3B3JA

The 2.55 a crystal structure of the apo catalytic domain of coactivator-associated arginine methyl transferase i(carm1:28-507, residues 28-146 and 479-507 not ordered)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
332
structure length
332
Chain Sequence
AVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-arginine methyltransferase CARM1
publication title Functional insights from structures of coactivator-associated arginine methyltransferase 1 domains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 101
structure length 332
sequence length 332
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2007-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
A PF11531 CARM1 Coactivator-associated arginine methyltransferase 1 N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 3b3jA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3b3jA01
3UA4A 1U2ZA 3ELUA 4AZSA 3DOUA 4QTTB 3R6TA 4PYLA 4OQEA 3GWZA 1R8YA 2OB1A 2DPMA 4G56A 5HIKA 2FPOA 2LD4A 1KYZA 2AS0A 4L7VA 3S68A 5E9WA 4RTKA 10MHA 3FTEA 2ZIGA 2EFJA 2O07A 5GM1A 2FRXA 1IM8A 3UJBA 4C4AA 1P39A 1QAMA 2R6ZA 5E1MA 3VSEA 4M38A 1X19A 3KQTA 2B25A 1ZKDA 3UJ6A 4FZVA 5DX1A 2AN4A 4DCGA 3DH0A 3THRA 5K03A 4U7PB 5HFJA 3E7PA 2PV0A 2PVCA 3DUWA 5CM2Z 4M36A 2JHCA 3MTIA 1FP1D 3SR4A 3T7SA 1HNNA 4GUAA 4GBED 1I4WA 2QM3A 5E1OA 2AOVA 1JSXA 1UFKA 5FCDA 1EG2A 2FHPA 3BGVA 5FTWA 1VL5A 4A6EA 2AVNA 1D2CA 3FUUA 5DM2A 3RIEA 5LQNA 4PYQA 1KPHA 1SVUA 5K09A 1X1CA 3RW9A 4C06A 4YV0A 4X1OA 5E8RA 2IIPA 4JXJA 2VS1A 1AQIA 3HA3A 1YZHA 3C3YA 3BGIA 5DX0A 1VIDA 5ICGA 2PKWA 3GCZA 4LWOA 2ZZKA 4AZWA 1L3BA 5T67A 2G71A 4AX8A 1O9GA 4F86A 3FPHA 5FULA 4OA8A 4PIPA 2XBMA 3GJYA 3DXYA 3JWJA 3P2KA 2I7CA 3UJ8A 4DF3A 4MTLA 4QPNA 3NJRA 3O4FA 4P7GA 1R18A 4DKJA 1SKMA 1RJGA 2PBFA 1QYRA 5E8JA 2IH4A 2GAFA 4OA5A 4QTUB 4YUXA 3TQSA 3SX0A 2HTEA 3UFBA 2Y1WA 5K0BA 3G8BA 1L3CA 2NNWB 3CBGA 2ZZMA 3G89A 3MCTA 3DMFA 3ELDA 5F2KA 5JUWA 3NMUF 2G8NA 2FK7A 4GQBA 1F38A 5E9JA 5DRTA 4AZTA 4QQKA 1RI2A 4ISCA 2EJTA 1G38A 3CCFA 3CJRA 3P97A 3D2LA 4YUZA 1QAQA 5FA5A 5FHQA 2OY0A 2P7IA 4QVGA 1VP3A 4M37A 3GRVA 4RV9A 4FT4A 1YB2A 3HP7A 5EPEA 5K0CA 4ER0A 2IH2A 5KVAA 3FTDA 3FUVA 3OFKA 4H0NA 1VLMA 2FK8A 2YQZA 3BKWA 3QOWA 3TKYA 3NDIA 2Y1XA 3M6UA 3KQPA 1RI4A 3B89A 4DQ0A 3HVJA 4PONA 5EMJA 3GRUA 1M6YA 3PFHA 2ONYA 3NWEA 5B1SA 5G02A 5FADA 3CGGA 2JH9A 4LG1A 4YMHA 3CJQA 1G6Q1 3SGLA 2IBTA 3HCAA 2ZTHA 4QDKA 4OBXA 3GDHA 4HGZA 4PYKA 3A4TA 5T6BA 5LQUA 2UZ4A 3IHTA 3R9XB 2AN3A 2FCAA 4C08A 3R0QA 4ER6A 3KQWA 3G2OA 3FPJA 2PXCA 2ZBQA 1QANA 2NXCA 2V74B 1UWVA 3HVKA 3KR0A 1IXKA 4IWNA 5DTRA 5EVJA 5P8WA 2PWPA 4E31A 4PYJA 5CVJA 1WS6A 4CXMA 4ER7A 4EMSA 1YFLA 1SQGA 4IKPA 4C04A 3M6VA 2KW5A 4KRGA 4B17A 3V97A 1X1AA 3M6XA 3KR9A 3NVMB 4YUVA 1VP9A 4E2YA 3KPYA 1XCLA 2PX2A 3OFJA 2B2CA 5IKMA 5EGSA 3UA3A 2V7EA 2VDVE 4F85A 1TW2A 3MHTA 3PFGA 4QPPA 3HCDA 4P7JA 1QAOA 1JQ3A 1NBHA 1KPGA 4PYIA 4U7TB 3UJ7A 2C7RA 4AUKA 2GH1A 2ZBRA 1DL5A 5D1HA 5DTQA 3RODA 5CVVA 2NXEA 3C6KA 5DXAA 2Q41A 3VC2A 2YTZA 3ER9A 3O7WA 1XDSA 1ZG3A 4FT2A 2CMHA 2ERCA 4ER3A 3EVZA 3UZUA 3IYLW 2QYOA 5DWQA 1KPIA 4X63A 1IY9A 3KPVA 3LSTA 5K0GA 3Q87B 4LWPA 1YZ3A 1RI5A 2PY6A 2GB4A 5FA8A 3LECA 2JHPA 5EOVA 5GM2A 2UYOA 3HCEA 3LPMA 4V0QA 1NV8A 1X1BA 3KQMA 5EQJB 3KPJA 2OYRA 5KQRA 3BKXA 5FUBA 1Q0SA 2B9EA 5DSTA 3LDFA 2GLUA 2NP6A 3DP7A 3R3HA 5EMKA 4RTMA 3T0IA 4NECA 4XUCA 2PX5A 3HTXA 2ZLBA 4ATNA 4KW7A 3LBYA 1FPQA 1UIRA 3P9KA 3QOXA 4PYOA 3KQVA 2OZVA 4RTLA 3G88A 2YX1A 2ZWVA 4QVKA 1VQ1A 3FPGA 3UJDA 4ER5A 2YVLA 5HILA 3HA5A 4M7RA 1L1EA 2ORED 3AXSA 5F2OA 3TKAA 1WY7A 1L9KA 3ELYA 3KQQA 3A26A 3E8SA 3BT7A 2R3SA 2EX4A 2YXEA 3FUXA 2CWWA 5C1IA 3REOA 3G5TA 4E30A 3M4XA 3FYDA 3EPPA 3IEIA 1JQDA 4ZTBA 2P8JA 3NTVA 1XTPA 2NYUA 3BUSA 5F2NA 4GOLD 2ADMA 2C7QA 4HG2A 2GS9A 3EVEA 1NW3A 1EJ6A 1P91A 2PXXA 3SM3A 2ZFUA 4DM3A 5MHTA 2BR4A 3THSA 4MQ4A 3GGDA 3GRRA 4QDJA 2VDUE 4K6MA 5DPMA 4A6DA 4R8SA 4RTNA 3EGVA 5HIJA 3KPWA 2PSSA 3OZRA 3NDJA 5H02A 5E9QA 8MHTA 4HC4A 1DCTA 4GC9A 5K01A 1JG4A 2P41A 5ERGB 1T43A 5CCXA 4MHTA 4CWAA 5DTMA 3PS9A 5EKXA 5GOZA 2PXAA 5DSXA 4GEKA 1H1DA 4XUDA 1G8SA 1JG1A 4DCMA 5E2BA 3LDUA 4XCXA 2AOWA 1BHJA 2O0LA 4HRAA 2Z6UA 4YMGA 4O29A 4DMGA 3PX2A 2FYTA 4RVFA 3NVKI 2JJQA 1JSZA 2CL5A 4E32A 3KU1A 4Y30A 2QRVB 3AJDA 3TR6A 3PLAE 1R6AA 3I64A 3O31A 1JTFA 4RTQA 3OE5A 3L8DA 4P7KA 5DM0A 5M5BA 2ZIEA 3CKKA 2OBFA 3EMBA 3HA7A 4BLVA 4EKGA 2UYHA 3FUWA 2BZGA 3EVFA 3I5UA 4BLWA 5BW4A 3M6WA 1R8XA 4KIGA 1O54A 3UJAA 3TM5A 3C3PA 1JQEA 3MAGA 2HWKA 3EVGA 3SVZA 1KP9A 3SSNA 3A27A 2F8LA 1PRYA 2YXDA 3MCZA 2PGXA 1BC5A 2NXNA 3GNLA 3P9NA 2O05A 3JWGA 5EZSA 5K0LA 3AY0A 3PTAA 3H2BA 2HR1A 1KYWA 1NKVA 4RYLA 2ZULA 5DM1A 3TM4A 1RI3A 2B78A 2A14A 4RVDA 1NW5A 3HCCA 3P9CA 4GOOD 1WG8A 3M70A 3G2PA 4GC5A 4KDRA 3SMQA 4RTRA 4PINA 3KQSA 2C7PA 5HZMA 1YF3A 1ORHA 3VC1A 4FP9A 2EJUA 5EIWA 5GIOE 4EK9A 2JHAA 1N7IA 4XUEA 2WK1A 3UWPA 3T7RA 3QV2A 1M0EA 3ERCA 1ORIA 2YR0A 4DZRA 3TFWA 5GINE 4RVGA 2Z6QA 4KDCA 3BWYA 2C7OA 1YUBA 2EG5A 3FTFA 2QY6A 3I58A 3UJCA 5BP7A 1XXLA 3G8AA 1AQJA 3OPNA 2G1PA 1MHTA 3DMGA 2OKCA 3DR5A 2XVMA 1KXZA 2BM8A 3V8VA 3FTCA 5C0OE 2IDKA 1EQAA 3C0KA 3I9FA 7MHTA 1WXWA 3P9IA 3OU7A 1OR8A 3GRYA 5LQCA 1VPTA 1R00A 3P2IA 1ZGJA 1ZQ9A 5ICFA 4C03A 1YFJA 2IGTA 3FRIA 3LCUA 5D1NA 2QE6A 2PT6A 2XVAA 4RX1A 4CTKA 3ME5A 2AOUB 4DA4A 4PGGA 3AXTA 2JG3A 3G2MA 1KR5A 1EAMA 2ESRA 5BW5A 2I9KA 2IBSA 9MHTA 5GP1A 2P35A 1NV9A 2OXTA 1L3IA 1WZNA 5FWAA 2BR3A 2DULA 3FYCA 3GXOA 3OU2A 3P8ZA 4CKCA 3EMDA 2G72A 2UYQA 4BLUA 1FBNA 2E5WA 4Y2HA 5CUQA 3MQ2A 5LSAA 2ZCJA 1Z3CA 3HCBA 3GIWA 1RJFA 2P1DA 1VBFA 3CJTA 3X0DA 3DLCA 3OZSA 4PCAA 5E2AA 3CC8A 2HNKA 5GWXA 4Z2YA 1O9HA 1NBIA 3TRKA 1NW6A 2PT9A 2PX8A 4IV8A 5ICCA 2HMYB 4PYNA 3HNRA 3Q7EA 4EQZA 4PNEA 3BWBA 2AZTA 1RJEA 2QRVA 2ZBPA 1V39A 4WVLA 1N7JA 1M6EX 3LKZA 2I6GA 2IPXA 3BGDA 3KHKA 5FQNA 2YUIA 2ZZNA 4FGZA 3NWBA 3MERA 3TLJA 2XYVA 2H00A 4UOEA 2XYQA 3FUTA 4LECA 1EIZA 1SG9A 3DXXA 3EVBA 4GF5A 3BXOA 3A7EA 3KR1A 3T7TA 3M33A 3BWCA 3GO4A 1JG2A 3DMHA 3EVCA 3NW9A 2UYCA 2O06A 4PYMA 1TW3A 5EZQA 5IH3A 5CD1A 2IH5A 3KPUA 2YXLA 3TPZA 3TMAA 4R8RA 1NW8A 3DXZA 4MIKA 4BP3A 2HV9A 3OE4A 1QZZA 1D2HA 3P71T 2ONZA 1RJDA 4EKIA 5CIYA 3B3JA 4HSGA 4HTFB 4P58A 4CKBA 3IV6A 3LCVB 1NT2A 3PB3A 4CKEA 5LQRA 5GIPE 2O57A 3E05A 3ID6C 1D2GA 2AOTB 3LX6A 4FSXA 4F84A 3ELWA 1FJXA 1ZGAA 3CVOA 1SUIA 5HIIA 3E23A 4RWZA 4V0RA 4YV1A 2P3LA 3JWIA 3K6RA 3EGIA 2AOXA 2OB2A 2ZIFA 5KYGA 3WSTA 4RTPA 4POOA 5DT2A 2AN5A 1AF7A 3PVCA 3SSMA 3OU6A 5K0JA 4BY9E 2VDWA 3HM2A 3F4KA 3K0BA 1XDZA 3LBFA 5HEKA 3UJ9A 1NE2A 2H11A 5DX8A 5EKUA 3B5IA 3EVAA 3KQOA 5ICEA 1SQFA 4C05A 3ORHA 2VP3A 3JWHA 1BKYA 2ZWAA 5EIFA 3UBTA 3KR2A 5EHIA 4KIFA 5E1BA 5EHGA 5EEHA 4E33A 5FHRA 5K0NA 4R6WA 1INLA 1Q0TA 3GRZA 4PWYA 4E70A 2WA1A 3SXJA 1P1BA 3LCCA 1X1DA 2AOUA 4PGHA 3A25A 2NXJA 4R05A 3DULA 3MB5A 5CVDA 3B3GA 4X41A 2CKDA 3MTEA 3EGEA 4C07A 1XJ5A 1G8AA 1MJFA 5K8VA 1XDUA 1JG3A 1F3LA 4E2WA 1KIAA 4RTJA 2IDJA 2K4MA 4IV0A 2N47A 5K0EA 4YUWA 2PWYA 1I9GA 4KWCA 3G2QA 3FPEA 5DRYA 2OO3A 3EVDA 4X60A 3B3FA 5U4XA 5DXJA 2ZSUA 5DLYA 2AR0A 5EMMA 5EC8A 2I62A 5K05A 4FS8A 3P2EA 5C9ZA 3DTNA 3KKZA 1NW7A 2OPBA 2AVDA 1BOOA 5EEGA 3OZTA 5LR6A 5BXYA 2P7HA 2NP7A 2G70A 1XVAA 4E2XA 2XYRA 5FWDA 1PJZA 4EVIA 4GOND 4YUYA 5LQAA 3KQYA 1N2XA 3HVHA 1WXXA 3FPFA 3EEOA 4RTSA 2Z6AA 1AV6A 5EG5A 4OQDA 1HMYA 4GOMD 2ZW9A 3LHDA 5T64A 4MWZA 2BR5A 2H1RA 1DUSA 2BM9A 2P40A 2JH8A 4PCLA 3MGGA 2WA2A 3FRHA 4P7FA 3G5LA 3AWIA 4HTFA 5HOQA 2B3TA 4YV2A 2IP2A 4RSRA 3BWMA 2BH2A 4OBWA 4FSDA 5HIMA 1R74A 5EMLA 4OX9Y 1EJ0A 5KS2A 2AOTA 1KHHA 3B7PA 3HCFA 5DM4A 3DLIA 1P1CA 1B42A 1JR4A 1RI1A 3OCJA 3C6MA 1JTEA 5CVUA 2PJDA 5CCBA 4FR0A 1ZHFA 1SUSA 3I53A 3R24A 3EEYA 4CTJA 5JR3A 1VE3A 5CVEA 1G60A 1G55A 3G7UA 4WXHA 3TOSA 4AZVA 5K0FA 2GPYA 4X61A 3A7DA 4HGYA 3HEMA 1Y8CA 2IFTA 3VYWA 1XCJA 4KVZA 4QQNA 3GU3A 2ZVJA 3ER8A 4PIMA 3LGAA 1I1NA 3BZBA 4RVHA 4HH4A 4BP1A 3HVIA 2CMGA 3FZGA 3SSOA 3LDGA 4RTOA 2VZ9A 3PT9A 4R6XA 5LQKA 2P3QA 5LQJA 3LKDA 2P3OA 5E1DA 5FQOA 2PLWA 3ANXA 1FP2A 2GA9A 2PX4A 3LL7A 3PX3A 3U81A 4E2ZA 5KQSA 1TPYA
chains in the Genus database with same CATH superfamily
4G0QA 1OFUA 3C41J 3GZTB 2VH1A 5LA6F 1PHRA 2ZIZA 1UJMA 3NEPX 1L5HA 2FWJA 1CZKA 1D7AA 3IQXA 5K6TA 3HJTA 4WE3A 3FIJA 1PS9A 3FDFA 1N5MA 1AS0A 1B8NA 4M8NE 3B53X 4JJ8A 3DWGA 3W8RA 1KYZA 4L7VA 5EVCA 4GH5A 4C4TA 3AEYA 4JX9A 1YQEA 3MCUA 2QTVB 5C8VA 3F7OA 5YASA 1TVKA 1XMJA 3INTA 5G41A 1YT5A 1KU0A 4TLBA 2IYRA 4RKYA 5FUYA 1GAWA 3O9ZA 2RHGB 4S35A 5DI3B 1X13A 2ORWA 1KVTA 4OQMA 3RNLA 2PV0A 1I7QB 1JQBA 3I83A 4DUYB 1BDHA 1Z7YA 2W71A 3STTA 3WAKA 3J80A 4MW4A 2H2WA 5JMTA 2R4TA 3LFHA 5L45A 5FCDA 3P0RA 4OI0A 3PXCX 3K2IA 4M1ZA 3JWEA 1DQSA 1KHTA 4ZHQB 4UBOA 3RW9A 5A2GA 3INYA 1XZ8A 3PJRA 4W5OA 5K8TA 2FMUA 5AW7A 2PUJA 3HKBB 1SXIA 2H16A 3KLNA 4UEQA 3DPIA 1B4DA 3UCFA 3FOCA 2Z2IA 4DFDA 4K03A 3ZY5A 3GCZA 4LMAA 1S8NA 3IP9A 3OPVA 4WSOA 2ODWA 3JQQA 4D2IA 4F86A 1A96A 1T34A 3HNPA 4JHLA 4BVFA 1GZDA 4DDMA 5KQGA 1QWOA 3DE7X 3JWJA 4IGFA 4KFTA 3GPBA 4N0MA 3VSCA 4DJFC 1Z7WA 2C5LA 1L4KA 4YAGA 1F8YA 1ZJ4A 5CT9A 2IPMA 4ZQIA 5GZ3A 5LWQA 1RDFA 2JFXA 5F1PA 1DO8A 1KYVA 1S6YA 1SCJA 1Z0AA 2O3RA 3H8WA 1KSFX 1CUZA 1SQ6A 3MQFA 4LK2A 4PAQA 3E22A 3RVOA 2HTEA 3UFBA 1Z4LA 3MJRA 4BB6A 4GR5A 2UKDA 3EFOA 1L3CA 1LNZA 4ZT3A 2JCVA 1RTKA 1UWCA 4EPXA 1R0CA 3VZCA 1KJ8A 2ZUDA 1H2HA 3PXEA 4IFEA 1TAHA 3U0BA 4CODB 4D9EA 4OJQA 5KWJA 1TTTA 3PC7A 2NSJA 4JJKA 1REQB 3QLJA 2FW8A 3CTPA 1AM4D 3CJRA 3P97A 4P1ZA 2Q1UA 2NQ8A 4W1RA 5BWCA 5JE8A 4DPKA 2J0SA 1L8OA 3JALA 1VP3A 2D4HA 1ECCA 1PR5A 2I2XB 4J16A 5FLYA 2FN4A 4HP8A 1Q3KA 1W581 2P75A 2WYIA 1E7MA 1IOWA 1NM5A 1MPTA 1E2KA 4JZYA 2EBUA 2P4UA 3IQDB 1KJ9A 1FUEA 2WD8A 4H0NA 2FK8A 2YIDA 1GCIA 1M9NA 2V6IA 2A7QA 3NDIA 3L0SA 3M6UA 4FNOA 1CSEE 2O9JA 3ZWNA 4E1BA 2X4GA 3L4BC 5TE9A 2HA5A 4EKEA 1W47A 3DONA 3ZHYA 1GITA 1R5NA 4IO0A 4W5WA 4FWTA 2ONYA 4D8YA 5FADA 3SMVA 2QNBA 3CX4A 3TLCA 2WMYA 2W8BB 4QDKA 2R8PA 1CYDA 3V6LA 3TN7A 4M1EA 1L4EA 2R1VA 4OI1A 1IJFA 3D8HA 3HDYA 3OLYA 3DVQX 1Z45A 2VP5A 3BWXA 3EZNA 4TVBA 4ER6A 1DG3A 3E1KA 1G3QA 1WP4A 2I6FA 4E31A 1JKIA 3DVLA 4FXPA 5JCPA 2WWGA 1YKFA 1NBME 2WYUA 3T3HA 3F97A 3COJA 3KOYA 1T9GR 5EIXA 2IHNA 4D8TA 3VZRA 2H7YA 3K1TA 4TTIA 4I6GA 4II3A 3QVWA 4AT1A 4R51A 4LC9A 4P5DA 4U9UA 4CKZA 3SJBA 2ILTA 1PWXA 3G9QA 3ONWA 1IHOA 3EQ8A 1FDUA 3KUXA 2P9BA 2ZPAA 5KU1A 4P92A 2VDVE 1CRPA 1F4LA 3ETNA 1FFWA 1LWNA 4RV5A 3CT4A 3FZQA 3PUZA 4YMSA 3PFGA 3DTVA 3G9ZA 4LTNA 3GAMA 3HGTA 1AO0A 4X54A 5BYAA 1F48A 2X7JA 1QIJA 2WHPA 1KVRA 2XX3A 4PC1A 2G0AA 5FL3A 4KPUB 2V1XA 4D5GA 4BNIA 2VNJA 1GAXA 4D3YA 1ZG3A 3AM4A 4B0OA 1YMUA 2NG1A 1MB4A 2BEWA 3RUFA 3ZW7A 1B16A 4BTLA 1ZR4A 4E5UA 3Q3GE 5H7XA 4DIDA 3GC6A 4WLFA 5FWNA 1ZD2P 5KNCD 5PGMA 3TCXB 1F6DA 1JDVA 1EP3B 1DEHA 3KWLA 1G63A 4JITA 3NXSA 3LECA 1E64A 5EOVA 2FG7C 2F59A 3COYA 3HCEA 1JNXX 2A0YA 3LPMA 2VUUA 4BL5A 3A05A 3OJFA 1Y80A 4D3DA 1TDJA 3ECCA 1TFRA 1KDZA 4Q1CA 4XIIA 1RIFA 2BFOA 2YRWA 3MMZA 1UMDA 2ONCA 4ZEOA 5GIPE 4WXRA 3MUOA 5ISMA 2M1XA 3T0IA 3DMTC 3GGGA 4BO3A 1WCIA 2PX5A 1SUFA 1P45A 3DOHA 1IXSB 4K8OA 1Z0UA 1PR1A 5F5NA 3WL7A 2BGIA 2RHTA 3ZE7A 3RTEA 4ARCA 4TKZA 1P33A 2KSQA 1KNXA 3G88A 3HKCA 3FPGA 4G0OA 1LWOA 1IFXA 2YVLA 4JLNA 2VLBA 3BCRA 4IZ6A 3UHAA 3P1JA 1G20B 1DV1A 1U7DA 2GI4A 5JH7A 1EE2A 3MFQA 2XYHA 1HFWA 4BDTA 1U0TA 2CXPA 1N8TA 2R3SA 2F3QA 4XZ3A 5KREA 1L6RA 4KO1S 2B98A 1K1EA 2ZT7A 1CT9A 2X76A 3R77A 5B1DA 1ZK4A 4L8VA 1RRVA 1AQNA 3C6QA 2WZBA 3LX4A 3RROA 1SZCA 2WAYA 3L1KA 4ZI7A 1Z37A 2KWIA 1EFUA 1S7GA 1WV0A 3B2EA 4F1JA 4Q7KA 3STHA 1I13A 2CLHB 4BMXA 1ODIA 3GGDA 1XFAA 5HKBA 2ZRHA 4R83A 5AO9A 1U4NA 2P0YA 1KL7A 3NDJA 2ZREA 1TF7A 4WN9A 3RUCA 2ANBA 4M0UA 3BRSA 1JG4A 1K89A 1QK3A 1P74A 4OK6A 3UMRA 2RG7A 1TC1A 4PXSA 5KB3A 2OK7A 1H8HD 5B3AA 4E5DA 1WTAA 1P75A 1WKCA 4JY7A 5TPWB 3PHLA 4L75A 3O0TA 1YHNA 621PA 1AJEA 2CK3A 4IXDA 2ZQ5A 3E5MA 1G8SA 3HGQA 4EDFA 4XJTA 4XB2A 1WU8A 4Q7EA 1BHJA 2O0LA 4BVHA 2REXB 1QHEA 2I1QA 2IHKA 2ZR8A 3FZYA 4PFJA 1QU3A 5JQGA 2FFJA 1UIMA 3OZFA 1WO8A 4URHA 3J81A 4BQSA 2XWQA 4UQPA 5JFOA 1R6AA 2VNIA 1AGRA 1EDBA 2ZJ1A 4PV7A 5JMOA 1V7PC 4XEHA 3GARA 4HQRA 3QFSA 5T8KC 4ZMSA 4BASA 2J5BA 1IBLB 4V38A 4H2DA 2ZIEA 1DKQA 3CKKA 3O4VA 4Q1DA 3G17A 5J5VA 1MW8X 5E6UB 1OWMA 4M1TA 3K70D 1XKTA 3AB8A 4FFNA 2Q46A 4Q1AA 5L6MB 1A9XA 2X42A 1U0GA 4JUCA 1MX1A 1Y3HA 2V6MA 1ZJ5A 5AXBA 2RC5A 3E18A 1N5JA 4TZTA 5HJ5A 1DOHA 1EINA 1R0YA 1KYXA 1NR5A 5H3HA 3ZE1B 2O23A 1HG0A 3QEMA 2E4ZA 4FINA 4EJSC 2W6QA 2JD1A 1R4NB 4YP9A 2O05A 1SOUA 3NTRA 3PTAA 2P9ZA 4AUMA 3SVLA 1UOPA 3WLFA 2HR1A 1YAJA 3OZGA 1EK5A 1HQYE 1TEVA 4YAJA 5CA1B 1XD2A 1JHAA 3AMVA 1UQTA 3H0EA 3ZU3A 3RWOA 1I6WA 1T5TA 1HSOA 1J0DA 1E89A 1PT5A 2VI5A 2O3QA 3HB9A 3GVXA 5IYZA 3DFFA 4RY8A 3VJLA 5AKLA 3TDMA 1NQUA 2A30A 4A0FA 2C04A 3B7GA 3BDIA 4B3HA 4GFDA 3GFGA 1WUHS 1O6FA 1COWA 2JHAA 3BTSA 3IIKA 2ONJA 3SNKA 3F4BA 1Q7GA 1WDMA 1Z39A 4M83A 1L7XA 1Z2AA 4KE6A 3UV3A 2RH5A 3M6MD 1Q0HA 2QAJA 4GZ3A 4UEKA 3AEQB 5CLQA 3VA7A 3B51X 4HS9A 1A72A 4NV3A 4L0CA 1VTKA 2VZLA 2JI7A 3DMGA 4OAOA 4Z1MA 3F2IA 4RAQA 4DLPA 2OV2A 4OLBA 5BSGA 4IEIA 2IZ1A 4M86A 2YHAA 3RK4A 1GXSB 2H52A 5JRJA 5ICFA 2IKSA 4E0BA 3ISTA 3LCUA 4CMCA 5D1NA 4S3MA 4IYJA 2Q0SA 1YMQA 5DM70 5AW0A 4BRUA 2JG3A 4KVFA 2H2AA 1X9GA 2JKZA 3BCUA 9MHTA 3EY4A 3WG9A 4S2EA 3ZU4A 4EELA 1W2GA 3VOSA 3WHLA 4IY1A 5FR2A 2PMWB 4H7FA 2QT0A 3SXUA 1G2IA 4NH0A 4BLUA 4X94A 3E5RA 1SBCA 5IAEA 3WRWA 2GD1O 3GB9A 4AXXA 1BWSA 2R7NA 5KOHA 4TYMA 3DLCA 4FHFA 1M2KA 1RWOA 4FILA 4MCIA 5HGJA 4CE6A 1DNPA 3IOYA 5AJHA 3HBAA 4CFZA 3ZGXA 3ZHZA 1ZW1A 4PRYA 2ZUWA 2XZTA 3RSZA 3S6JA 2YHIB 4EABA 1RJEA 2PIDA 5AUNB 1ESEA 3DTVD 2JZOA 3FYHA 2RD2A 3MWDA 2AR7A 4OLHA 3H5OA 4I55B 4Y9UA 5D3KA 2QZ4A 2FU5C 1YDEA 2CCJA 2QM7A 2QX6A 1JAHA 3MRXA 4LXIA 4QTYA 3OQOA 5GJVC 3EJWA 1M7GA 4EHJA 3IE1A 4AZ0B 2WU3A 1KY2A 1Z26A 4WK6A 3VR6H 1JR2A 2IEGA 3DZDA 3LCMA 2W83A 4ZWNA 2QIOA 3BXOA 4TMZA 3T7TA 4PZPA 4TVKA 4DIUA 4LYDA 3CEHA 3VVMA 2UXCB 1NI4A 3K1ZA 4C43A 5CD1A 4UJ3A 1T26A 3FB4A 4RA6B 4FNMA 4R8RA 1NW8A 3SE0A 4LXXA 2E1RA 1RMYA 1R9GA 1QR6A 1OYWA 1LDNA 3AYXB 4ZOEA 4RQBA 1VRWA 3FLAA 3JU3A 3HWX1 1IK4A 2JEYA 2PUTA 2WC1A 2BMEA 1NT2A 3NBUA 3PB3A 4DVGA 3HS3A 1GKIA 1F2UB 1RR6A 4CLHA 4FSXA 1Z82A 3UGQA 1Z18A 5DJ5A 2VJKA 1JFVA 2NYAA 3GZNA 5TPZD 2ZBUA 2J8ZA 1KMNA 4CL3A 3TLZA 2BLNA 1N9GB 4FIDA 4ZHQF 2Y4NA 3A4LA 1FYVA 4CQMD 4X1YB 1XDZA 5JCJD 4IIGA 3NT5A 1B73A 3DE1X 3WLLA 3F0TA 5JYEA 1N6IA 4EI2A 3IALA 4DG5A 5EIFA 3HJGA 3KAQA 2WTEA 3TAHA 1C7RA 3HDGA 4CHGA 1PAUA 1K7FB 5D00A 5A05A 4K2AA 1Y5IA 2FEAA 1NDUA 2C5GA 1GGMA 4YGXB 3LZDA 2XNKA 5KSPA 1FPMA 3M1AA 4UQOA 4W8HA 1J2TA 2J9RA 4MWSA 3V7WA 1UJNA 3S99A 3ADBA 1NTOA 5KTYA 2F3TA 4R7ZA 1NMSA 4TQGA 4EMUA 4F4JA 3SS8A 5BN4B 2CK3D 1BXZA 1P1RA 2HO4A 3I4FA 1FNNA 3NZEA 3R44A 1WMSA 1FU7A 1MMFB 4H27A 1KIAA 2FN3A 4I2VA 1EUCB 2FI1A 5GMOA 2Q1TA 2AZDA 1NVWQ 2GPJA 1IHPA 2WM2A 2PWYA 4QBFA 2YCBA 5G0SA 2Y1LA 1PZGA 1MAVA 3BMXA 4LYAA 4B6PA 3W5CA 4KE8A 1R6XA 4YQZA 5I51A 2E82A 4FZRA 4IKEA 4L8LA 4TM7A 5F77A 3VYSB 4ESVA 2OXIA 2E55A 1AZTA 2QN7A 1CR0A 5EC8A 1L5FA 3EOAI 4QGAA 1R0RE 1HSZA 2M1ZA 4PGMA 2X8WA 4R9RA 1BOOA 4A3SA 2H1FA 5HF8A 4C0BA 3HFGA 3HFSA 3D3QA 1NHGA 2ROQA 2DFPA 2PBZA 3CWQA 2A92A 3HCOA 1SC1A 4KXNA 3T5AA 2GAAA 3DSRA 1QFJA 4INAA 4YT4A 1NFFA 3LPCA 4YY3B 3HDQA 1EQ2A 2JFYA 2COEA 4M7PA 5LBTA 4KQHA 1D8TA 4BLTA 1FA9A 4L4YA 1QYIA 3BE6A 3GD7A 4YIKA 3LHDA 1QK5A 1BHSA 1THZA 4IOMA 3B1VA 2JCBA 1C3JA 3WKBA 5F3DA 2X7HA 3T4PA 2R8ZA 1OA1A 1U3VA 3WLQA 3DKRA 3R7LA 1UXJA 3RIGA 1CDOA 1JHUA 1NVFA 1CNEA 4P5EA 4LQCA 1E6UA 1QQ7A 3JQ6A 5JADA 4JL6A 2C5AA 3TGWA 1UJ5A 1ZA2A 1VYHA 4DG8A 1LI4A 1UK7A 5C52B 4RLHA 1VHDA 5IBQA 3LDAA 1RYBA 5U4QA 2GHRA 2TYSB 4HPXB 1C50A 3KSBC 2PVPA 4DMFA 1R0XA 2FPIB 2M9MA 2Y66A 3H9GA 1RE0A 2XHZA 1G55A 4KHZA 4WXHA 3V7UA 2CDRA 1TU3A 5DLPA 1NXVA 3OMXA 4UHBA 2ZUUA 1SOMA 4FFBA 2QU8A 4IWYA 4Z1MD 1WLSA 1Y8CA 3HXKA 5AK3A 5KWVA 4FFSA 4G4SP 2BRUC 3KELA 5FPYA 4QULA 4PTZA 1X7GA 5I9SA 4ZMRA 1K8QA 3FZGA 4KAAA 2HBYA 5FD8A 4BZWA 5I5GA 2CLSA 4M49A 3PT9A 4BBPA 5CXQA 2CNLA 1LQUA 3QLUA 5FQOA 1JBQA 4Q82A 4YJDA 1Y1TA 1NXWA 2A0UA 4XTCS 4CT0A 5IDYA 5CEEA 4Q3BA 1VKOA 4WAUA 3WDMA 2VHEA 3ZBPA 4CQLB 2BZSA 2RDMA 2RHBA 4J1NA 3TTUA 4RL4A 1B3RA 2QJOA 1WKVA 4O2BA 3ESZA 3H83A 4D9NA 1E32A 3TW4A 3BB3A 3DDCA 2X8JB 4F3RA 1S96A 3E7DA 4P35A 1OI3A 2LDBA 4IHJF 3UJBA 2DF8A 1GN8A 4B6RA 3M3DA 4JWTA 3R20A 3UJ6A 2GM9A 3HRHA 3KYDB 5JPIA 4LXUA 1DKRA 4LDNA 4BNGA 4XQ0A 2H5LA 3D4BA 5G4LA 5JZ9A 1IEWA 2QTRA 5IN5A 3A4IA 2VJCA 2XYGA 1V8DA 4WLEA 4D0RA 4LZWA 3H16A 4RKQA 4YVFA 3F90A 1HV8A 1BKSB 4GR4A 4LBWA 4DBLE 3L4EA 4P0QB 3OQIB 3B6KA 3FUUA 5ALSA 1CFZA 5ESWA 4CCSA 5K09A 4X91A 2N75A 3BD8A 4WCFC 3EF3A 3OQHA 4UNIA 4L3OA 2IE0A 4N49A 1QRTA 4R0VA 3DD1A 5C8YB 1E3MA 3EA0A 1YR9A 2O2CA 4FGWA 2VK4A 4J76A 1RM3A 1S3GA 2GN9A 1A5BB 3Q5EA 3NS7A 3VDQA 4V0MA 2EDCA 2OUIA 4D9GA 4DIFA 5BMVB 3LPNA 2B6HA 3FTNA 2JIPA 4EEKA 2WR8A 5TF4A 2NO9A 4XGRA 3FNQA 3AEUA 4KI7A 1B6GA 3UT6A 3QNMA 2FPLA 2B6NA 3I1FA 4L3VA 3WTBA 2C3MA 1K98A 1K4MA 1UBOS 4RJTA 4AP6A 4QTUB 1JEQA 1HDIA 2JGLA 5FLKA 2IP1A 5L3QA 3ZX4A 3QZUA 1NBMD 5EJ7A 1HH4A 2QMZA 3N6XA 4V3BA 3HVRA 1XL1A 2HA7A 5JAUA 2XCUA 4URVR 4C1BA 3HUTA 4JL5A 2CYBA 2PFSA 4WNAB 1ZUIA 4F4HA 5DIFA 5CMLA 3RT1A 1ESCA 2XE6A 4PZCA 4BB9A 3HI6A 2V03A 3CCFA 3QP9A 5JQWA 3GLFB 2P1ZA 2DQ4A 1Z6AA 2C20A 3DO6A 3K5IA 3RO7A 3RQIA 1ZINA 3BN3A 2Q6VA 2WZCA 4IJMA 2HIMA 1GKYA 4RDIA 3UMGA 1ZN9A 3WKDA 5BSWA 3HP7A 4LW8A 5HSGA 3PWKA 5FPQA 2RK4A 4UQLA 3OQMA 1KZYC 2BFAA 3DB1A 2Q3JA 2IOYA 4D99A 1DRKA 4Q00A 3KVOA 3RWBA 5JS7A 4WIAA 4MHTA 1EVEA 4HB2A 2Q6TA 5ED4A 3U9TA 4A8JB 2VSQA 3THWB 5DZSA 3QPWA 3REQB 2CYAA 2EC5A 4B3FX 3KSAC 4EF4A 4ENQA 1GADO 1XLUA 4OHCA 3HDJA 4C6RA 5I47A 4P7BA 3EW7A 4YYEA 3V7NA 3IE2A 3TEFA 1UDAA 3ZWXA 3QE3A 2NQ2C 2NZUG 3PNBA 1CQXA 2JVKA 4FUQA 1ESMA 1C2TA 1GDHA 1DIGA 1ZEMA 2WHXA 3QA9A 4EI9A 1JV2B 3ZOKA 1C8BA 4LDPA 2ODTX 1C1XB 3G2JA 5EXTA 2HB6A 2FLWA 3RKRA 4BJ1A 4GL2A 1GGVA 1UJ4A 1IXRC 2AG5A 2O2SA 3IP6A 1Y4AE 3GXBA 4P4SA 4Q02A 4EA6A 4MB6A 3EZ2A 5ETJA 1P72A 1U28C 1E98A 2AFHA 3MD9A 3QFRA 1FNCA 3DV0A 2JI6A 4WKGA 4XSVA 5AI4A 5HK8A 3OG9A 2G9VA 2R87A 2V4UA 2HSWA 1XRRA 1E9CA 4QPZA 3E7FA 3F2VA 2XADA 4YRCA 5CM8B 4G8CA 5DNAA 4BKMA 3N2KA 3CB2A 4RK5A 2C2BA 3ZGNA 3M5PA 1AUXA 2R5FA 3F7MA 3KVVA 1VLHA 3HCWA 1T3HA 3QPVA 1U3GA 2XMRA 4XGNA 1JAXA 4L2IA 4HWGA 4UXJA 2GH1A 2R751 1YU6A 4B85A 1XPOA 3OEHA 2HYDA 5DXAA 1JPNA 5JW6A 2PT7A 4HXGA 1YE5A 1NUPA 2DUJA 2Q3FA 3MT7A 3Q3VA 3GPIA 4I4CA 3KB2A 4TL7A 3I12A 5H3CA 3P0JA 4TTPA 4DR1B 4ZICA 2YYZA 4ND8B 4GBJA 2RAFA 5ES3A 5DEOA 5LU8A 2E49A 4LWPA 1W29A 2F3UA 4LPSA 4MEJA 3L06A 4ND1A 1XF1A 4N9WA 2V7QA 2W0SA 1K8ZB 2DQKA 2G7MC 3RF6A 3F3MA 5B57C 3LW8A 5CD9A 3TQCA 1DOAA 1V71A 5EQJB 3GN1A 1D8AA 5KQRA 2ET6A 1EA7A 2B21A 1U1IA 3KVYA 2VRWA 3GY0A 3QE9Y 5BWOA 1J0BA 4B0PA 2JAQA 1DX6A 4EKNB 1G3MA 5H9VA 1PJRA 4XJVA 4M22A 3HTXA 1PJ8A 2VWPA 1QS0A 1YQUA 3U13A 3UT5B 5DO9A 2P3SA 3V3KA 4LOLA 4B73A 4DMCA 5CXSA 5IG2A 3V1MA 1NVBA 2DUNA 3GFPA 5HF5A 3UMCA 1VHWA 4TS3A 3LLCA 1U0OC 5DMXA 4BZPA 1Z6ZA 2UYGA 4PLVA 5F7XA 2PS3A 4W9RA 3BT7A 4DGQA 3NHRA 3G5TA 1UC8A 4LRTB 2VFAA 1JAZA 1ZKMA 2BP7B 2OFXA 3AVOA 3IEIA 3FDZA 3HBLA 4E14A 1NJSA 3Q6NA 3BUSA 2GF0A 4WLNA 5J1SB 4JFAA 2AMVA 3DTVB 1JIQA 4YRQA 1EFTA 4K6HA 3X1YA 2WJ3A 4ONEA 4A6DA 4DARA 2ZI6A 4GPEA 4W1PA 4CIBA 2PSSA 4Q4JA 2AC2A 1KI6B 1CD5A 3CZQA 2YYAA 1RVDA 2BUBA 4ZZ2A 3N2LA 4AO7A 1MOQA 4ABYA 2ZI3A 2XNCA 1FTSA 2FPXA 2JNWA 2NO7A 1WUJS 1DJQA 2VWGA 3QE4A 3OZCA 4W9NA 2XJ4A 2BKAA 4KXQA 5CDSA 3HO1A 1QLWA 3NP7A 5ENVA 4ZRNA 4YAUA 1TQ6A 3TG8A 4CMIB 4IDCA 5BN3B 1FSSA 1RC0A 2EHJA 4B6JA 3NBMA 4EATA 1YDFA 1DAFA 1EX7A 1SCNE 3OE5A 4X5OA 1SWWA 1MQ8B 2GESA 3ND5A 3LOUA 4YRJA 1XDGA 3DLPX 3RUAA 4OHYA 5GGXA 1BMFA 3M6FA 2PD3A 2PYIA 4A82A 3BXPA 4A15A 5MFPA 4QAQA 3NC1C 1VSBA 3FLEA 4KIGA 4P5PA 5H0IA 4D97A 1ZEJA 2XUPA 3ES9A 4HZIA 1Q16A 3ZKWA 2YYYA 1JQEA 2OT3B 2H1SA 1Z9BA 5JU6A 2JFBA 1RQGA 1W5TA 4LSMA 1GG2A 1QVVA 2NO0A 2FQYA 2OHHA 1CUBA 2YWRA 2ZXFA 1PRYA 1CY7A 4B2YA 1RXWA 2ODNA 2VHTA 2OBYA 3JWGA 1P1FA 3WXMA 2RBGA 4IIUA 4DRXA 5AOVA 2ORIA 2ZI7A 4R1SA 5JPCA 3D43A 1TJNA 4LZPA 1IRXA 4FDAA 4N3AA 2F7SA 4ND5A 4XX0A 2AUTA 1CY2A 4LRUA 3V8BA 4A6XA 2QGZA 4ZI2A 2C3YA 2VHJA 2IXTA 4NYJQ 1G59A 4JASB 3T7DA 4UZSA 2RHHA 2UVPB 1RAIA 5IJZA 3GCXA 3LUAA 4EK9A 4KX3A 1CY8A 4MVJD 2PL3A 1QBGA 2WD7A 3KZCA 4B35A 2QM0A 4ZFNA 1TTHA 4XFDA 3VFDA 1L4GA 3KK0A 4ND3A 5BVHA 4DDKA 5H4GA 3K2BA 3I2IA 1N2HA 5IBRA 4N82A 5IUNC 1OH8A 1T10A 2QORA 1T3TA 3L1JA 1XEXB 5BNTA 5TY0A 1ZGHA 1CJUC 1PP4A 2R7KA 2OXEA 3GRYA 1VPTA 1LBIA 2CB0A 2Q3DA 3SWWA 4CTMA 5JROA 4UZFA 4ZT6A 1E92A 1ZGCA 3V4SA 1QIHA 4BUCA 2HDNB 3ADKA 2OCXA 4NATA 3GOHA 4B3RB 3MTDA 3PHJA 4FW9A 2YVAA 1O5TA 5CDTA 4D56A 1GNLA 1K06A 2IOFA 3G9XA 5GADl 1L3IA 1A9XB 2RGEA 1UZLA 2XCIA 1J42A 2YXNA 1JLLA 1WXGA 2BAGA 3PC2A 2R00A 4W1QA 2P2DA 1DKMA 4DIEA 2Q0QA 1WXFA 4M0KA 3V1NA 5LMUB 1PKXA 3F6PA 2W4MA 4MWOA 2ZCJA 1QTNA 3DDUA 3T38A 4F3CA 2PX6A 5DF1A 4S1OA 5AT1A 3X0DA 4FMDF 5FWXB 5IC4A 1AA9A 2ZRAA 1U3CA 1M2OA 2FLKA 1XD2B 2QPTA 3LBIA 3FNHA 2MSCB 3ENWA 3VR5D 2ZSJA 2AZTA 4B34A 2INGX 3WIDA 4L22A 4WVLA 2DWUA 3N0VA 3T3IA 3ZWVA 4CQMA 1O96A 3R5SA 5CA0F 4LRWA 1XRJA 3DDHA 4XWKA 4L5BA 1FRVA 3OEHD 4Q3NA 2CXUA 1KEZA 2OP1A 3LWBA 3VZDA 2W2KA 4A2WA 3I9KA 5AVQA 2E4AA 1V5IA 2XYQA 4JEIA 4WZBE 2RK3A 4IVQA 2GX6A 2DRIA 3H1GA 4LECA 3QBVA 1QP4A 1U9IC 1CFJA 1OAOC 2D1TA 4PG5A 2DKOA 2GJ4A 4KQEA 1B23P 2B20A 2HRBA 2WIKA 3PXUA 6ABPA 2V9ZA 2IPLA 2M32A 5C81A 2V7QD 3C6YA 4MKRA 4MUNA 1JMKC 1SXGA 3NBZC 2VAVA 4DSTA 4RZ2A 5H82A 3CEPB 5BYKA 2NT4A 1HYQA 3EGXA 4YJHB 3SEZA 1IM2A 2A4KA 1UK9A 4YRLA 5LMNB 5D51S 5CVTA 1CC1S 5LJLA 1EFVB 5DLEA 4LF5B 1XTZA 2PWBA 3UAZA 2EFGA 2V6BA 2GFHA 1N4DA 3LQ2A 1QZUA 4CUZA 4EI7A 4YJGA 3GLIE 2CE2X 2JGDA 1D2GA 1ML4A 2GWHA 4HAXA 3UMFA 2WP0A 1BJKA 2XDAA 3HL4A 3QF4A 1WE2A 3CF0A 3TEJA 3WQSB 2J4DA 1AKTA 2LKDA 5JY1A 4UTXA 2HXGA 5IF3A 4V0OA 3K05A 3BWDD 2QPAA 1FSFA 1G8GA 4EFMA 5KOHB 3Q7TA 1T9GS 4HWOA 1B2LA 2XKAA 5DX8A 2O5RA 2QOEA 2R1TB 3R5XA 2IYWA 4TQAA 1SB9A 5ARCA 3ORHA 4LFBB 5C8YF 1GQOA 2GK7A 4B3XA 5IMBA 2Q07A 1UDRA 3IO3A 2ZDHA 3V7FA 4PY2A 3T41A 3FHLA 4UC0A 1DWUA 1EVZA 2DC1A 3MSXA 2EZ4A 4E3WA 4E33A 5BMVF 2OD7A 5JJLA 1DXYA 5LB4A 1JTVA 4IS3A 2B1RA 3L7JA 1DXOA 1GSIA 4OP1A 4CMKA 3O4HA 4E6PA 4EYOA 3U16A 3MB5A 1NP6A 5IKEA 3B3GA 5F3WB 3DVAA 3R5FA 3WK9A 2PH5A 3QUSA 2YC4C 3VR4H 4XX1A 3COVA 1A50B 3X3HA 4YJ3B 2RKBA 5GAJA 3INRA 3UUGA 1EXNA 3D1JA 3M0EA 3BIWA 4MLCA 3C39A 2BGNA 3ETLA 1J2YA 3ZXIA 2H4YA 3ETHA 3HE3A 3LY7A 2G07A 5CTAA 4X71A 1PLJA 5EUMA 4ZQHA 5AOAA 2NPFA 2ZSFA 4EJ2A 2VKTA 4TRJA 3L4BA 1GGEA 2OQ2A 2X0NA 1H4SA 3NTXA 5HS6A 1LPAB 2X8LA 3R8CA 2RHLA 2MR5A 5ALRA 3WBKA 2DUWA 2A9RA 4D74A 2HEIA 1MKYA 1BU5A 1TQ2A 3MINB 4IHJA 5SZIA 4XDGA 3TAUA 5ITSA 4RW0A 4GZMA 3VNBA 1V26A 3SI7A 1NMEA 1QO9A 1XNRB 2XVXA 2XQVA 2BZ0A 4K9OA 2FSIA 1XOIA 4KLNA 5BSVA 1GPKA 1E2MA 2Q4RA 2R6CA 2WWIA 3G7SA 5B58T 4E2XA 5FTLA 1T4CA 1PZHA 1TYDE 1EFLA 1ONSA 1QP8A 1ZRMA 2VHWA 4WK4B 3T5CA 1Z0JA 4MV5A 3ONVA 2OMEA 2QRHA 4QHYA 1ZVJA 1FK8A 4UMEA 2I8AA 2MOKA 2Q4BA 2G67A 3A2LA 3W6OA 4UUMA 5TQVA 2W37A 3MBIA 3OHMA 3QUAA 3TJMA 2P9TA 2ZJZA 2JH8A 2R6HA 3C3JA 2OQIA 1I2MA 2OO5C 2QR2A 2XVYA 3QRWA 4MV6A 2AI1A 1FFXA 2B3TA 2Y76A 1N1GA 2IP2A 3G7NA 3SZMA 3SNHA 1ZJWA 1DDGA 1YQQA 3NAZA 4OX9B 4EHDA 1HL7A 1YJXA 1DCMA 5DYNA 4JLSA 4PU0A 5I48A 3MUEA 1DBIA 1IY2A 1P2GA 1Z6TA 3GH3A 3K4PA 2D74A 3OD1A 4HKTA 5KC9A 4RE5A 1ZHFA 1SB8A 1T2FA 3OCWA 5GJCA 3A6FA 3DE2X 3C8MA 3NIFB 2NX2A 4RM3A 3UKJA 1YJQA 3OZXA 2Y99A 3I2YX 4UAVA 1N5IA 1L5OA 3SQNA 5JZVA 2ODBA 3VYWA 4DIMA 1PTJC 4EY3A 4QQNA 1OGYA 1KORA 1N1MA 2HH9A 2PZ8A 4YBZA 2OAQ1 3HVIA 4R8KA 2W5UA 3NHWA 1GIAA 1GDTA 3GLKA 2BFNA 4QKQA 1KC1A 3PIDA 4Q05A 3D4PA 4PBRA 2ECPA 2L19A 2YOGA 3DMTA 2V5UA 4C4YA 3VH4A 1ATIA 2XI4A 3I52A 3TW0A 1WD7A 4UHDA 3TB6A 3HU1A 1DX9A 3MLBA 5H70A 1YCFA 3EBOA 3GFQA 3R6TA 5EZYB 2W2TA 3LQ4A 1FC0A 4BNDA 2E1PA 3IQFA 3R8XA 4DBVO 5CVCA 4ED9A 5HIKA 4MDYA 1NU8A 3X2FA 1CVRA 3FPBA 4BRWA 1NVVQ 1OJ7A 1FY2A 3LP5A 3RHSA 4XOIA 2AWOA 4JOCA 5MF6A 2R6ZA 1SBIA 1R4ZA 1KQPA 1CY0A 2SKCA 1X19A 2PUCA 4GSYA 2YFKA 4GOKA 1B6SA 2DECA 3E4DA 4U7JA 3CGWA 3MMPA 4WOCA 4CLDA 3THRA 1NJFA 1GSAA 3KUKA 1WW2A 4CIVA 1U0LA 3JATB 4X6LA 1Z56C 2XB2A 4IIXA 5EKSA 4G0YA 3T7SA 4C3ZA 3PFKA 4KLCA 2QM3A 4WA8A 3QG1A 4RA9A 5ALXA 3FTPA 2RCYA 2FHPA 1DLIA 5I7EA 2AVNA 3KYBA 5DM2A 3RIEA 1ZY2A 4U2BA 5AHKA 3ESRA 1KPHA 1SVUA 3PQ7A 5BYBA 4AAYA 3M6IA 2NSHA 4ZAZA 4S1TA 3LD9A 4W4TA 2P77A 5E8RA 1JI0A 2WIJA 4FFBB 1U8AA 4IDGA 3SYLA 1SVNA 1MXFA 2ID4A 4GPZA 5F64A 3T5GA 3UXEA 1XB2A 2PKWA 4K6CA 3RIYA 4N5LA 4CM1A 3GLVA 1W73A 1NNSA 3OOJA 1L3BA 2FTKE 2G71A 4FD2A 4HWPA 3A9WA 4FC6A 4PIPA 1MO2A 2RARA 2Y1FA 3RIXA 2JFZA 4KMMA 2H48A 4OBBA 2HKIA 3UV7A 2I7CA 4GXNA 1AXGA 5T8KA 3RREA 1R18A 2DHDA 3HR7A 3OOWA 3PNSA 4DSAA 1L1FA 3TW8A 2NVOA 4NENB 4C0WA 4CJXA 3D59A 5CRIA 3WO1A 2VQ6A 4F91B 5EI5A 4JNKA 1SFRA 1WABA 4J4HA 3F6SA 1JU4A 2G0TA 3KV3O 1MJHA 4Y2QA 3STYA 4XB6B 2VDOB 3OI7A 1POWA 3LBAA 1K5GA 2GRUA 3KTDA 5DRTA 1AS3A 1D6JA 4XKJA 2Q62A 4M0MA 1FVHA 1U7UA 2W2NA 1KYYA 5JXIA 1GRQA 1QFSA 2OECA 4ARZB 4EJSA 2J67A 1NNLA 3UB3A 4EPYA 4EVQA 2V7PA 3WWDA 1HY3A 3O3NB 5FA5A 3U7HB 4OO3A 3ZCQA 2ZJ7A 1OXVA 4AWXA 4BDSA 1VJCA 3EN0A 5TMPA 3MRVA 1TM4E 4KQGA 3L6CA 4U1RA 4MRRA 1UDXA 4JNCA 1WB6A 5IVHA 2FZ4A 1QV7A 3AZQA 2C00A 1PCXA 4HNHA 2Y67A 4AJJA 2PH3A 3QE2A 1H3FA 3ZCTA 5AP9A 1PJTA 1VLMA 1JU9A 3QOWA 1HYEA 1U7HA 2ZRNA 1BW9A 1O4WA 2DUMA 3OX2A 3OPYA 1DT3A 4CV3A 4EZIA 2DPLA 3C7DB 1VI6A 3G8CA 3N2IA 2GYYA 2X23A 4RCYA 4BMOB 1K8YB 2A9JA 2VAWA 5I6DA 5DYIA 3CGGA 3W7AA 3GDHA 2Y0BA 2RHDA 1K9SA 1YHYA 1YB5A 4N03A 1KEKA 1S5PA 2R4QA 2XXJA 1QIGA 3DOIA 2ZQZA 3AEKB 3CG4A 1XTUA 2DVMA 4QPCA 1M2FA 1N9KA 4WZAB 4YP0A 4DCVA 1GQQA 4WI1A 2YY5A 4FNGA 3TIXB 5F9FA 3AEUB 3N0TA 4MUJA 3SBOA 2ODEA 2VH5R 4F96A 1RYDA 2XTAA 4M1WA 1WUYA 1N8NA 3FMFA 3JRNA 5JDCC 4IGKA 1KZ4A 1L4FA 5AXCA 2OHFA 1E5QA 4AJEA 1VP9A 4EKYA 1QHSA 3EXIA 4KHPB 2L17A 3CYFA 4AN1A 4IOKA 5EGSA 1LUAA 1ZCBA 3AW8A 2V7EA 2DZDA 4N3GA 4ZALA 5GV8A 4C4OA 1SHLA 1U0BB 3DG9A 2YJ4A 2F1OA 1C4XA 1ZD8A 3ORSA 4MIYA 1QAOA 4U7TB 1KPGA 3R3ZA 4JDUA 3KHUA 5DTQA 1K88A 4GM0A 1CJSA 4XYBA 3O7WA 1VKNA 3JQ9A 2GRAA 5IXSA 3C14C 3PNYA 2IOHA 1L7BA 1C0EA 2C4NA 4PW0A 5I8PA 3DWIA 3OKPA 4HUQA 2GXQA 1DTWB 3H9JA 3OZUA 3I2JA 2X1LA 1G5HA 1NT4A 1Z8HA 3DMNA 2DH6A 2ZXEA 3LUJA 4M53A 5C8ZA 4NEHB 2JHPA 4M3NA 2D7JA 2YWJA 3IPLA 3NRCA 1WB5A 1DTEA 4LRXA 1H6CA 3BB4A 3WTCA 4E4TA 2VA8A 1OFTA 5JLAA 3T94A 2G9QA 5DGXA 2W2OA 1L5VA 3DO5A 2D5BA 1KFKB 2FMKA 1X1QA 1PZMA 1QB7A 1PLLA 3QU7A 1NLUA 2PJZA 3HXPA 4QFDA 3VI3B 1I01A 1YQ9A 4ATNA 4MK4A 2GOYA 1BCSA 1TA4A 3IT0A 3OZVA 1CHDA 1QGUA 4KN8A 3TSYA 4DVJA 2CHVA 1WX1A 2OZVA 3N75A 3QU2A 5LMCA 1VQ1A 3UJDA 4D41A 4DCSA 4P3NA 1GL6A 2AFHB 3AUYA 1NF9A 4FIZA 4O2LA 2CV1A 3DV0B 4GQIA 1Y6JA 2G25A 2OVBA 4HLNA 4XQGA 4R7GA 1Z0FA 4FJ1A 1E1YA 4NBWA 3V48A 2YXEA 4UM5A 1WBDA 2AX4A 5DIZA 3H13A 4NEQA 3VPAA 3D54D 4ZTBA 2A9QA 1JQDA 2AYXA 4YWHA 5HMLA 2JLSA 3K0CC 2NYUA 4DKXA 4U8GA 4Y18A 2JGJA 3NUGA 3WX0A 3ZTYA 2HFKA 4H3HB 4II2A 1AIPA 1L5ZA 2PXXA 4K05A 1V95A 1W4AA 4B31A 1GAEO 1HE5A 5KSWB 4WLUA 4B3TB 4K6MA 2ZUSA 4BCCA 3FOAA 3I6IA 1ODKA 4DB2A 1SVOA 5HIJA 3TBKA 2NOAA 4J1TC 4BKRA 1R6DA 4ID3A 2JAOA 4HC4A 2FEWB 1Y6ZA 1Y9ZA 3GQBA 1FX0B 1YS4A 1L5KA 5K01A 3TCKA 3DDOA 4WBSA 4CKCB 16PKA 2Z1MA 2O52A 3RPEA 1FFCA 3PUKA 5DTMA 5GOZA 1GV0A 2HPVA 2PA3A 3PCTA 4U0KA 4RGBA 3I8OA 2G8LA 4PC2A 4ESOA 3CVXA 4G1UC 2GZDA 3Q9UA 3QA3E 5JECA 3BRWD 5AW5A 4EJFA 4WZZA 1E3IA 1LA2A 1OAKA 1RWVA 1QIIA 1W30A 4G01B 5F9HA 3AU9A 5A6SB 4NWIA 4JLUA 1Q7CA 2XUQA 2WB2A 2JBHA 3O31A 2I2BA 3V8NA 4PHCA 2LKCA 1RYZA 2OESA 3KB1A 4I1VA 3JXEA 4IUYA 2OBMA 5AKIA 2C8KA 4UBNA 4EKGA 1OT5A 2KB0A 3JQRA 2Y92A 1P17A 3A14A 1QDLB 3K9QO 4TV8B 1QYVA 1VG9B 5CA0A 2RHCA 1R8XA 3L8HA 3LY9A 1XVUA 4IJUA 5IW8A 2VHUA 4O1HA 5A4AA 3KJIA 1OHHD 1QGZA 5B2ZA 3EVGA 1AKQA 2AF4C 2JBWA 1Y7HA 3E9DA 3BB1A 3SSNA 3KC2A 2O8FA 3IIMA 3G9TA 4WL0A 4TYWA 4MQLA 4CEIB 3ZUPA 1ZJZA 5ALVA 4WBXC 2FG5A 3JASA 3LT2A 3INNA 3ROPA 2QYHA 1NOJA 1RYYA 3UKDA 1QZTA 3V2UA 3DAYA 1T8YA 3ICCA 3OPYI 4GECA 2H2DA 3L7AA 2NU7A 5IEBA 3OUTA 4CKEB 1NW5A 2IT1A 3JYPA 5BY2A 4TLEA 2VXBA 4AKIA 2ZYAA 4UTPA 2C4TA 1ZAKA 1V7CA 3VC1A 3F67A 4MMZB 1U2EA 4IXWA 3YASA 4YRKA 1BFDA 3CSUA 3G0OA 1WHTA 2VJYA 5ALQA 3QYAA 4RO0A 1EDDA 3M1YA 3U4QA 3M2PA 4DBLC 2UUPA 4DDTA 1SRQA 4AQ7A 1FXSA 2FZEA 1MOSA 2KYRA 5LZ2A 3FTFA 2IYSA 3THOA 1NKTA 1XQVA 3RU7A 2I8CA 5BUZA 4QAJA 1AQJA 1FTYA 2G1PA 3PR1A 3SHVA 4ADSG 2CXRA 1J0CA 3MS2A 3R0XA 3L7BA 2BM8A 2GNOA 4HD8A 1V5GA 4F04A 3I9FA 4F2GA 1EZ1A 4ZOLB 4EFLA 1OR8A 2IUTA 4INZA 3FHTA 2GR9A 3C7TA 4D6PA 1U31A 4M6WA 2OCPA 3K8YA 2HA0A 5F23A 2JA1A 3W5BA 1L4HA 3UOAB 1H1TA 2ISSD 2ZRQA 3CRZA 3IH5A 3NM4A 4DHEA 1Q0ZA 1WCV1 4KC0A 4N76A 3PGLA 3RV3A 3ZBQA 2G17A 2QU7A 5ECYA 1FW8A 1PFQA 2BRUA 2C84A 2QTFA 4Q1BA 4AYTA 4F9GA 5DYTA 4ZGWA 2G1KA 4DABA 1VXRA 1JDTA 2BBWA 4H1HA 2BBTA 2FRDC 4RFSA 1ZSNA 1QRSA 1KY3A 5EKTA 1RJFA 2P1DA 1VBFA 1JFLA 4YLYA 5E2AA 1B0ZA 1NJ2A 5CLFA 1L2TA 3T3PB 2I55A 1NW6A 4J03A 2BFFA 3ETDA 2QTZA 2HMYB 3MT8A 2LDXA 3P0HA 4XX0B 2Z9DA 4PNEA 2PAAA 2ZS7A 3KYJB 5I9MA 2OAEA 3CLSC 3JZDA 4Z3DA 2GTPA 1GRRA 2AMYA 4H7EA 3BGDA 3BD7A 2I4RA 3ZCSA 4V03A 1SZJG 1GZ5A 3I9NA 5IDQA 3T95A 1YI1A 4G0NA 4NAUA 1C7IA 1GCGA 1GQFA 1MVOA 3A2NA 1R9NA 1KYTA 2QF7A 3ND8A 2IYLD 3KO8A 1VGRA 4BHTA 4YCLA 2WIFA 1F3OA 4K3VA 3NW9A 4WH0A 4XVQA 1J2RA 1NQOA 1S3IA 4GZ5A 5EZQA 1I51A 3AP1A 2XUHA 2GBIA 3KPUA 1HDXA 1MBZA 1N5DA 1Z5NA 3EIUA 5I9IA 1A1SA 3LI2A 4BBZA 1MTZA 3WIVA 1D2HA 3P71T 1YL6A 3UYLA 1I24A 2AE1A 5DHTA 4TX1A 4HDMA 3TYXA 3NM5A 5HYVA 4D3SA 4WCFA 1NRXA 1XU7A 3GR6A 3IC5A 1QGOA 4CMGA 1HT3A 3VDNB 5LZ5A 3ZWPA 4LXGA 4F84A 1WKBA 2AOTB 2W0MA 1P3Y1 1WEHA 3HWSA 5ALNA 2A35A 5D85A 3CVOA 1EWTA 1GLVA 4ZYUA 5DW3A 5KNBH 2B8TA 2MSKA 1DJNA 1JLLB 1N2CB 2W6OA 3TINA 1E1QA 5L7YA 1I5RA 2CGEA 2AOXA 4U5QA 5AKHA 1U8ZA 5CDFE 1XQYA 2FF7A 1PNQA 4J07A 1OLUB 3VO1A 4POOA 1DTSA 1ZUWA 2EYQA 3GP8A 2VPPA 4R71A 5G0TA 1LVGA 2WWTA 5KVQA 1L5LA 2IQ5A 2AQ8A 1BS1A 1USIA 2W2QA 3LRXA 5ILOA 4WK0B 4KGZA 3WISA 4BV9A 2F3SA 4C1NA 1BG6A 1SPXA 3ORRA 4B47A 3AG6A 1W25A 5EHIA 5FJJA 4D5EA 5HRCA 2R1ZA 2BSQA 3WOHA 1N1EA 3IP5A 1O96B 2GCIA 3AFHA 1BYIA 2J9ZB 4EMBA 4LYGA 3F96A 3G6KA 4QNNA 1DX4A 1RT9A 2P9HA 5KOJA 1XQXA 3U60B 2NXJA 3T9BA 2J9XB 4L8GA 3OJ0A 3MELA 1TTPB 1U6JA 2ZJ4A 4B7CA 2SECE 1XTKA 1JH8A 2YH2A 2FFRA 2IPAB 3O95A 4QNMA 4R16A 3A6EA 2FPSA 5F21A 3JVIA 1V5FA 4NC9A 3TDKA 1H69A 1CLEA 4RTJA 1FJGB 3H6KA 1EZZA 4JK3A 4ZVTA 4CT4B 3O3CA 5K0EA 3SF8B 1C0PA 4OAPA 1I9GA 1JR6A 4BCBA 1QGED 3HH8A 1R37A 3LC2O 4F8YA 4KGXA 4LOJA 3THXB 3SHWA 4GRIA 4OP2A 2F48A 3A4YA 5CBKA 3P2EA 5DM60 2Y71A 4MQ6A 1I3LA 1JA1A 3W5IA 2VDQB 4B6EA 1NMXA 1XNGA 3FAZA 4GBMA 4GRDA 3EBLA 5FWDA 1YVPA 2WF6A 2NSDA 3T7CA 3BMNA 3FLMA 4YRMA 3TTWA 3CBQA 4JI5B 4GKAA 2JJMA 4HLCA 2WKRA 3SC6A 1V8OA 1WSDA 2P9FA 3U19A 3DNMA 2ZCVA 1U28A 2PMDA 4RVOA 1NQVA 3BJMA 3K0AB 5AI0A 3T3NA 2VATA 4ZKDA 2BR5A 1OC4A 4G86A 5IPFA 4JUFA 1J49A 1DUSA 2ACEA 2DR3A 3RRZA 4HVAA 2G08A 2AD1A 3GUCA 3IESA 2DFKB 2P4HX 4RSRA 2O8VA 4WXPA 3F6BX 4C9BA 4DEXA 2VSYA 2DR2A 5FUXA 5IKXA 2O59A 3U26A 3QNWA 4A9AA 2GJKA 3MILA 2VZ8A 1N5KA 2H3EA 3OAAA 5T57A 3AU8A 4DLAA 2WU1A 1HE3A 2H1WA 2CHFA 4QLOA 4EA7A 3C6BA 2CFOA 3QVMA 5A6VA 1JE1A 1U1EA 5TDHA 1XTJA 2Y0CA 5HF9A 3SHFA 2I4TA 2TECE 1CQPA 1T36A 1ZJ6A 3DT8A 4LAFA 2QUAA 2BMVA 1A3CA 3GU3A 1J00A 2RAUA 4RVUA 4HH4A 1YGYA 4MHSA 1O3YA 2NTNA 3C5VA 5LP6C 2JAWA 3EZ6A 4XWTA 4BLSA 2WAOA 1FLNA 1P5HA 4EHBA 1FFBA 1U1GA 4G3XA 4IR7A 1GT91 4DQDA 4ZRDA 1H3EA 3A6PC 3PXGA 1LK0A 3X1MA 5D3MB 3UJPA 1SVKA 4NCHA 5ESRA 3VV3A 1APBA 4N5IX 4TTJA 1WNFA 4OQEA 1T0IA 2IW1A 3NGXA 4BO0A 4D02A 3OO1A 3SQOA 2NU9A 3PQ4A 3D6FA 1YIOA 5LLSA 2LD4A 1F12A 2NUPA 4NBLA 4BQIA 4RELA 3TPCA 3BL8A 5BOSA 2ATEA 3ZS9A 5GM1A 4EUEA 3ZCRA 3L1HA 3NHUA 1U80A 1SU8A 1P9OA 3ANLA 2GNPA 1F20A 2B25A 4MQ5A 5JXWA 3VPBA 3RC9A 3T06B 1KDYA 3ZGOA 4BGDA 5CB0A 4MUMA 3CX6A 3LTEA 2PVCA 4F0JA 3JX9A 5J40A 3MTIA 4P3XA 4JEHA 1BH2A 1TE2A 2MT9A 1NI5A 2C2MA 2WHYA 2B1JA 1YOVB 1IN7A 4LSWA 4CEHB 4CR7A 3EGOA 4Q24A 3BGVA 4ZANA 3H2GA 5FUWA 5T3UA 2WIGA 3M81A 1JW9B 1EUDB 2PLFA 4P33A 1Z74A 1M67A 4RWEA 4FGLA 4LHZA 1J1IA 4NZNA 4DWJA 1A5ZA 4N5NA 5JRDS 1EX9A 3M9XA 1NUAA 3IR6A 2F64A 3IERA 1JR3A 3EXFB 4CCYA 2VOJA 4X20B 2OZLB 3ABIA 2CYCA 4IQGA 4AZWA 3UH0A 1YU9A 5BSUA 1HEYA 4HX5A 1U11A 1XMPA 5LXTB 1TOAA 1V9SA 4MR9B 5KTPA 2O14A 3C8ZA 3TXAA 1Z68A 4JT4A 3RADC 2ZUBA 3DAPA 1DUVG 1G3RA 3ACCA 1RHKA 1UM8A 3CKLA 1R8SA 3KXDA 5EIHA 3C2QA 3N0XA 4QUHA 3EXG1 4C0HA 1E1QD 3W8DA 3QEBZ 3LV8A 2Y1WA 5J63A 2BEVA 1RBZA 1NDQA 2ASEA 3VKGA 1E3WA 1EJ2A 1XT6A 4GQBA 4KAXA 5E9JA 1FTNA 2Q5LA 3VZSA 5TB5A 2JBAB 3ZHUA 3IAM6 3X1ZA 1CF4A 2WT9A 3NX4A 3ZVMA 3QSGA 3AUAA 3P9SA 4CYMA 1YJAA 2XB9A 3NVAA 1SVWA 4FNAA 3RSSA 5IVKA 5ERXA 5FHQA 4MHOA 4ERXA 4PLFA 2WWVD 5EPEA 3ITKA 1PJCA 1JQ5A 4ER0A 3CMCO 4M9SA 3R75A 2JGEA 1OGIA 4OREX 2XTZA 4MV9A 3MOGA 4CG1A 4C7VA 1PT7A 5BURA 3N0RA 3ZY3A 4K5QA 1I4EB 4R84A 1AKWA 2P2NA 4KSBA 4GUDA 4DQ0A 2OAGA 2ZYTX 3BCSA 3TJZA 2QL9A 1QVWA 2VJLA 4CETA 1QCCA 5MFZA 1JXOA 2ONKA 2VQDA 1U9ZA 3U80A 5JASA 1YI8A 3A4TA 4V24A 4RLSA 1JHPA 5MN4A 2AN3A 2DBQA 4UD6A 4YAFA 1GNTA 2AI2A 1NXSA 1Y4UA 1Z8NA 1H5QA 4FYIA 5CTJA 4IDOA 4GKKB 3V2GA 1ONOA 1G8PA 1ZU5A 2OAP1 4B4OA 1RWWA 1OREA 2VBIA 3EPRA 4JGIA 1UOQA 3UANA 1G5PA 2PTGA 1S4MA 1YFZA 4RM2A 1NA5A 1WZ2A 1C3OB 4B17A 1RKUA 1QSGA 1X1AA 5F3RA 2BW0A 2XUKA 1RAGA 3KEQA 4H4EA 3I39X 4NICA 5FYQA 1VJRA 3EXHC 3STUA 3O2NA 4OG2A 4BFVA 4AJIA 5FT9A 1R4MA 4ZOLF 2JLCA 1A8HA 4LE1A 5EXDA 1WBJB 3ZLJA 1A7KA 5G1NA 1AB6A 1M66A 2JA2A 1EUYA 3K9CA 1T24A 2Q4EA 3L84A 4TKVA 5K2OA 4M89A 1QNFA 1SKUA 5IT0A 2C7RA 1T6NA 3MJTA 1IZZA 1NBEA 1TKAA 3PFIA 4ILEA 4UAUA 5EESA 2ZR0A 2WFLB 4ZJZA 1XDSA 1E6MA 4AXBA 1E2GA 5B3JC 1TGYA 3QTTA 4Z51A 5HM6A 2EX0A 2I3BA 4HLUC 4HSEA 1F7UA 1BW9B 2C03A 3TGLA 5HNKA 2G5GX 2GN4A 4MWDA 1Z15A 1BA2A 4N1AA 1L4BA 2WF7A 1DELA 3SOPA 3WLSA 1J09A 5CB6A 4V0QA 1NV8A 4P6VF 1U9IA 4PCVA 2O7SA 4HGQA 4RZXA 3TEMA 1MA0A 1OAOA 3U7QB 4F38A 3IELA 2XUFA 1UT5A 3KLMX 1TYAE 1QJ4A 2R8BA 3QXHA 1ZFNA 1UM9A 3FGOA 5I7AA 2IV2X 4ZOBA 4XXHA 2FQXA 2H4JA 1PZEA 3R3VA 2GK4A 1IPHA 2XZDA 3NC4A 5AW3A 3J7TA 1MO5A 3PT5A 4G07A 1U1CA 4G2TA 4P98A 4S0ZA 3WADA 1CEYA 1ZC4A 1YMVA 4ZTUB 1CNFA 4M7RA 3N39C 1H2RS 1IUNA 2BHSA 1Z62A 2D7CA 3V42A 5A2QA 2VF5X 4D3ZA 5KYWB 3OEYA 1T5DX 2CWWA 2EEPA 4A23A 1BVRA 4P08A 4EVSA 2GZ3A 5DN6A 2EG9A 2X41A 2QRMA 4WINA 1OLSA 5AHRA 3HG7A 3NOXA 2VSOA 1VKHA 2ZFUA 2A9KA 4JQZA 5F1YA 3SCZA 1XTQA 3SM3A 1HNXB 4MPTA 4HN4B 4TM8A 5G3ZA 4E46A 3O8RA 1I4TD 1RBMA 3TLGA 1BMQA 4IJ5A 1SCBA 2C5FA 3OF2A 1BWRA 2P6UA 1JE0A 1ILWA 1CTQA 5EHQA 3T61A 3DTTA 2I1VB 2X5KO 3BFJA 1DCKA 1CR4A 3A6GA 3H1AA 3HPRA 1DMRA 3MTGA 2ACVA 3PS9A 1WA5A 3WLKX 4XUDA 3HLYA 3Q0IA 3OOEA 3MYRA 2IYUA 3MTJA 4O4IA 5E2BA 3LDUA 2IHBA 3TLEA 4HRAA 3AI7A 1ZUNA 2CVPA 2WJAA 4N7MA 4YMGA 3PGMA 1ZPDA 3HO6A 3BD6A 4LOHA 3BXEA 5E2IA 3U3ZA 3UUFA 4H16A 4HBGA 3EZXA 1KWKA 1I7PA 1K5DA 3LT1A 3W8EA 3D2CA 3CSSA 3DQPA 3ZD7A 1T6XA 2EIXA 4PG4A 3ZV7A 1LI5A 4U00A 1JR3D 3CU5A 5M5BA 3EG5A 2ZCUA 1J90A 1SHKA 1ULHA 4BLVA 2ZUVA 1NMQA 1AQUA 3LOQA 3MCVA 3CNQS 1LJ8A 5LQSA 3GN2A 2QE7A 3S1AA 3U4AA 5CG2A 3QWIA 5HQ3B 2OGZA 4JR1A 4O1IA 4IMIB 4OJMX 4UE3S 1XNJA 4UPVA 2JCXA 3IR7A 5KAMA 3RC1A 1HLGA 1J21A 1EI9A 1KIFA 2DWCA 5DU2A 3W9SA 1TCAA 2YVUA 5C7OO 2CSUA 5IT9A 1NXOA 5BRNA 1KC3A 3H1FA 2D4AA 2NT3A 3MWGA 1RLOA 3KSDO 3FDXA 1MQAA 4KWIA 3QXGA 4B6OA 4RYLA 1J8MF 4EP1A 5KSYA 3QBEA 3TM4A 2FKNA 4BVGA 2N3ZA 4OIFA 5HKKD 3MAJA 4O3MA 4BWFB 1RJ9A 2A14A 4U3JA 3FYTA 3OX1A 4GP7A 2C7PA 4PINA 1KQ3A 4BNKA 3TLYA 2XRFA 3AUKA 2OO5A 1S8AA 2WRZA 3BICA 4QIHA 1EA5A 5I9TA 3Q8WA 4EGQA 3OKFA 3BQMB 3A0RB 1ULUA 1XAJA 2J7PD 4MQFB 3HXQA 1VDMA 3U17A 1US8A 2ZRBA 4FLMA 4GMDA 4L5YA 4LGCA 4UNNA 1DPGA 1NP7A 2CBZA 1XVIA 1LGYA 1G8FA 2OKGA 1IL0A 2PKEA 2VL7A 3DBRA 3ORQA 3AQ4A 3BHMA 1RQ7A 4YO7A 4O5OA 1ZBDA 2QUIA 1R0LA 1OXUA 1RKQA 3FTCA 2IXFA 1SKQA 3MRTA 3L8CA 4I9UA 1F9AA 2IVFA 4ZU6X 1N6KA 1ZGJA 3DCIA 3R6GA 4MROA 1RPJA 4RK7A 3EIHA 4AUEA 5JAIA 3LT5A 1XZIA 3AR6A 3MHPA 1JEOA 4G4GA 1BXRA 4J43A 5SZKB 4DA4A 2BCGY 4IEFB 4OYYA 3CLTD 4WXEA 3S2SA 3TRFA 1KR5A 3LLSA 6LDHA 4QUBA 5K3DA 3WB9A 3A10A 1J0AA 1M6HA 1PTJA 1UBSB 1YB1A 3CTMA 3HFJA 2QGNA 2QMOA 5G1OA 2EKDA 3KCNA 4LV8B 4MNTA 4LJ5A 2RJOA 3GGOA 2WU4A 1P4SA 1XRLA 4HN2A 3KEOA 3WJ2A 1A2KC 5L51A 3CUYA 4JBIA 1FBNA 2HSGA 3GRCA 4DR2B 1Y1RA 1RWNA 4PCAA 3EEBA 4KIJA 4EENA 3JASB 2VJDA 4Z2YA 1KRXA 4N8EA 3PDCA 1FTGA 2C9DA 3LUBA 4WLOA 2PT9A 2JB9A 2PX8A 1KO1A 2WJGA 4IV8A 5THQA 1Z6GA 4BATA 1NN3A 3V4RA 2YBDA 1P61B 3H9BA 3W0LB 2QQEA 3B5JA 1N7JA 2VF7A 5F76A 2Q2NA 3KYCA 3R3XA 4FDLA 1RMTA 1UXKA 1HQKA 1C1YA 3SC4A 3FMPB 3PGXA 1EX6A 5KJ1A 1II8A 3MERA 2XYVA 3WSWA 2H00A 4IIJA 3IMFA 3W6NA 5KX5A 3ZVKA 3OIUA 2GDZA 2LNDA 2X86A 4QBKA 2FFQA 4FX2A 3UH1A 1IN1A 3LH5A 4RVCA 3ZI0A 4YFVA 2UYCA 2NGRA 1X80B 2LCFA 3LPDA 4IX9A 4Z86A 2BSXA 5AIBA 3ZD6A 3CXRA 1SBTA 3FMVA 3Q7IA 4TQUS 4RF2A 1C9KA 1SBYA 2CLEB 2P65A 4IDDA 3VBCA 5AKEA 4DSZA 1D1TA 1I4LD 2HSEA 1Z83A 1OWPA 4OI4A 4MS3A 1TEHA 1L5SA 2C9OA 6PFKA 3LCVB 3W6UA 4D96A 4HNAA 4EGFA 2CCGA 1XDWA 1GA1A 3B82A 1EWVA 3AJAA 4IUCS 1TA0A 3L46A 1NU6A 3GCWA 1OB2A 3AFIA 3MXTA 1GKLA 1R8JA 2QLTA 2I0FA 2MINA 1FRZA 1DSSG 3UG6A 3HC7A 3W05A 1N2GA 4EPRA 5IABA 4RFSB 1U8YA 4ALKA 3GD5A 1QFMA 3AI3A 3IDZA 1JLMA 2DPXA 4NNOA 1AF7A 4KO2S 1JZTA 2ZB3A 2G4VA 3PFCA 2ABWA 2VDWA 4YAKA 3MIIA 2HW8A 4UU8A 1BDIA 3N70A 1IBKB 2YWXA 1TD1A 1X8KA 1PWHA 3FVTA 3AV0B 3AR7A 4OM7A 3K71B 3WR5A 1ZMOA 2AI3A 4KXVA 2QLMA 2HRQA 4CG2A 1P7CA 4PLTA 1PK8A 1QB8A 1P31A 4IFIA 4D81A 3U7FB 1E79A 3PX7A 2VHCA 1QMGA 1ZC3A 1XJQA 4B44A 1LQ2A 3PVSA 1ABBA 1DWQA 2QD4A 5I7FA 4FFPA 4BO6A 3DULA 1I10A 3KXIA 2G9UA 2XTNA 3WFZA 1CRLA 2IJGX 2NO5A 5HPYB 1N2JA 2VNAA 1A71A 1P6QA 1AZLA 3PRJA 3WXBA 2OZEA 4Q4CA 4PC3A 5C8XA 3IAXA 1X2BA 3ISJA 3SJZA 2FQWA 1LTKA 2QSZA 1YWGO 1TAUA 4BGIA 1EGAA 4NCKA 3ZE8A 2AFIE 1JFFA 2Y2UA 2V97A 4D1YA 4HUJA 3A2KA 4HDMB 4BFCA 2JIDA 5D01A 3WV5A 3C3DA 1PYGA 2GPAA 3C3EA 3EULA 3L7DA 4WCFB 4Q3LA 4WKCA 1CUFA 3ZCVA 2I62A 2WJZB 1E5DA 1HR0B 4MV4A 5C9ZA 2HJVA 4P86A 4ROSA 2QYTA 1MORA 1NW7A 3OM0A 3VNUA 4PO3X 3DHEA 2QE7D 5E6SB 2JGFA 2ZUTA 3TLBA 4PRKA 4YBRA 3WHIA 3ZDYB 2YOHA 4FCCA 2JK0A 3SZLA 3LZ6A 5ER9A 4EL0A 3PNMA 3HXOA 2JASA 4YQYA 4ZU3A 3ZLUA 1AQLA 5AVJA 1C7JA 4DG9A 5HWSA 5G0VA 5EG5A 3LLMA 4RDCA 3CZ4A 5J2UB 5JDCA 1E0SA 3L0CA 1O8CA 1DKOA 1UKAA 3COSA 2DWPA 5IJ9B 2DCMA 1V1RA 4BWYA 4D4KA 1XZDA 1HX7A 4PCLA 4R1PA 5TGZA 2CXNA 1E0JA 2A3NA 3G5LA 9LDTA 3AWIA 3WL8A 4BMVA 1E8DA 1Y1LA 3NHLA 1I3KA 2Q8PA 5CHYA 5EYPB 5T4HA 1P1CA 4UM9D 1JR4A 4YAWA 5HGXA 1L4YA 1WMAA 2YVQA 2QMUA 2A1UB 3AESB 3BERA 2ODAA 3C3AA 2ETVA 5U1PA 2RHWA 4MP8A 3RVDA 1E1RA 5SYAA 3IPXA 3LP6A 3RLIA 5LOVF 4CTJA 1E2PA 1PW7A 1TT5A 4WQMA 5CVEA 2IWRA 5EN4A 1XLTC 5ALUA 5K0FA 2WIBA 2C58A 4QUDA 4X61A 1T2NA 1K5HA 2VJPA 2XBLA 2WNSA 2AQKA 2V5VA 1I4DD 1M8PA 3WRXC 3Q3HA 4MQEB 1O0CA 3Q3IA 3D6NB 4I0WB 5H68A 4PIMA 2JRLA 4QPDA 1GTRA 3S1LA 4OY3A 2REOA 3DF9A 3IGFA 3R0IA 4J0GA 2WF9A 1YQTA 2J5RA 4P34A 2J09A 3A36A 5B6IA 6REQA 4JXXA 3U5ZB 2HF8A 3ANXA 5M04A 1FIUA 2GJ9A 3AIMA 4Z0NA 2DEUA 3A1SA 2YWBA 1GZUA 2OGWA 3ELUA 2C8VA 1R3UA 3IBTA 5KHAA 4QTTB 4I4TF 1A98A 3ZWYA 4BTVA 2PKQO 4TL6A 3KT3A 2NU6B 2VPYA 3D7LA 3TCNA 1MH1A 1ZNQO 3BQNB 1M6VB 3B70A 3K32A 3VU1A 2ZIGA 3OKAA 1IM8A 2C59A 2B5OA 4KN6A 4LRSB 5ALOA 1QRRA 4D7AA 1NTRA 2ZEJA 1ZVQA 5DX1A 3K0CA 3U7IA 1U0NA 4G0MA 1O2DA 3EQ9A 3OTQA 1XMIA 2QBYB 2I2CA 3OY2A 3Q0EA 4LOKA 4PXAA 1R9JA 5JS2A 1EVQA 3UAWA 3CNBA 1FYXA 1E60A 3O8OA 2LW7A 1R0WA 1WSWA 3JQ7A 4J1TA 4Q9LA 2VG8A 3EISA 3ZU6A 5CFNA 2XGOA 3QEJA 4OHXA 3MC1A 3THYA 3H1PA 1UH5A 2EW1A 1AK2A 1TL7C 2GEVA 2JFHA 4OXNA 3WZ2A 3VDXA 4BBAA 4YV0A 1ZCAA 1BMDA 4YCDA 1QKIA 5AHWA 3A1CA 4LDJA 4B3MB 5AVUA 1E5VA 2XXAA 2GK3A 3H87A 4U02A 5IXYA 4MDFA 1CQIA 3DCNA 3F3SA 5C2JB 3R9XA 1JT9A 2FB9A 2YASA 2ZZKA 4GAEA 4I66A 4Z9FA 2AJCA 1YUNA 3AF4A 3U4DA 4ASUD 2OCGA 5NULA 4IFBA 4IOJA 4NONA 1XA0A 3EJ6A 1DFHA 4N8DA 2WTNA 4DF3A 1AK9A 1I3MA 1I33A 1RAEA 2AD5A 3O1IC 4KREA 4FUTA 1M0TA 4IZHA 1LPMA 1M10A 4PO9A 3A1UA 2JCGA 1DQYA 2YC2C 3GLGE 5AJYA 1K2VN 3PTZA 4XVHA 2P90A 3CBGA 2FSHA 2J0UB 4PO1A 1JS1X 1K3FA 2O3JA 4G5SA 4D42A 1XF9A 4OHMA 5CCEA 3EPHA 3AKYA 4Q9JA 2EJTA 2F1JA 3GEHA 4F2WA 2GBGA 5KTTA 3R9IA 2QR3A 3OF3A 3M5DA 1M8GA 3LT4A 1RWXA 3CMMA 4XOUA 4HAIA 3FTQA 2BMFA 2ZAOA 1FBTA 1YZFA 1JRLA 4FT4A 4RV9A 5IP5A 4DNQA 4YHHB 4DB4A 2Z09A 3HGMA 4MR7A 1JHMA 4OQLA 2I99A 4HH0A 1OZGA 5BN5A 1JIKA 1H2XA 1F0NA 3CF4A 1KQNA 1U9JA 2RKWA 5M3BA 1N32B 4RPGA 3N7UA 3EUWA 3WFJA 3KFVA 2DHRA 4CW7A 5AQ1A 3K92A 5JS1A 2V1UA 5JJIA 1OFVA 1R12A 3DPUA 2I6TA 2O2ZA 1X14A 1N78A 1XEAA 5T6BA 1FP4A 2WMDA 3IHTA 1JL3A 3SEFA 2PZAA 3KQWA 4R3NA 4FR5A 2J87A 1YDWA 3S4YA 4IWNA 2V74B 1RE1A 2Q3EA 3D1LA 3HVKA 4KYUA 3LWNA 3A6HA 3BBPA 4WV3A 1CJKC 2WVGA 5CVJA 4MVCA 2HJRA 4PC7A 2BYTA 3RSQA 4ER7A 1E2IA 2VUSA 4X3OA 5D87A 4FN4A 4AVYA 3RTAA 3H5AA 4EY5A 5FDFA 1FDVA 3O1LA 4KGVA 2WV7A 2BFEB 2XA9A 2HQSA 3KVRA 5FBLB 1TZ2A 3KTFA 2VBGA 3K4QA 4EAQA 2BEVB 3MCAA 1TZCA 1ESNA 1ZCJA 3ECAA 1TM7E 3I42A 1LF0A 3M4NA 3QKIA 3LFTA 1KY5A 2FRDA 1IWOA 3IP8A 2IOQA 5K2MA 3A9CA 3TR5A 1W2WB 4D45A 4DADA 4MA5A 4HDCA 2XD4A 3I9V6 4NBRA 3HMQA 4MYUA 2I33A 1MX5A 4HDRA 1WTCA 4Q9AA 4LVCA 1YXMA 1DB3A 1SZPA 1Q6YA 2C42A 3FWKA 2X4IA 3UWDA 4BV3A 3JSAA 4XFJA 4MW9A 3SLKA