P2ZA 2JAOA 3UMFA 3CZ5A 3DZJA 1CLEA 1KOGA 3DF9A 2R60A 3G0HA 2BFEA 4Q9LA 5KC8A 4X8LA 3AUUA 2OGWA 4BO8A 1QIKA 4FWTA 3QXCA 1QRRA 4AZ3A 4MQ6A 1PK9A 4V0OA 4YP5A 3T3OA 4O3MA 5DGDA 1AIPA 1RQ7A 1TYCA 2CVFA 3N6XA 1U94A 4FR5A 4RK7A 4DIDA 5IU6A 1YRAA 2X0RA 4BQPA 3HSKA 4UOEA 2MMCA 3UAGA 2FFQA 3FMOB 3NANA 3OM9A 1ISHA 4GRAA 3GFSA 5GJBA 5DHSA 4C2UA 2FZKA 4L4ZA 1E6KA 3F2IA 4HDKB 3ST7A 3BB4A 5FOQA 4C0AC 2GZRA 4JLSA 1Z6QA 3HBAA 4RZSA 3KO8A 2XQGA 4DC0A 1SC6A 3EX7C 3BH6A 3FAKA 2EZ8A 4FMCB 5ERYA 3GAZA 4ER0A 3NBAA 1BIFA 1AUXA 3QU7A 4YXFA 1I5OA 1EQAA 2EJWA 2WM8A 1BU5A 3B9PA 4X61A 2Y0DA 1KU6A 1ZM7A 4QTUB 4Y2YA 2CHEA 4L3VA 3T8YA 4RV5A 4NOMA 1XMOB 4OY3A 2P9QA 4QODA 4OLJA 2R5WA 4JQSA 4WZBE 1MRZA 1W19A 3QWFA 4OLBA 4B34A 5ITSA 4PSDA 5FV7A 1Z5NA 4AKEA 4DIUA 2W2KB 4UHEA 4RHEA 3DBHA 3P9RA 2I0FA 4KXXA 4OK5A 3EGEA 3Q6NA 1WAMA 5AJZA 4EF6A 2AN3A 1TKCA 2JIQA 5LC1A 5BSEA 3N1UA 3S2IA 4GBED 3PS9A 3ONDA 1NJGA 1W5FA 5FBWB 1EBFA 2RB5A 1LCIA 3OQVA 2GJKA 2JAPA 1KI2A 2X42A 3RAJA 4ARVA 1FU8A 2FA9A 2BFPA 4I5EA 4KHPB 3IH5A 4X85A 2ZTLA 1JNYA 4JJZA 3RG2A 3TZQA 5JBQA 4PFKA 4U9UA 4R1QA 4ZI7B 4EPYA 1RPAA 1RKXA 4JOSA 2GETA 5DRYA 2V9ZA 2OHOA 1DMSA 2NU6A 2BRUC 3MWEA 4LAFA 1ZY2A 5FB3A 1TT5B 1II9A 2HUPA 2VDQB 4O4HF 4UTOA 5F64A 3RVOA 4JI8B 3A8TA 1MJNA 3OY2A 4HGZA 2JJMA 1KZ6A 2ZIGA 3OICA 2A14A 2WAMA 4DR1B 4L74A 3JQDA 1XVUA 1CRLA 1KPHA 1M2EA 4TYPA 1PD0A 1SXJC 1IC6A 1KY5A 4IXTA 4OQFA 1F2UA 3LYAA 1G8FA 4CZ2A 2JDID 5AW3A 5CT6A 1XZ8A 2I1VB 3R7FA 1XZGA 3WOHA 1TM2A 3ZV4A 2WYHA 2FG6C 5DM60 3U4QA 1MC5A 3EH2A 1V1RA 2J5BA 3KKNA 4ZYXA 3QPAA 3EAGA 1IY0A 5AXAA 2QP3A 1ZH8A 3E2IA 4MEBA 2G76A 4EDHA 4RTMA 5K0FA 1K7EB 3BC1A 4LZLA 4XRRA 4J0KA 3EIWA 3WHLA 1OXUA 5EKUA 3OA2A 1M2GA 2AV6A 3A36A 3EOBI 3Q3HA 3GGGA 3EARA 2IOFA 2O0JA 4G1MB 4KPGA 1U1CA 2VQ6A 1YWGO 4MDHA 4RAOA 5C8YA 3I4FA 3NB0A 3KSRA 5HQ3A 1HKUA 3SQLA 1IWPB 5CMLA 1T1SA 2I22A 3CUKA 5LBUA 3U7IA 1U3TA 1YUNA 1YZTA 1U8EA 2NLOA 4FM9A 2D62A 7GPBA 5EJGA 4A26A 3PX2A 3OP1A 1QG6A 3K6SB 1FJ2A 4E70A 3WLAA 1OREA 1LBTA 3QP9A 1GYRA 5KTTA 3RUFA 5FLEX 3J80A 2ZRIA 3MXOA 2D13A 2GTHA 1KI6A 2IUSA 5THKA 1MORA 1QMGA 2JGDA 2Z9DA 2PEYA 4EABA 3SSOA 3GUUA 3PXGA 1R4AA 2DG2A 5CLFA 1NSTA 2QRKA 3HV2A 2BTEA 4JR1A 1SKUA 2JBWA 4NZ9A 5JI2E 3QHAA 2H4FA 3HKEB 3SEFA 5L3QA 1DC7A 4Q1EA 3UAXA 4M88A 1HYQA 1C8BA 4LBWA 5FWXA 3EPKA 1OFGA 3EDOA 3HU5A 4GKJB 5SY9A 1XTSA 1MXFA 3G17A 3NKVA 1U0RA 2ZCJA 3I8SA 3N0VA 5M5BA 1G6HA 4QNNA 3FYSA 5CBPB 1G9TA 3V6LA 2FMTA 3P4XA 2G7MC 3WB2A 3PGKA 1N9KA 1MEOA 3WKBA 2AEFA 4YRGA 4MPRA 2LGJA 1X80A 2GHTA 4F2WA 2QVBA 1FDOA 3TRDA 3HJRA 1GKIA 3U9SA 3K0AB 1QHSA 1YZGA 2OV4A 2WMOB 3CMMA 4Z2AA 2XWJI 3TR5A 1M5RA 2AFHA 3FOBA 2VT7A 1X15A 4XWOA 4RY9A 1ISFA 1PR4A 1XDBA 3IELA 3SSAA 2CMHA 5DYNA 1BE6A 5JZ9A 5DOZA 5IM4A 1ZR2A 5SYAA 3FI9A 1DOZA 1HE5A 2QTCA 3Q7QA 4MR7A 1CQJA 3HVUA 2H1IA 2FWRA 4RFLA 4RIGA 4RIFA 5CH3A 3U44A 2VUTA 2IBSA 2QQ5A 2FFBA 1CU1A 3LOUA 1U31A 3FNIA 4QJ5A 2H4XA 4JUCA 3TLJA 5DTMA 5KKAA 3WL3A 4DA6A 2G9VA 1SQ0A 4NNPA 4XWWA 2G1AA 1A71A 2WU3A 4CEIB 4F0JA 4P3KA 3VPFA 1A72A 1JAIA 4ID9A 4HGOA 3WO1A 3OFSA 4NYJQ 3KPUA 1Z18A 4U7FA 4WN3A 3RRMA 4ZVSA 2KLHA 1RXYA 2JJ1D 3TVDA 2VOJA 5IKEA 4BO3A 4TWZA 4WT7A 2IFTA 4Q9IA 3X3HA 2UYHA 1GTRA 2BFNA 4FPXA 4WFJA 5IUKC 1Y4AE 1P7VA 5I9BA 4B81A 4C5BA 1YZQA 2QBYB 3O8CA 4I1YA 4YRLA 1Q0LA 1PJAA 1T3LA 3A3KA 1PLJA 1NQOA 3DDOA 3CYFA 3M0EA 1JZTA 1WXFA 1W4AA 2ZE8A 4D4KA 2HHCA 3OLVA 1V39A 4IOJA 3RE1A 4U8HA 4WPGA 4OHKA 1RI2A 4YMGA 3LM8A 4EG5A 4EF5A 5ALMA 1UH5A 2EX4A 2HYDA 4D42A 3KYDB 3BFJA 5K5EA 3C74A 5ITZB 4G85A 3TBKA 3DVLA 4BAGA 1EFVA 4EJSB 3SSMA 2JIBA 1V71A 4BTEA 3ECAA 4ZIRB 4KE7A 1KAGA 3KQTA 4B32A 4BNHA 2WHPA 2RHDA 1CJSA 3B6KA 4JSTA 1GAXA 4QPNA 4B3SB 3QKSB 4NARA 3A2KA 3EEOA 4BXOB 5IF3A 1S01A 3AJ8A 3EIEA 4BE4A 4DDUA 3BF8A 1H2RS 5DI9A 1I4OA 1A8PA 4JB3A 4LXIA 4KPYA 3BFPA 3LQ1A 4GXNA 5TX7A 2FG7C 5HJ7A 1GKLA 1W8IA 2OR3A 3BD7A 2H1VA 3C8HA 3S27A 4I2VA 4DJAA 2DPLA 3O26A 1EINA 4GI3A 2IOQA 3LGSA 4AUMA 4QPJC 3BILA 4ZALA 3U7QA 2W2LD 1Y1QA 3I2KA 4PHHA 2SECE 3HUUA 3IXMA 1YJXA 4GYKA 4U2EA 5CT9A 5EZQA 1M0TA 1NVAA 3V6MA 2VDNB 1EMDA 4N5HX 1CJMA 3Q8MA 5DYGA 3ERCA 4X54A 1T1RA 2FEAA 5TEWA 4BVHA 3CRRA 4L6AA 4WVFA 5H0IA 1Z7BA 4OFZA 3HUFA 4XKJA 5CB0A 3C97A 4AUKA 1N75A 1M74A 4MUKA 1R8JA 5H02A 2R6ZA 4FFNA 3NGMA 3MT7A 2O6LA 2IL1A 2TS1A 1B93A 3DL4A 3LZ6A 4V0LA 4BNWA 4EY4A 3BERA 5MHTA 3S81A 3EGDB 1U0LA 2QSUA 3O8NA 1DV1A 5T7BA 1YZYA 3PXUA 3Q2KA 4S3MA 3UV3A 5KOJB 3H18A 1XL0A 2JLRA 1DHRA 1KARA 2WWGA 1GU7A 2C5BA 2OL4A 3PX7A 2QPAA 3OCZA 3P4YA 2WNIA 2Y77A 1NKTA 3GF4A 4RW0A 2DLDA 4RELA 3DVSX 4BRWA 5CCXA 5EYPA 2FPGB 3ACDA 1CT9A 4BMVA 1EJ0A 1B4DA 1CDDA 3DQPA 1EWYA 5J59A 1JQAA 2D54A 4OKSA 2QY6A 3ZBUA 3BH7A 2H9IA 3GA5A 2C57A 1CRWG 5M3BA 3WAKA 3E9CA 3NIDB 1W6RA 3NM4A 1K92A 1N8NA 1VFNA 2OBBA 3QPBA 2YRXA 4I36A 1UM8A 5AVTA 2OXFA 3KOYA 4I5FA 4UE2A 4N47A 5JAOA 1X86B 2ZATA 3ACBA 3MPOA 4FHFA 1US8B 3QOWA 2V7UA 2OYRA 5IBCA 1KWGA 1L8QA 4OHXA 3OX1A 3U4CA 1WUYA 2Q62A 4GOMD 3LS2A 4PC2A 1T9AA 2EHDA 3KT3A 1E92A 1EVLA 4ZO4A 3UT5B 3RFXA 4JLDA 2QXUA 3FYCA 1YB5A 4O4JF 1OTYA 1UWVA 2OD7A 3TQSA 3KOUA 3KPWA 1EQUA 1OAOC 1KVUA 3VMFA 1ZMXA 2A84A 3F46A 3MINA 3QY9A 4TWBA 5JDCA 3IQIX 4PZPA 2YV4A 3T15A 3X43A 2OAGA 5HM8A 2IS6A 4MWDA 1ONBA 1HDIA 1M34E 2GMWA 3B70A 4MV8A 4QE3A 4ROTA 5EJFA 2FMFA 1W93A 1JAHA 1AXGA 3SCZA 4BFTA 4WOJA 2JFPA 5LA6A 4B3JA 4DV2B 1FX0B 1TZJA 4KE8A 2FOIA 1IG3A 4JLNA 4CIAA 2XITA 4QXAA 1L1RA 2O0HA 3RQIA 3Q7IA 1X1SA 1OFHA 4RF5A 4YHBA 4Z9BA 3ZD9A 4C3UA 2NO4A 2UYQA 1NLZA 4KH1A 3H9GA 3V1KA 4UOZA 1IQ0A 3PEEA 3K0KA 1W6UA 3U62A 4DARA 1GTSA 3DP7A 5CDUA 5JDIC 2RKWA 2BFMA 3ZZUA 1SB9A 1O94C 1BA3A 4U2BA 2D2FA 2VSFA 4UTXA 2ZANA 2DBZA 4PXYA 1M2OB 1CUXA 1P4HA 4DCCA 3LNCA 4XASA 1P74A 2REQA 3VUFA 2BPOA 1QF7A 2WTBA 4J7XA 4JBNA 4KXMA 4TMXA 2RBKA 4M37A 1W5EA 3U4IA 3JSXA 1ZLXA 1E7RA 1JSXA 2X19A 1SUAA 1E6UA 3RUEA 5M34A 2P4UA 1M2HA 1BQ4A 1JLLA 2WF9A 2ZRAA 4OAPA 1TL7C 1D1SA 4FMPA 2I6FA 1KJIA 1FUYB 2WA1A 3OEHA 3CJRA 1SVLA 2ZPUA 4QYXA 3MK31 4CFZA 1E2KA 1KEKA 2JVIA 1KJYA 1JKMA 4O0MA 2YCLA 1TECE 2P1ZA 3QV2A 5GMOA 3GA0A 3VR6H 3FZQA 5DH9A 1N2IA 1V1RB 1IIBA 1E9BA 1H8EA 1TF2A 1SCJA 3PVSA 4K9LA 4ND1A 5EVJA 2BTOA 3TPCA 4D4IA 5C7LO 3PEWA 2JH8A 1EK0A 3T12A 3ZWXA 1GARA 1A4UA 1V41E 4NNJA 4RXUA 1N1DA 3DOOA 4QECA 2QRVA 4P31A 1MC1A 3A3YA 3IBSA 4UHBA 5C1DA 3P0JA 2A35A 2GA9A 3IMKA 3C4JA 3PLRA 3IOEA 3NWJA 4C3VA 4GGMX 4FQ5A 3RHSA 2QVGA 3ROFA 2DTEA 5AJTA 2IGBA 2PLFA 1UUFA 1RRFA 2ZU0C 3PGA1 3ABZA 4G0PA 5DX8A 3DKKA 1BJKA 3VOSA 2QW8A 1LLUA 3ZIAD 5JSQA 4PG5A 4YY3B 4V24A 4R6XA 1AV6A 3RS4A 3WKEA 3BX1A 1VMIA 3C85A 3NTVA 3LYUA 5ECYA 3RUCA 4DV0B 2JZCA 1RRCA 2JIDA 4FOTA 1JHMA 2OC9A 2DY1A 4LQDA 4AULA 2XTMA 3HM2A 1ZD2P 5A9SA 9GPBA 3G8CA 1CQWA 4HAWA 3VPXA 3GPDG 4BEVA 1R8SA 3OPYA 3QEOA 2YVLA 4J4TA 3HXTA 3HUEA 4G9EA 4EB6A 2W2XA 4BCCA 2WF5A 1YK0A 4MR7B 3FM9A 4ZT5A 2W58A 1TK9A 1ADCA 1IQRA 4PYRA 1ECGA 4TMWA 2VCEA 1U1EA 1QKIA 1L3IA 4AECA 5JOQA 1A9OA 1K6JA 1O4WA 1WHTB 2CUZA 2PUGA 2B1QA 3M6VA 3IMGA 1P39A 5B7NA 1SU4A 2AG6A 3IE0A 4K6KA 4YJHB 5BWMA 5KTNA 2NWQA 1QTRA 2WNSA 3DCIA 5B6PA 4X1OA 3L5KA 5JAMA 3LHDA 4E6PA 1GZHB 2KLBA 4UDNA 1ZOLA 3VSEA 5BXQC 4FNOA 4Q3KA 1JG6A 2A9QA 5JWHA 4YR9A 3THYA 3HXQA 1JT9A 5T3YA 3ZQJA 2JKZA 2NXEA 3W34A 1SOAA 5DLQC 3R8XA 3CUYA 2GXAA 4CDRA 1WCIA 3P97A 2O19A 1Q1AA 4RVOA 1SUEA 1IWOA 4JVNA 1DB3A 4CTOA 3RYCA 2QUIA 2BEWA 3WMFA 5SZIA 1L8XA 1GYQA 3MINB 3WK5A 1C5KA 4KLZA 3O93A 4PSVA 1P2BA 4XW2A 1CG6A 4JY7A 3K30A 2H06A 4BNDB 4DLXA 4KQCA 2IEYA 4B3TB 1UMBB 3P9PA 4OB6A 1QCYA 5JISA 3HRIA 3JYLA 5K9ZA 3FOCA 4XH9B 4LMAA 4MKHA 3WGQA 3A2MA 3CPSA 4JZKA 2CVOA 4QYWA 5FTWA 1HNNA 2IHKA 4LHYA 5IT9A 3IP1A 1B73A 2CLEB 1L7VC 1QBKC 3U3XA 4CTJA 4Y6GB 2AG1A 1Z2EA 4TWIA 5FLXA 2P79A 1ODIA 4GXTA 3ZH9B 2FSGA 3BWVA 2FX3A 4UZSA 4IZ6A 2G82A 1W34A 2P9HA 1ZL2A 1L5KA 1S8OA 1RM5A 1TMOA 1I0IA 1YCDA 3A4LA 5F78A 4Q9NA 3O0TA 5K09A 1KYTA 3HXKA 3HKCB 4HX9A 4LVNA 4R2XA 4G8JA 2VXOA 1P60A 3TBHA 4D9KA 1NPYA 2ILVA 3SZMA 3CVJA 1Z08A 1G18A 2WU4A 4MQ4A 1WHSB 3W5UA 2GNPA 2VHVA 2ZT8A 3F96A 1WCWA 4YDQA 3GW8A 1QO7A 1C30B 3AW9A 4DMHA 1GQQA 1BROA 4YYEA 3BE6A 1B8UA 4KLNA 1Q16A 4UQPA 5FPPA 3SF8B 3UUWA 3VU9A 1Y8RA 2CNNA 1NI5A 1SH7A 2P9CA 2Z43A 4IDDA 5AW7A 3B20A 3U4MA 1QFYA 1GAQA 3EE6A 4LSZA 3F0TA 2AMYA 2KSQA 3NQ41 1O95D 4FS8A 3KTAB 4Z4IA 2PQ6A 2ZSBA 3GC6A 4FN5A 4U0KA 4Z86A 1Q7GA 1JE0A 1VHJA 1HNXB 5JCZA 1AKRA 2QD5A 3AYXB 4RC9A 1KAQA 1PJCA 3S0JA 3I9MA 2XCSB 4S24A 1KRXA 4JLPA 4PPQA 4YUYA 1EWRA 1I32A 1QFMA 3NG1A 5CX1A 3SYRA 3C7KA 3QMWA 4NNOA 3VU1A 5JXJA 1WO8A 4AUNA 2HHJA 2CV2A 4H17A 2VRNA 4DNOA 3MAJA 2CNLA 2XUAA 3PHLA 1WKBA 3S2YA 3OEYA 2D8MA 1HMYA 2E6UX 3GT0A 3ID6C 3UJAA 4KQ2A 3VC3A 1N77A 4RDHA 3QVGA 1ZXBA 2AI2A 3ML1A 4LS3A 1PWYE 1T9KA 3OT5A 3W6OA 1NBWB 4WADA 3D2BA 1IXSB 4P2BA 3WGTA 4ZIRA 3CE9A 2A86A 3EIUA 4GKAA 4YV1A 2FK8A 2AFIE 4EEZA 5C4MA 3KQUA 1IZZA 4GBGA 3WLEA 3ZE1B 4BNYA 1T3GA 1QF6A 2R6CA 3GEIA 4BFXA 1QIMA 3DZFA 5CD9A 1M8PA 5IMSA 1C0EA 3RREA 3IVCA 4N18A 1N2CE 4DADA 1U1DA 3JYPA 2R68A 2X6RA 1PEYA 3PC6A 4ZMRA 2HAEA 1TMKA 3AB8A 1D2NA 4GBJA 3BM5A 1Y81A 1XPOA 3BGIA 2I6XA 4Y2PA 5ADVA 3K0BA 3ZDCA 3RRZA 5I7OA 3VNQA 2A92A 1DBQA 2AOTB 1ABFA 1U0SY 3GLUA 3HCAA 5ALIA 3UT5A 3SYNA 1FTQA 2ZB2A 2ZEJA 3E7WA 2CEKA 3QLVA 1WTAA 2C2XA 3HFSA 4EY5A 3FUWA 1PBTA 4RV4A 1PL0A 1NR1A 4NCNA 3DAYA 1E2QA 1FFWA 1IB6A 4FFPA 3UAYA 4YJKA 4FZ5A 2FE1A 1J56A 3PF9A 1S9DA 3K09A 4BZZA 3FMVA 3MWJA 3GZNB 1DQPA 1R0KA 3CLTD 2VLIA 1MRSA 4FDUA 3UFXA 1QJCA 1VOTA 2QMUA 3K1AB 1W25A 1KI9A 1R00A 4OKIA 5AVKA 3RYTC 5FNVF 3SX2A 4ZGBA 1ZUNA 3TD2A 1JHPA 4KAXA 5LQMA 2GN8A 1NE7A 3A6KA 3BXEA 1TYBE 3HL0A 3I9KA 4FFVA 4J1TA 4KK4A 1KQNA 4Z3KA 2WTUA 4D9EA 4OXQA 3VR4D 4W7SA 1U0TA 4GMGA 2ZB7A 4I19A 4C2BA 3LDGA 3NNNA 1T3TA 4PYQA 1DAEA 2TMYA 1SVOA 3D3WB 4JA2A 1H0SA 3WGMA 3ZWVA 4F21A 2FW8A 3HMQA 3T4EA 1X7ZA 3TJMA 3WLNA 1UJMA 1U4SA 1ZUIA 4M9XA 3H5IA 4WDRA 3SBXA 5BMOA 2OM2A 4G0NA 4OGWA 4UMFA 1QHEA 4BL5A 1K89A 1QFXA 4WX2B 5AI8A 1ZAYA 4ZMBA 2PIDA 2YWJA 3KP1A 1YR1A 4AO7A 4ZI3A 1V2HE 1CXZA 2AKEA 2ISCA 4B76A 4JWKA 3HJFA 1U28A 2IYOA 4UMEA 3HSSA 1JQ5A 3ZI0A 4P0QB 4OA8A 4I66A 2D5CA 4M6WB 4FFLA 4O4HB 3DFZA 3B7GA 5D86A 4A23A 4RS3A 3IXQA 4MSUA 1R0WA 5J43A 1B0UA 2B4KA 2YS7A 1GEEA 1NUAA 5FFFA 2GASA 1Q14A 2YDXA 3UZUA 1NMZA 3QLTA 1Z26A 1QHNA 1A8UA 2FPKA 3KJZA 1GGVA 2BJVA 2I7VA 3PUZA 2G5TA 1FP4B 3JVUA 4EGQA 4UPEA 1FXWA 1U81A 3KYCB 1R6UA 4IOLA 2OCDA 4Q34A 5FWYB 4K5QA 4HLUC 3W78A 3QYFA 5HKBA 3EWNA 4O1MA 5CVDA 3ZNPA 3ZV5A 1U9IC 5HQJA 5B4VA 3ULKA 1ILWA 1H2XA 5EOVA 3UWOA 1DRKA 3BHIA 4I6EA 2YWXA 1WY5A 4ZCMA 3LQ4A 3PNLA 2DYKA 2O2HA 4FFDA 1AN9A 1QZUA 1V4VA 4Z9XA 4MW4A 2B61A 1LY1A 3PUKA 1DEOA 1ZICA 2WM3A 4KX5A 1XYVA 1XEWY 3AVQA 1LV7A 1KBOA 4ZVNA 1ESDA 4OFWA 3B6MA 1JR6A 3K05A 2F17A 2HMTA 5CFRA 1UAYA 4J1NA 4S1VA 4DA7A 2H4WA 4D9IA 2Q9AA 3WFIA 3L46A 4W7IA 4E15A 3FYHA 3NVDA 4DGSA 6CHYA 2X0KA 2XWSA 2IYNA 3U1VA 4JUBA 4K03A 1IZ9A 4C89A 2WWIA 2VO1A 3W2EA 1DFGA 1VKRA 2WJGA 3M6WA 4CT5A 3KQOA 4BB0A 3E9EA 1JMYA 1EFTA 4DMGA 3ZOKA 1H0KA 1BG6A 2VK8A 5D00A 4REOA 3IE2A 2OCXA 1UZNA 5F35A 2WF7A 3A37A 3TEMA 2PRYA 4MPDA 2XYQA 1GAWA 1U3DA 4KYVA 4JL5A 2XUIA 1SXHA 1OWPA 1U6IA 1XGKA 3H8SA 4LZNA 4XPZA 4HQRA 3MIIA 4J0QA 4D3XA 3RF6A 1O95C 4Q4AB 2O05A 5CP8A 3IDQA 5TXGA 4UAUA 1SIWA 2Z4TA 4MVJD 4EVSA 1WULS 3T52A 3ZEIA 1OLXB 4UC0A 2OKCA 2REQB 2ZS7A 5I7WA 5IZ4A 3KWFA 3QLUC 4HWTA 2PWYA 4RTSA 1SG9A 3UCXA 3QEMA 4UATA 2IITA 3DAPA 2D1QA 3HR4A 4NECA 3T99A 4EG8A 5CFZA 4ZO7A 4ZT7A 5K3AA 2GPSA 2M1ZA 1CHNA 4BKQA 3MIZA 3TTTA 1SUPA 3CE6A 4G37A 1H0HA 2AN9A 3INNA 2EJVA 1D4OA 3E9ZA 2CWDA 5EJ2A 1DEHA 4Q4JB 5IKXA 1QP8A 2R6HA 1Z2OX 4CDMA 5FIUA 3NHWA 4F97A 3RKUA 3NONA 1JG4A 4H1TA 4IMPA 2ZI3A 2IQIA 4E2ZA 1E2FA 1XHLA 2AJ8A 2BJHA 4FOSA 4WA7A 3V00A 4JS0A 3WR5A 4KFCA 1E1QA 4BNKA 4DDMA 5KKCA 1JDPA 2C0QA 2PKWA 4JVLA 3IO5A 4M89A 4S2UA 3RSFA 1RM3A 4I2NA 4JMLA 4U6QA 4R2JA 4UUMA 1O6CA 2C9CA 1ZCAA 5KYUB 3ADDA 1U9CA 1HLFA 2X41A 1URPA 4GR9A 2OV6A 3GQBA 3GRVA 3CCBA 2WK1A 5DISB 2QE6A 4MI6A 3PGMA 4N7JA 2NP7A 1QS0A 4IKEA 4J1QA 2C3YA 4YRQA 2O07A 5LN1A 2HDWA 4JYPA 2C4VA 4MRSA 4PWYA 2OVFA 3O4HA 3SS7X 3VNBA 1XVVA 3YASA 3LCVB 4LE1A 4ZOLB 4D9MA 5A06A 4XA8A 2W2LA 1GRRA 2VEDA 4M87A 4JKIA 5EXPA 5FUWA 1V95A 1DRVA 3WNBA 2EJBA 2UYYA 3K09C 2HNBA 2DT5A 2NSLA 5B7QA 1HDRA 1EX7A 2WD7A 3FJ1A 5AW8A 2IRWA 2GJAA 4UNPA 3GFQA 1Y3IA 1SG0A 3Q1LA 2AOTA 4M2LA 1Y7PA 4XLTA 2R8BA 3NHFA 4U3JA 1FDIA 1CZUA 4NESA 3VTAA 5KWSA 4Q21A 3B5EA 4LJKA 3LBIA 1C3JA 3L6CA 5D3MA 4IS3A 1E9SA 3DDSA 5K6TA 4LC0A 4QELA 2ZULA 3PDCA 4I8XA 3VI3B 4KNVA 4CL2A 3RAFC 1VG0B 4H2DA 3WZMA 4ZGWA 1IONA 1SK9A 4WL0A 4HNGA 4JB8A 5IDWA 5FA6A 4WW0A 1FPQA 1HURA 4JB0A 3QKRB 2Q0HA 2A58A 3CURA 2OWDA 1DTWB 1QHIA 4HH1A 4YBZA 1R4NB 3GFFA 5ARCA 1L4EA 2VK4A 3PENA 1MO2A 1M1YE 1TEXA 2QGFA 5FTJA 3S68A 1CEYA 2OG1A 2PTGA 3GJ5A 4HDMA 3LF1A 2VATA 2QGZA 3BREA 3ETJA 1NMXA 4YRKA 2X4DA 3M3PA 2AE2A 2Q6KA 4D99A 1THMA 4A03A 1J8QA 4CR8A 3ZU4A 4X97A 1XN1A 3W5JA 4BLRA 2RFLA 5AXDA 4HFJA 1MB3A 5B53A 1QTIA 1GITA 1DCMA 4L51A 3ZIDA 5EMKA 1A9XB 3R3VA 4Q39A 3H8JA 1BW9B 2X9QA 1DVRA 2Z8YM 3R8FA 3QFSA 3N70A 1WZNA 1SURA 3N2EA 3H1BA 1TC2A 1UBOS 1BQEA 2J0VA 4TGLA 4B3HA 3HDVA 4R69A 2F3TA 5SZHB 2FR0A 1LWNA 2QI9F 3DV2A 4UVDA 1MMFB 1RE0A 5HJ5A 2N1MA 1NVKA 1T5HX 4G1EB 3OKPA 1RLTA 3QVUA 3HMKA 3U44B 1X1TA 2P6RA 1I10A 4FYPA 4NZYA 3JQ9C 5LLSA 4JX9A 5J2TB 5F7XA 4C1BA 3ILVA 2QTAA 2GBFA 2I7DA 3TO5A 3QITA 4JJ8A 1DXHA 4MVJA 4MQEB 4LV6A 2XWBF 4KN6A 5JZMA 1TCVA 1UXHA 5JG7A 2FEKA 1E1CA 2WDZA 3E1SA 1Y8QB 3PJDA 4IDBA 4HXEB 1QFZA 1YS2X 4C88A 1M0SA 4EAQA 4YMIA 1IZ7A 3VUEA 5LP6B 1L5MA 1QFJA 4DT1A 3T3GA 2G9QA 5EE1A 3HKBA 3OFKA 5JS6A 3PFHA 1C7FA 3C6MA 3PUXA 4N0DA 3WGUA 1N0WA 2AG0A 4J0FA 3V7WA 2AR0A 3BFXA 4B79A 4PLWA 1NATA 2MT9A 4FNAA 3SIRA 2Z2XA 1Z8FA 2HIMA 4LJSA 3GVPA 2GSWA 5D7BA 1T2EA 2YWFA 3IC5A 5IVPA 5IAJA 4PN7A 4INJA 4BMOB 3LJKA 1U1GA 4MS4B 4N5IX 1RI5A 2CFTA 4IX9A 1SA0B 4NQRA 3TECE 4CMEC 2HNAA 4C2AA 1VDZA 3G85A 2X2EA 3V48A 1LRLA 2H08A 4LPSA 1RRVA 3AC0A 1CNEA 1O94D 5KYKA 1KZYC 2G63A 2WJYA 2C3PA 3NAGA 3Q87B 4IWYA 4NZOA 4QBKA 3E9NA 2DC1A 2G5GX 1WMEA 3O3NB 5EFOA 3WL7A 3MJ4A 2XE6A 2JASA 3GJ4A 4ZCLA 3TTWA 1SIBE 1TTQB 1FSSA 4RLHA 4MUEA 4QBTA 1Z7GA 4QYTA 2OAEA 4PYNA 5HXAA 3X0DA 1HYHA 5E2IA 5IP5A 3OKCA 1JDUA 1UANA 5LPNA 1RU3A 1QIGA 1CC1S 1RNLA 5CT5A 5KYXB 2ZUVA 3LX8A 4GZ6A 1Y9DA 2YYZA 1Y3HA 4IVPA 2QNIA 4PYKA 4RADA 3WYGA 4AG6A 2FPOA 2LKDA 1KXZA 3PD0A 4M8SA 4RVSA 4DT1B 3EGOA 3MCTA 1H85A 4R2MA 2CZGA 1CR0A 2HADA 5AI4A 4BLTA 2X9NA 1FS5A 2X13A 3C5WP 2IS1A 1UFVA 5JAIA 1H4SA 2PBLA 2C96A 1GNPA 5EL0A 3VXKA 4Y6OA 4TRMA 3HN7A 1EVKA 1RS0A 2K4MA 2QW1A 5EAIA 1GTZA 3E1GA 4W5RA 1X94A 1M72A 2W2PA 3FMPB 2R65A 3G5MA 5KHOC 3DCJA 1YRBA 1N1MA 2J7PA 4ZQCB 2XX3A 5G1PA 2H9AA 4RD2A 1Z6GA 1N3BA 2PIAA 2ZJAA 2VP3A 4RPCA 5K8JB 1QYWA 4LDZA 4ZCTA 1NVXQ 1R0CA 1PG0A 2AW5A 3OAAA 5JATA 2Q46A 1TZMA 2IP1A 2UYOA 4MVWA 1LBSA 4D3FA 6REQB 4FDVA 3W5CA 1L7EA 1LLQA 3ASYA 4K0KB 3WIDA 1B7GO 1KNQA 2YXDA 3ROMA 2XMZA 1EXVA 1HE4A 3UT6A 3VSAA 4BQFA 1WE2A 3CW8X 3RS7A 5HDQA 5K3CA 1CR4A 2W6PA 1WQ3A 3HFJA 4GOND 3X2FA 5BOSA 1T34A 1XZQA 4IL5A 2SBTA 1LVUA 2PRJA 2PZAA 1L5OA 4YA6A 2HDNB 1YDMA 5AW1A 1YS1X 1P33A 4R9NA 1MTZA 2YIMA 1BVYF 1KEPA 2RJOA 2TMKA 3NYIA 1N2JA 3G2LA 3T9DA 3TE7A 2HUNA 4AKHA 1T6NA 4MUJA 1I2DA 4A0GA 2CVHA 1FFAA 2NU7A 3KD3A 3JD2A 5L40A 4V0ME 1NJFA 1THGA 4IIJB 1TIKA 4XJVA 3W4IA 2CL0X 1CF2O 1G5RA 3N05A 4RH0A 2R62A 3W9YA 5AIBA 5TT0A 2XMBA 3STWA 1FJXA 5AW2A 1FRVA 1WXGA 1FS4A 4GC9A 1OY1A 2REBA 4GWLA 5G3ZA 2ZUFA 4UU7A 2R7KA 5JLAA 5JCJA 2F55A 3VR2D 2Z5VA 3AR3A 1GFWA 2WZQA 3ER6A 4JBGA 3COJA 1PUIA 4PPNA 4G4IA 3OU6A 5AKGA 3R74A 3VFDA 3BYZA 3Q8WA 5HS4A 5F9FA 3QOYA 5NLLA 1I36A 2EWVA 2HQBA 2YBEA 1Y3BE 2WAXA 2ZRMA 3DWEX 4NL4H 3IXLA 3SYLA 5KNDH 3PQFA 4Q1DA 1NHGA 2E4UA 2ZYRA 4NMLA 5HRCA 4S04A 2OXCA 1YSCA 3QX7A 2HCRA 3GRKA 4MK4A 1JEAA 4Q7LA 2IIPA 4GP9A 1XDGA 4XCXA 2CXTA 4PHGA 4Y6LA 2WAAA 5EJ9A 1UFKA 2DSTA 1AM4D 1FFSA 2GJSA 1SQFA 2GZHA 2K2QB 5LQDA 1WR8A 3NWEA 1U11A 3DEJA 2G77B 2QLLA 4EL0A 5AUPB 1WKVA 3W1WA 3JALA 1QH8A 2XNDA 3I9OA 4AKTA 1K3FA 4WJKB 4AJ1A 2DAPA 2AEEA 2R8EA 2VC2B 4MYSA 3RHFA 1KKMA 3CG0A 3UQZA 3TM5A 3OCWA 4LRXA 5B37A 3LC2O 4UTNA 1AN0A 1KORA 2AL7A 2BFFA 4TTPA 5CBPA 5JIBA 2VDPB 1DIGA 1EDEA 1JG3A 2XMDA 5FULA 3HRKA 3FDZA 5E8JA 1H1LA 1SC4A 1QQTA 3U7FB 4IRXA 2O3SA 4UBKA 1CY2A 2O8FA 4BVAA 4QNRA 1QQ6A 1ZYUA 3P9KA 3E27A 3AR2A 4U7TB 1Z25A 1OV6A 1X3SA 3U40A 2NX2A 1ZD5A 2EC5A 2D06A 2PGXA 2L19A 4CFSA 4TVSA 1UAAA 3ABOB 4AJEA 1RZRA 4MHOA 3QYAA 1WDTA 5CVEA 2J30A 3IV9A 4CRWB 1E9EA 1HZZC 4R81A 1PVOA 4XB6B 4P81A 4LZJA 4RTOA 4ID3A 4REQB 2BFDB 5GV7A 3MRXA 4PEVA 4XPIA 3LC7O 1E6WA 4BFLA 1UP6A 3DAOA 5C8VA 3GEPA 4K6CA 3IJPA 3LUPA 3QPCA 4IDCA 1US8A 2I3AA 5GGXA 3U7QB 2QRMA 3ZHZA 5CPFA 2SKDA 4BKOA 5CK5A 3X1KA 1V6AA 4W5HA 2KS6A 3C98A 3CBQA 4MDEA 1LLCA 5BW6B 1KEUA 2NO6A 5EQDA 1HE8B 3HO1A 1U4NA 5FXMA 5BPFA 2WFAA 4NYIQ 4FNGA 1TTPB 1LDMA 2AHOA 2YR0A 4LGYA 2LRHA 2QX6A 1BMFD 2CY0A 3FUUA 4UU1A 5DEOA 5FBHA 1HSZA 1MX3A 3UK0A 3WY9A 4FOPA 1XD8A 3E3NA 1BMQA 2Y05A 3IP8A 4KXFB 5JVDF 3TNFA 3H7IA 3ZE2B 4HEA6 1MJGM 3H99A 4JV5B 2QTBA 2FZCA 2NQTA 4ARSA 2E5FA 4LDPA 1GILA 4R1LA 4RK5A 1NVFA 4ZKDA 3UMYA 1QRUA 4JIMA 1UZAA 4Y2SA 1M8GA 2B25A 1VLVA 1Z5VA 2NZWA 3G8DA 3KEGA 4L6CA 4NCHA 1ICIA 3MLEA 4UREA 4X44A 4ZYTA 4Z9FA 5J47A 1N5MA 3LBHA 3E3MA 2F1IA 3KCQA 3PYMA 5BSHA 3AVPA 1W5AA 3D7MA 3EG9A 5I7FA 2OY0A 2YX1A 4JWTA 6YASA 3O91A 5DZSA 2FLKA 1QH0A 4B6QA 5JT1A 3QBJA 3R2JA 1RQPA 1J2JA 2B3TA 3SKYA 5L3SA 3K71B 4FKBA 1NW6A 3KJEA 2XMPA 3L4BA 2VRCA 2N46A 2C2WA 1N2ZA 3E2PA 1VKZA 3MTAA 3EIFA 3QPUA 3CF4A 1ZW1A 4MYHA 3PWKA 1WZUA 1A50B 2QMZA 2DX7A 1I94B 5FUBA 1R9GA 5JEEA 5K99A 2G0TA 2PQMA 4HADA 3PJRA 4WXPA 4OAOA 1O87A 3KUDA 1C50A 2VOEA 5D87A 1XZHA 3GCWA 1YNSA 2BGMA 3N2KA 1E6EA 2NO0A 3VKWA 2B7BA 1MIOA 2ZYDA 1GDDA 3QELB 4N4AA 2D1SA 2YYAA 1ISPA 3DW3X 1PWEA 1YH3A 3QWHA 2V0GA 4UXJA 3EIOA 4QG3A 1F14A 4UHHA 2JEOA 2VHEA 3KZKA 4LYHA 4XDYA 2C7RA 3AQ4A 2IC5A 2CLCX 3HG7A 1OC2A 1ORWA 1AF4A 3QK7A 4KIWA 4NU5A 4DAEA 1OIVA 2JI4A 4PPYA 2ONYA 2IY7A 3A4YA 1H8HD 2C9BA 4FD3A 4OYYA 2QHXA 4R2WA 3TZ6A 4GM1A 2JIPA 3A05A 3DEHA 1PHPA 1LA2A 1SMKA 3NETA 4WY8A 1ZHHA 4CG3A 3AVUA 1OIXA 3GT7A 3D8TA 5KVCA 2NSYA 5L53A 3UICA 3AKDA 1Q44A 3ROXA 2XB8A 2RHTA 3RVNA 3ILYA 4ER6A 3GJZA 1YUBA 2VBFA 4GHWA 1KDVA 2HXSA 3B36A 4DMLA 5I51A 3ENNA 3I9JA 1GTL1 1IOVA 2FOXA 4YI5A 3VO1A 4RTRA 1JQKA 1UQRA 3PL1A 5TS2A 1VBMA 4HTFB 4QYIB 3OIDA 4LYFA 1OZGA 1WPRA 1BS1A 2MJLA 3BH0A 3KXPA 3LVBA 4C06A 3GT3A 4D81A 4UCQA 3ET4A 2FRDA 1CNMA 1XKXA 4F3KA 5HM6A 2DPYA 4EGFA 3W6ZA 1Z34A 4LYAA 4L0CA 4P22A 4TLDA 1QRTA 1MW8X 1BXRA 5ECGC 3WGHA 1KETA 2AXNA 2AKYA 3BZUA 3M5DA 3MMNA 1IPFA 1ZH6A 4QM7A 2EP7A 3GGDA 1Q0SA 1ZJWA 3AHIA 2XGGA 3TTYA 4JA0A 4DPKA 3NR2A 3VZBA 3HR7A 4YPFA 1Y34E 1POXA 3I12A 1TC1A 3AOEA 1KMQA 4J0CA 3B89A 1PN3A 2D0OB 3MOIA 1LK5A 3K4PA 2OD9A 3THYB 1BMTA 2XOXA 3IVXA 3LAWA 1RYDA 2LCFA 2JD1A 2ZBVA 2ZZKA 4RPLA 3IALA 3A6ZA 3DZBA 1EGHA 4NBNA 3ZWAA 3ZTYA 4CI9A 4E2FA 3BAZA 2NTJA 3GVHA 3LRPA 1JG1A 3NWPA 4GWGA 3LO5A 5TS3A 4XVCA 2JFGA 4HY3A 1JI3A 5AQEA 4XB1A 4DQUA 5K3BA 2NPIA 2VSQA 3TNDA 3O3OB 4XTCS 4BNUA 4P8RA 1KOLA 3L6RA 2ZQ5A 4FYVA 1KDOA 4M1ZA 5BWLA 1DJPA 3KVVA 3C6XA 1K88A 4NCXA 3IKJA 2QSZA 3ZNNA 4J8PA 2PANA 4ZO6A 5D3KA 4A91A 1PJ3A 4F4IA 2RSLA 4LDQA 3C5CA 1HLPA 1YNOA 2BFCA 2VBIA 1PFYA 1E5DA 1FLDA 1PUJA 2BZSA 2YQ5A 1T8WA 3OZWA 5IC5A 3ZEAA 3AF6A 1D1PA 1I6KA 3NHBA 5J4HA 1NASA 1MJGA 1ODSA 1RWWA 1UINA 1XKQA 1TYDE 3KSUA 2JCGA 3IVAA 3MMSA 3OE7D 2ZJ0A 1XJCA 3TYXA 4WKPA 3WNCA 1MZVA 2Y0PA 4I5IA 3NHKA 4DDKA 2QVXX 2W6JA 3AJDA 2RGGA 1XQ1A 3ESZA 1EP3B 4QOSA 2JW5A 3CRMA 4KP7A 4OH7A 3GROA 2HNKA 4JXKA 2F6RA 2VHWA 3CB4A 3OZBA 5FR2A 1KAMA 4J75A 2XTNA 3OWXA 1JIKA 1VJDA 4D6YA 1KO4A 4C7JA 3UCFA 3R9IA 4QQFA 4PFJA 3HJCA 2POCA 2WKWA 3CX3A 5LZ4A 2WHPB 4S0XA 2H54A 3FFWA 3UUFA 4A0QA 1EFRD 3DONA 3QW2A 4IDPA 4EJ6A 3GLVA 2DULA 1GDTA 5EIAA 4NZPA 3H4IA 3ZH2A 4EATA 4YFVA 3DR3A 5HOQA 3G5TA 3JD3A 4PANA 2MSNA 1XXLA 3TRHA 3SC6A 4LWPA 2A0YA 2GFQA 4P7KA 2JFWA 3CZ9A 1Y33E 3A3NA 2LDBA 1LF0A 2JEZA 5GQSA 4QUHA 4DJJA 5A5VA 3A9WA 3QVOA 1U9IA 2F1RA 4B84A 4BVFA 2JL1A 2UUPA 3UJNA 2GEBA 1NHWA 2BBTA 2JGMA 3AR8A 3JQRA 3O83A 3BS4A 4HGPA 4HQLA 1QIIA 4Z8XA 3R8CA 2XJ4A 3AUJB 3VBEA 2JIZD 5AKYA 1VHQA 2Z6QA 1S2MA 3E61A 4FILA 4ZQGA 1JZQA 5K51A 3R6GA 3AM1A 3RSZA 3VR2A 1BYIA 1KQOA 2OB2A 1KNXA 2QMEA 3EDMA 2GM5A 1AZTA 4E2XA 2W43A 1Z36A 3T9AA 1UPUA 1UZMA 4M8IA 5ILQA 3PWZA 1H2ZA 1UM9B 4J29A 5JJ5A 3GP5A 4QKQA 2R84A 1VKJA 1I6MA 1V8BA 5T4EA 2GLTA 2JAUA 3A9VA 3GI1A 3EQ8A 1Y4ZA 1DAHA 3F6CA 4L85A 4UM7A 2X3UA 1N9GA 3ICOA 3HCCA 4HP8A 1IBSA 4ZJYA 4HRXA 3SGLA 1JB9A 3GAAA 1MJ5A 5MN5A 3GUYA 1Q83A 3D8NA 4FBGA 4H0CA 4RH3A 4DLUA 1TUEA 5JNTA 2Y1GA 1Y98A 2OCBA 2KJQA 1OHHD 4CMIA 1WBBA 3VVCA 4IMRA 4HAUA 3CN7A 4H31A 1NJ6A 1JNXX 1BXKA 2GFHA 3PE4A 5CLIA 3FSEA 1OPRA 3C7AA 3NM5A 2YMPA 4KDFA 4P6VF 3RIGA 5LU9A 1ZVVA 5DN6A 4AJHA 3EQ9A 2F90A 4MIKA 3BBLA 3FOZA 2J41A 2PL9A 1KJ8A 5DGXA 3ANNA 4HAYA 4ABTA 2O8FB 3TW8B 2C9OA 4WCFC 2C2MA 1HRKA 1XDWA 3WWYA 4C6RA 2AHRA 3SZOA 3FPGA 3A9CA 3DP9A 1WV1A 2R47A 5B1YA 4PPFA 2DB3A 2G83A 3FJOA 1VI6A 3GNLA 1U7XA 2G25A 3NYQA 1JH8A 2Z8XA 3RT9A 3N87A 5I7EA 2G9UA 621PA 3GXOA 5EIHA 1UMCA 2WTMA 3NXKA 4HAXA 4KIGA 3I01A 1Y6ZA 5KJFA 3NTXA 1U5BA 3MAGA 3OTWA 4E5NA 1JEYA 1T4MA 1X2BA 4KPUB 4UBIA 3REFA 4X6XA 4YJHA 4DLLA 5L6LB 2Q3JA 2HSWA 1O58A 3L0IB 4FINA 2JBHA 4I3FA 4OXYA 4OMDA 1R6DA 4TQ9A 3FX2A 4YUXA 1IU9A 4RVHA 4IUBS 4OHZA 2ZE5A 1XMPA 4AF7A 1KDTA 2POQX 1CBUA 1XEXA 3HWRA 4BDTA 4MCIA 3BGDA 1V5FA 1D0SA 4H4EA 4WY5A 5KSPA 5JO0A 2ZB3A 3EZFA 2B5WA 3PIIA 3TQOA 4DLTA 2JZNA 2WQ6A 1RWBA 5A6SB 2EJCA 2QZZA 2QJWA 4CCYB 3B2QA 1VL5A 2Q4DA 3L8EA 5CPBA 4ECAA 5EWJA 3EZ7A 2QRQA 4TS4A 2IH4A 2J0UB 1C3LA 1OVGA 2IHYA 3R0XA 3UAVA 4GNRA 1BMFA 4J94A 1YQGA 3R7WB 1MVNA 4WESB 2J6HA 1LW7A 3QG1A 3R3ZA 1NOIA 3HBNA 4LCEA 2DBVO 3B52X 4GNKA 4NU6A 5K3OA 2O5CA 4MKFA 1Q3HA 3LHKA 4XVQA 2W22A 4X0EA 1XZKA 2C84A 1Q1EA 2BM1A 5JBNA 4A1OA 1UEIA 1YR2A 2HWYA 3TDKA 5EHNA 2HJHA 4RF2A 4C3ZA 2ZRQA 3OLWA 1U1FA 3F6YA 4MJLA 1YE5A 2VZEA 4DL9A 2I65A 4PYOA 1Z2NX 2CNWD 2Q0QA 4MTLA 3QV1A 2WQZA 3L1UA 4Q7MB 4F1WA 1YMQA 1RQNA 1UPTA 3JTMA 2DZDA 4KWTA 1NRIA 4O4IF 4KXQA 3IJRA 1JHVA 4QDZA 4ZA2A 3U3KA 3W06A 3KKPA 3RRFA 3BPSA 1S2GA 4JODA 1CTQA 3VR5A 1O5IA 4BB9A 1E8DA 4RUKA 5JC8A 4HQFA 3HB1A 1CE8B 4E5YA 4LBZA 3D4PA 3LBFA 3ZHRA 4CDNA 3PQCA 1RABA 4MIEA 4C2TA 1VL1A 4CQJA 4XJSA 3EY9A 3U9TA 5E3IA 4EG6A 1BDBA 4JI5B 1J09A 1L5YA 1RHUA 4G36A 4QM6A 2BTQA 3F5SA 1CZLA 1N78A 5BNIA 1PO7A 1RYMA 1T6YA 2D3WA 3SEAA 2F9MA 1EVQA 1YBAA 1WXQA 2LNDA 5DP2A 2YINC 3NORA 4RGBA 1IM8A 2Q49A 3MVEA 2I4MA 3DL2A 3OT1B 3S70A 5ALLA 4CTMA 3OPQA 2ZSAA 2P5UA 3PIRA 4LHEA 4IKPA 1M6WA 5IDYA 1GDHA 3VJMA 2DPHA 1CW2B 2C94A 1GUAA 1DAOA 2H29A 1B6RA 1T6XA 2CGEA 1WXIA 2JFOA 2JFZA 2LZ0A 3QU4A 5GAJA 4UAGA 1C2YA 1O7JA 1YZKA 2H65A 1ZM3A 1EE2A 2ZBQA 3H65A 5ALSA 4BQEA 2R9VA 3OD1A 3MTIA 1TZ2A 4JNKA 2H52A 3OX4A 4ZAGA 5IYZB 4KFTA 1QE0A 3MMPA 2R751 2F4NA 1G4UR 4DWJA 4ZJUA 3ETEA 3NP9A 5BN1A 2HWWA 3PBKA 3C39A 4YRNA 3AKZA 3TZHA 4LZOA 4JUFA 2NUTA 2FW6A 2J9RA 4WZAB 5H4HA 2QVCA 4OQQA 1JIVA 2V58A 4II2A 1Y5IA 5FUVA 3RUDA 1WQ4A 4N7MA 5EXXA 3ZI7A 5A2GA 2YN4A 1SU8A 4F45A 1PEDA 2DFVA 3GFGA 4LY9A 4BGEA 4R3UC 3T7AA 2ZLBA 2AMJA 3QA3E 4GPAA 1XN4A 4U02A 3GRAA 4QJIA 5GZ1A 4JI7B 1AG9A 4LXYA 2FXIA 4QDKA 2DQ4A 5KTOA 1QGED 1RAHA 5GZ6A 2GCEA 1R0LA 1PGNA 1KS9A 5JNLA 3HR8A 4GX2A 1PNRA 1TKAA 4D6PA 4YV0A 3LGXA 3KR9A 4AC9A 1GJRA 3H2BA 2B1GA 4JP8A 4AZ3B 1M1NA 3WDSA 1DPGA 4GMFA 2NADA 2E4ZA 2I2WA 3F5DA 4BC0A 3ZHVA 1SXJD 4S1OA 2COUA 4M1EA 5DGHA 2JD0A 4G8DA 4CV2A 1RMYA 5JXGA 5K0LA 1NI4A 3AY6A 4GD3Q 1U9ZA 5FDFA 1TJNA 1V7PC 2JA2A 3OC6A 1J7JA 4ENUA 4TL8A 1SHLA 4GUDA 1JLSA 3MG9A 1K6MA 3EGIA 5D84A 3LK6A 4JVMA 3H5WA 3GD7A 4X6LA 1L9KA 2VUIB 2WJIA 4QGFA 1HQCA 2X2FA 2C1EA 3W5DA 3W8DA 4WOBA 4II7A 2XRFA 1VIVA 5AJVB 2VNKA 5L3ZA 1V8ZA 1F2UB 4MRNA 2ZT5A 2XEXA 2J7PD 4YRFA 4AIRA 3OZSA 1AMNA 2OBFA 2HPZA 1SUBA 3PA6A 4DQXA 1XK7A 2HA4A 1KP9A 4C7MA 1IHPA 4U5QA 4ZQEA 1MTOA 3L1HA 1JSZA 5KSOA 4N0PA 1KR2A 4V02A 4BLSA 4D26A 1NBOA 3C8MA 4M83A 3FROA 2W83A 5EFZA 1QG2A 1NLFA 1H94A 5A3JA 2YXBA 2BKEA 1OQAA 1RHKA 4NOJA 4R8RA 5THXA 3GLFB 2O2SA 2X7JA 2LDXA 2RC5A 3C0KA 1C9KA 4N8DA 4PINA 2C61A 4KWCA 3FZYA 4DDHA 4BNMA 1E1QD 1M10A 1MLDA 3LYHA 1O97C 2Z30A 1XRSB 5TT1A 3IUEA 1MJHA 3JQ7B 1EHCA 3R4CA 1CX9B 2QQ0A 3INRA 4BUZA 3FCSB 4HLDA 1HA3A 1SHKA 3PTZA 4BXOA 3MN1A 1BE0A 2JJYA 3AERB 3UM9A 3IIIA 4HFNA 4G1FA 2W0MA 3IMEA 2C7GA 4KTVE 3U0BA 4YK7A 1BHJA 3DNMA 4IIHA 2YKGA 5DSXA 3GUZA 4LY3A 4RVCA 4CKEB 5IJWA 2OFOA 4GECA 4NE2A 4W8HA 3X2SA 1GA4A 1YB4A 3WLHA 2QD3A 4D9FA 1RHQA 1SKYE 3B6EA 4IS2A 4X3PA 5EXTA 3WOVA 4DKXA 1Z73A 1NDHA 1OLUA 4MJ3A 4EI7A 3LBAA 3T5GA 1Z7EA 2C4WA 1EUCB 3C4VA 5LNK1 2QPOA 3NH9A 2BM9A 1EFRA 5EEGA 1A97A 4RGYA 4D74A 1YZLA 3O03A 1OXKB 4OGFA 2AZXA 1FA9A 1PGJA 1DBRA 1WU8A 4ZT4A 4MCAA 1PR5A 3KQYA 3EODA 5GIPE 4TX1A 5BSMA 1AKNA 4HGRA 3RK1A 2J9ZB 1UFRA 3DMDA 2Z56A 3DT9A 5HEKA 1V26A 2BC9A 5FWDA 1NF8A 3CIFA 3IVGA 3KR1A 3PCXA 4J0EA 5CHYA 4L3WA 4PFSA 4RE6A 5H81A 1KHHA 2X76A 4K6HA 4RM3A 1NIJA 3DO5A 1Y5RA 2W6JD 2VAMA 3PP8A 3NTLA 1DAIA 4TTJA 5ECDA 2ETXA 5HX7A 1X92A 4FMCF 4BVBA 1WD5A 1X1DA 2O3TA 4KKVA 2A5DA 5CFNA 2FETA 2MIIA 2OK8A 2OM6A 3B1VA 1CUAA 4TS9A 4EUSA 1BVHA 4M0FA 1XTIA 1XZCA 2JVJA 4ZK2A 3V8RA 4ND7A 4URFA 2UUCB 3H4TA 2JGIA 3LBNA 4LBYA 4ESVA 3MJVA 3VNSA 3MQ2A 4CMIB 1GAEO 1C1XB 2XUHA 3B9QA 1NBMD 1GPBA 2RKOA 3NP7A 4HI0E 2D1YA 5J1TB 5I7HA 5JY6A 2YL2A 4P0TA 3Q3IA 1MV8A 2X7HA 2ZDQA 4JCCA 4W5QA 1MABA 5IWCA 3QM1A 1NAIA 3TN7A 4E11A 5B4TA 4FSXA 4C20A 4CGYA 3GN2A 4LJ7A 3HHPA 1YOVB 2R44A 3BXZA 4QEKA 5C32A 1YA6A 1UQTA 1D0IA 2V4ZA 1KKLA 2OAP1 3GWGA 4ZMSA 1YTUA 4AG5A 2P4EA 2QRJA 4TOIA 4OSPA 1X0VA 3ZYZA 2FRVA 2E4XA 3L7JA 3ZZMA 4G97A 4EHAA 3H2ZA 1D09A 2JCXA 2QLJA 4HJRA 5AVJA 4X66B 1Y8QA 2OUKA 3LA6A 3U0VA 4P4SB 3UYLA 1UC4B 3NUQA 3NYRA 2QD1A 2FR8A 2VXYA 4D4GA 3I1YA 1XRNA 1E7WA 3HDHA 1QPGA 2ONZA 5IAKA 4ZI7F 3JR7A 3BWXA 1EFPB 1D2EA 3KQQA 5WRFA 1Y6RA 3IJEB 4WE3A 2QLMA 3BMXA 3IV6A 3ROPA 5J4YA 4PO1A 3T5DA 3SLGA 2OP1A 4M60A 4X6YA 4EFLA 4JUDX 4M3NA 1OWNA 3OUTA 1D3AA 4PIVA 2HDHA 1TGYA 1KYVA 1SKQA 4QGSA 1S3FA 3GV0A 2F4VB 2DHEA 1A5AB 2EKPA 1QHHA 2HSEA 2UZIR 5BXYA 4TYYA 1ZN9A 2VAVA 3QFCA 4UPDA 3V4PB 3ZU3A 1ZIDA 1I7NA 4O2RA 4CMBA 4F5YA 2ZB4A 5JSUA 1WVGA