3B3QE

Crystal structure of a synaptic adhesion complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
189
structure length
187
Chain Sequence
HSAFAADPGHTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for synaptic adhesion mediated by neuroligin-neurexin interactions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Nlgn1 protein
total genus 40
structure length 187
sequence length 189
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3b3qE00
1PZ8A 1X50A 4DS0A 1SLLA 1WBLA 2A6YA 1HQLA 2CYFA 1AZDA 5E88A 1JYIA 1LGBA 2ZGPA 4PBPA 1MACA 3FUQA 1MZ6A 5KXCA 1S1AA 4YG6A 1S0JA 2GMEA 1MZ5A 3TAYA 3NWKA 5GZGA 5DUVA 4LBOA 5F5QA 1XQNA 3VKFC 3N7KA 1QU0A 1BQPA 2A3YA 3AZVA 4YFZA 4XJWA 1WLWA 1KRIA 1V00A 3WHTA 4BMEA 3B3QE 1IS5A 1MS8A 4PBOA 4R9BA 4R9CA 4YW3A 1CVNA 1I3HA 2DUQA 1ONAA 2V73A 5CNAA 4R9AA 2P34A 2FHRA 5CAZA 4YGEA 4H55A 3RQ0A 2YROA 1S0BA 5JLVA 4U36A 4TYSA 1QOOA 3NV2A 3RRDA 3VKMA 3OY8A 1W6PA 2A7AA 2ZACA 3ILRA 4FOVA 5GZEA 1LHVA 1JBCA 2A71A 2DURA 3PVNA 3WG3A 1AXKA 5DZGA 4OZXA 3WG4A 2A75A 1FV3A 5FRAA 3AXEA 5GLZA 3SISA 1GANA 1V6KA 2ZHKA 3D4KA 2DV9A 2WJSA 4LBQB 1APNA 4PCRA 1N1TA 1GBGA 2GN7A 1MS9A 4FQZA 3R4UA 2D44A 2YY1A 3A0KA 4W65A 2WKKA 3UJOA 4BPZA 4ZXKA 4AYUA 1WLCA 2PHRA 3SLIA 3OPZA 5CA6A 3APBA 4FOQA 1LOFA 3VKLA 2VH9A 1FNZA 3R05A 4XJAA 2D3PA 2DVDA 3WDWA 4YZ4A 4YZ3A 2LALA 3U4XA 1S0FA 2ZGRA 4Y22B 1HDKA 4ZKTB 4TZDA 2CL2A 5T5JA 2VXRA 1UZYA 3INAA 4XBNA 2VW2A 3N36A 5SV8A 3N3HA 4XBQA 1DQ2A 4AWDA 2DVBA 3C2UA 1N3PA 1QKQA 4YZ1A 1LOEA 2UU8A 1AVBA 3TB0A 3AP6A 2ZGNA 4BQ1A 4ATEA 1LEMA 5AVAA 1W6OB 1GZWA 2DU0A 4UW3A 4XE9A 4ITCA 1QNYA 5EXOA 4XJUA 4ISQA 4K1YA 1DGLA 2I2SA 2W52A 3BIWE 3POWA 4AVTA 1GNZA 5T5LA 3D6EA 1KJRA 1KQRA 1VAMA 2A3XA 3ZSMA 4L8QA 2W39A 1AX2A 4FP2A 5E8AA 2VU9A 4LBKA 1FX5A 2ZHNA 4RL7A 1UPSA 4YW1A 3WDXA 3WCSA 2C5DA 1LU2A 2WSUA 1G9FA 2D7FA 2P3KA 3WUDA 3POYA 4FPFA 4DFSA 1YIFA 4Y1XA 5GZCA 3WCRA 1IKQA 3GALA 2ZGKA 1S0EA 2P37A 4P9XA 5DZEA 4BOWA 5DZFA 3WDVA 1H9PA 1WCSA 4YZ2A 5GLWA 4DPNA 3MW2A 3ZSJA 1GNHA 4WZFA 4WVVA 3KQRA 1AF9A 1SCRA 1H30A 1V6OA 3RSJA 1F9KA 3IKWA 1JN2P 1S0GA 3AP7A 3O0XA 4HANA 1YRZA 1YXWA 3A4UA 2TEPA 4YGCA 3B69A 4LBQD 2D3RA 1CR7A 1BXHA 1Q8SA 2CY6A 1DQ6A 2YMZA 2DUOA 1SLCA 1SLAA 4I30A 2NYYA 1VLNA 4AVSA 5IK5A 5GZFA 2ZMKA 3AJZA 1LU1A 3V64A 1DQ4A 2H0BA 5F9TA 3AZZA 2E7QA 3M1HA 1LCLA 2ZAAA 1N1YA 3MW4A 5EWSA 4D69A 1WW7A 2NN8A 3AK0A 3AYCA 4YG3A 5T52A 3WUCA 3AJYA 2ZMLA 2XG3A 1CQ9A 3OYWB 4Q8KA 2OW4A 4BLIA 5CBLA 1LHUA 1JYCA 1FATA 1G8WA 1JW6A 3ZPYA 2PHWA 3AFKA 3H0OA 5IUQA 4Y20B 1ENQA 1CIWA 4YM3A 1UAIA 1VAVA 3FLRA 2G4IA 1SBEA 1DFQA 1DZQA 3AP9A 3AP5A 1CONA 4WVWA 5LK5A 2GMPA 3PVOA 4UW4A 2D6PA 3A0NA 5GLTA 1UL9A 4YFWA 1G86A 2SBAA 1SFYA 4UW5A 3USUB 4CTEA 1JXNA 5T55A 2UURA 2ZZJA 2EXKA 4GALA 4LBNA 2GDFA 3AYEA 3UK9A 4YM2A 1GLHA 1DBNA 2ZABA 1FYUA 2A6ZA 2HYKA 1LGCA 2D3SA 2DTWA 3OBTA 4FPEA 1CN1A 3JU9A 4JRAA 4Q27A 5DXDA 1W6MA 3FLPA 4IQPA 3N7LA 3IPVB 4YW2A 4KBBA 2W08A 2EALA 3BOPA 4FVVA 5JOXA 1YO8A 2B7YA 2ENRA 2WNEA 2AENA 2CNAA 4BM8A 1JUIA 2JECA 3N7JA 2JE9A 1MS0A 4FPGA 4LBMA 3WNXA 2EXIA 4YM0A 3POSA 4K20A 3W59A 1CJPA 4FOYA 4XHBA 5DUUA 3WG1A 2AGSA 5JMCA 4XIKA 1DQ0A 3T1LA 3DGTA 1SLIA 2ERFA 1SCSA 4FPYA 4Y24A 4Z8BA 3M3QA 4M3CA 4P9WA 1KJLA 1U0AA 3D5OA 5GM0A 2NM1A 1QOTA 3L2YA 1W6NA 1IS6A 3M3OA 2ZGUA 1V6NA 4FQ4A 2AH2A 5KXBA 3LSDA 1W0OA 4K21A 1LOAA 3ZVXA 4CRQA 2YXSA 5T5PA 3PJQA 4YGBA 1V6LA 2PHFA 2ZA9A 4JCKA 4RA0A 4K1ZA 4YW5A 2DUPA 1BYHA 5HCAA 4Q1PA 1O4YA 1W0PA 2EIGA 1UMZA 1LHWA 2ARXA 1LULA 2AREA 2VUAA 2A70A 4Y1ZA 1ULGA 1OFSA 2OUJA 3GNEA 1G7YA 1N1VA 3FLTA 3SH3A 4YM1A 3HN1A 3UJQA 1WW5A 1VIWB 5EYYA 1WUVA 1NXD1 2VW0A 3HR9A 2SLIA 4BMBA 1BKZA 3AXDA 3ILFA 2ZKNA 1WW6A 2NP0A 1LESA 2GN3A 4NOTA 1AXZA 1ZA4A 5HCFA 1D0HA 2DVAA 4P9YA 3ILNA 2PELA 1GSLA 1IOAA 4JC1A 5H9RA 3WV6A 4FPHA 2ZGTA 2UWCA 3SITA 4XOGA 3LSEA 4AVVA 4M00A 2D6NA 1ZM1A 3N7MA 1KITA 2AR6A 3OJBA 4SLIA 3V0BA 3QCWA 5IK7A 5CB7A 1QGLA 4XJZA 1OQ1A 5GLUA 3WVJA 4U2AA 2D6LX 1AX0A 3VKOA 2GNMA 2VY0A 3AYAA 2ZGLA 1RIRA 3ZXFA 4GKXA 3RMXA 4C1WA 1EPWA 5H9QA 1N1SA 1PZ9A 2R16A 1N3QA 1V6JA 3T2TA 2E53A 2WT0A 1QMJA 4M01A 5GJ6A 2V5YA 1WBFA 3WDTA 1SLTA 4ISRA 5L73A 4FPJA 3B9CA 2Q5TA 1MVQA 4FPLA 1LEDA 3I4IA 2CTVA 4FOWA 3ZXLA 4GWNA 4M3CB 1LGNA 4YGDA 1RITA 1D2SA 1GYKA 2JKBA 1R1ZA 1KDKA 4C1XA 5EYXA 5HCBA 4XJ9A 1JOJA 2E7TA 4PQ9A 1DHKB 1LOCA 2PHXA 4YW4A 3AZYA 1ENSA 1Q8OA 2PHUA 3V0AB 3O0VA 1PZ7A 1V6IA 5FREA 1Q8PA 2ARBA 1JHNA 4Y1UA 4UW6A 4WV8A 1F5FA 2DVFA 1DLLA 1G9CA 4GXLA 1UX6A 1FAYA 3PVEA 2RHPA 1IS4A 4LBJA 4XHXA 5IT6A 2C9AA 1LENA 1G9AA 2A6VA 2LTNA 1GZWB 2GNTA 1SBDA 2EF6A 4AGGA 4BLJA 1FNYA 2UWAA 1A8DA 1F31A 1WD3A 4XILA 2DWRA 4FPOB 2ZHMA 1ENRA 4GA9A 3USUA 1MVEA 2GMMA 5KXDA 1LOBA 1B09A 1LOFC 1OKQA 2JD4A 2Z42A 1MS5A 2CWSA 2WT1A 3ATGA 3FUOA 1YI7A 5DG1A 4XBLA 4Y22A 3HMYA 3VV1A 4DRVA 1DQ5A 1MS4A 2ZHLA 1TEIA 3ZYPA 2GALA 3N35A 1ULCA 2BQPA 3O0WA 3ASIA 1UKGA 2XB6C 2AUYA 1ULFA 3UL2A 4XZPA 2OUHA 2R0HA 1HLCA 1N3OA 3VUOA 4R9DA 2JJ6A 1AXYA 1WW4A 4XMAA 2ZMNA 1GKBA 2EAKA 2FMDA 3RG0A 5JOWA 1DYKA 4XXPA 3MEPA 4GKYA 3I8TA 4YG0A 5JVVA 1C4RA 2KM2A 1C1LA 4M3CE 3O12A 2R1BA 1W6QB 2WLQA 4XTMA 1KDMA 3AX4A 3OBRA 3WG2A 1W6QA 1A3KA 5IK4A 2ZGQA 1LTEA 3SNMA 4GWMA 2NMNA 1W6PB 1QOSA 2NMOA 3CNAA 4Q2FA 2GNBA 2WQZC 3ZYRA 3V0BB 4Y1VA 5DG2A 1GZ9A 4Q8LA 5JOYA 4YLZA 3NV4A 1SLBA 5T50A 1CESA 2A5ZA 2R49A 1Q56A 3MPPG 4PF5A 1URXA 3WZ1A 1LODA 3B01A 3OGGA 3LCPA 2WT2A 4XJ8A 1BZWA 2EXHA 1SBFA 3M3EA 3ZSKA 2CWMA 1QF3A 3ENRA 1N47A 5JDBA 3AZXA 3M2MA 3WHUA 2ZGOA 4DRRA 1AJOA 1HKDA 1H9WA 2ES3A 4LBLA 4NO4A 5GALA 3AZWA 1J1TA 2D6OX 5IK8A 1Z0HA 5DUXA 2YV8A 3DUIA 1ULDA 3ZXJA 3M3CA 1CPNA 1QDOA 3PMEA 5GZDA 3BTAA 3AYDA 4HL0A 1IS3A 1W6OA 3ZSLA 2PHTA 4Y1YA 2UWBA 1RINA 1WD4A 3QLQA 5GLVA 5KXEA 2ZBJA 2D6KA 1V6MA 1SACA 3MW3A 3IM0A 5JOZA 5E89A 1LECA 4F83A 1W6NB 1Q8QA 3FBYA 4AGVA 2P3JA 2EXJA 1FV2A 3V0AA 4XYXA 4Q26A 1IKPA 1S0DA 1LJ7A 4FP3A 3SH4A 4XDQA 3WLUA 1DYPA 2W68A 1GICA 2GNDA 3Q9OA 4P14A 5T54A 2YZ4A 2P3IA 1BJQA 3FFZA 4M3CF 4Y26A 1GZCA 3WDUA 1MS1A 2JDZA 2ZGMA 5BYNA 2NZ9A 2ZGSA 3O5SA 1O4ZA 1ULEA 2DVGA 1HQWA 3IPVA 1LHNA 1W6MB 2DYCA 4XIOA 4XMIA 3ZXKA 4CZSA 1Y7BA 3ZXEA 2OVUA 1YYNA 3BODA 1MS3A 1LHOA 1UN1A 2AYHA 2DTYA 1QDCA 4LBQA 3T1MA 1AJKA 1Z78A 3RMYA 1C1FA 4YZ5A 3WOGA 1G9DA 2P2KA 2JE7A 3AP4A 3SH5A 2R1DA 1G9BA 2A3WA 1VALA 2WSVA 1MR5A 1CPMA 1C57A 2A6XA 1S0CA 1AX1A 1S0IA 2E6VA 5H9PA 4Q1RA 1LOGA 3JUUA 3OY8B 5T5OA 1A78A 4XTPA 4Y20A 5DUWA 3RS6A 1Q8VA 3IMNA 1DIWA 2D6MA 3IN9A 3R4SA 1DQ1A 4FPKA 3OYWA 1UZZA 4MYEA 2D43A 3WDYA 3NV3A 3VKNA 1QNWA 1NLSA 4ASMB 4FPCA 3NV1A 4XXAA 1WLDA 3KM5A 1I1EA 2R0FA 4ATFA 4AGRA 5H9SA 1GV9A 2E51A 2VW1A 2A6WA 4DQAA 3V65A 3B00A 3W58A 2DU1A
chains in the Genus database with same CATH superfamily
1PZ8A 2ZOEB 3CMGA 3ZDVA 2CYFA 4CDXA 1GU3A 1HQLA 4C91A 1B35A 2ZPXA 1R093 3KSCA 3BTYA 4K7JA 5FFOC 2R063 5FZIA 1MZ6A 4YARA 2VZQA 4NRQA 5FY7A 3VZOA 4NAOA 5FMBA 1E5SA 5KHJA 3NWKA 3PLQA 1H8TB 2JDAA 4LULA 1XQNA 3BPSA 2WR9A 3MF6A 4PDWA 4IEYA 5L9VA 1WLWA 1OD5A 1V00A 5A7QA 4QPGA 5G04L 2VZUA 2QDRA 3B3QE 4PBOA 5FBJA 4G3YC 3T4VA 1I3HA 1K5MB 2ZS6B 3VD9A 2V73A 4XUPA 2XKPA 2WZ8A 3CZJA 5DAXA 4YGEA 1VRH1 1CD3G 3RQ0A 4QXCA 4PDWC 4IDZA 2OT7A 4CPBD 2YROA 2ZX3A 2HWD2 3ES4A 1QOOA 4N53C 4QPWA 4DINB 4UFJA 3RRDA 3VN4A 5G05L 3VKMA 1OLQA 3NJYA 3JBG1 2RDSA 2FDFA 3PL0A 4NJ4A 1JBCA 3CZUA 2A71A 2VR4A 2JE8A 4D6RA 5DZGA 2HWD3 3ZR6A 1C8M1 4CDUC 3BTXA 1QJY2 2Q1ZB 3SISA 1GANA 2ZHKA 3D4KA 5FP4A 1BEV1 3IDAA 4Q4W2 1VBE2 4L0PA 4ZHNA 1FMD1 3RYPA 2GN7A 2RDRA 2WUHA 2HWC1 2YY1A 3AMNA 5CKMA 2WKKA 3CEWA 3UJOA 1CZSA 4ZXKA 4AZZA 2ADDA 3VD5A 4FTEA 2JICA 1BHGA 3B93A 3OPZA 3I2HA 2YC0A 1IPJA 4N53B 3RZMA 5D21A 3VBFC 3CKHA 3RI8A 4A7ZA 4PT6A 3T0DA 1QXRA 3UGHA 3LOBA 5JXHA 2R7EB 2WNUA 1I5ZA 4YZ4A 2VZSA 3U4XA 2QQIA 5A6QA 4O9GA 5LRRA 4ZKTB 1D0GA 5T5JA 1MEC3 3VDBA 4RFT0 4XBNA 4QXKA 4COVA 1UOGA 1Z7S3 3I7DA 4WVZA 1OA4A 3N3HA 4XBQA 3H8XA 1FPN3 1QKQA 3CJXA 2UU8A 4FSJA 1AVBA 2QJVA 3AP6A 1VRH2 2F6BA 5AVAA 3KV6A 2JX9A 2HWF3 2VMDA 1W6OB 4ATEA 4XE9A 3ZYGA 5FYVA 1QNYA 5EXOA 4XJUA 1POQA 2Y64A 3GBWA 4ISQA 4AAPA 2W52A 3VBOB 2H0VA 1GNZA 1VAKA 3R4DB 4A6SA 3MYXA 3K48A 2DCJA 5CIRA 1W3XA 4WBBA 4L8QA 3T0BA 4RL7A 2Q8OA 4YW1A 1HRI3 5FO9B 2WFPA 1LU2A 1VBC1 2WSUA 3CU7A 2VMCA 4BIOA 2A73B 3U10A 4QB6A 5FXZA 3TBDA 1SMVA 1YIFA 2ETEA 4Q4W1 4ES8A 4XF0A 1UYYA 1YJLA 3SXWA 4NROA 3AB0A 5DZFA 2HWC2 1WCSA 3PURA 2VNOA 2YFZA 1PVC3 3T2QA 1NA1B 2XJPA 5GLWA 1W9YA 5K0UC 3ITQA 3MW2A 3PTYA 1GNHA 2WAOA 1AF9A 2PYTA 3WW3A 2Y0OA 1F9KA 3IKWA 1JN2P 4HANA 3AP7A 4ZXEA 4AR2A 1YRZA 4COWA 1GOFA 3A4UA 3MIHA 3AKTA 5LATA 4AF9A 3WF0A 4MGKE 4B8EA 4TXWA 1F4AA 3LA3A 1NCRB 1DQ6A 1B35C 1CAUB 3KV4A 4LJHA 2DUOA 4MXWA 1SLCA 4LXLA 2C0ZA 3O1OA 3S57A 5C70A 1YHFA 4CCEA 5FBZA 1HJFA 1LU1A 2H0BA 5CZKA 2VVEA 2Y8KA 3AZZA 3VBHC 4CYDA 4CUCA 1LCLA 1N1YA 3MW4A 2KR2A 4W6WA 5EWSA 4CUBA 1OA3A 3NVCA 1MQTB 1WW7A 2NN8A 4HG6B 3WUCA 3D0JA 2JG9A 4L92A 2WN2A 3ZFFC 5F6LB 1W0NA 3OYWB 5FPVA 4DXRA 2FDHA 1NQJA 1LHUA 1JYCA 5JIUA 1OUSA 1G8WA 3ZPYA 4DUWA 4BOWA 3D82A 4M4PA 2PHWA 3AFKA 1YWKA 2YHJA 3E6DA 3PDQA 3PUHA 5IUQA 3WP4A 2FZ2A 4Y33A 2BPA2 4W6YA 3FLRA 5JXIA 5KBFA 4OLLA 1IQDC 1PIV2 2IUWA 3PVOA 2VUCA 4UW4A 5GLTA 3RDIA 4D7TA 1S55A 1UY0A 2RDQA 3USUB 5T55A 5A1AA 5F6KA 5C9AC 4LBNA 1AYN3 2GDFA 2VE1A 5FKBA 1AL22 1GLHA 1JOBA 1YJKA 3N9NA 4AQ6A 5KC5A 4JGYA 5C5UA 1Z7S2 2WINB 3MV11 3VHNA 4W4ZA 1LR5A 1OKOA 4FPEA 1ST8A 4OI2A 5FZKA 3LOIA 3FHIB 5FZLA 2EALA 1AYN2 1YO8A 2B7YA 2ENRA 3PU3A 4B1MA 4BYYA 5C3OA 2YU2A 4BM8A 4QQOA 4UAPA 2JE9A 4M0HA 5DABA 3POSA 3FL7A 2DF7A 1OSGA 1CJPA 1ZZ7A 3LQCA 3LA7A 3MFAA 1VE0A 3WG1A 2AGSA 4NIAA 3DGTA 4LO7A 1RUD2 2GC2A 1SCSA 1L3JA 2B46X 1X7NA 5T3NA 4NN0A 4LHSA 1FOD1 3DL3A 1U0AA 4GH4B 4OHYA 3L2YA 1GQPA 1IS6A 4BQ3A 4W6XA 5FLIA 1YFXA 3JD73 3MIEA 1GFF2 4KH9A 5JR7B 1ND2A 3CJIA 4CRQA 2YXSA 1H1IA 3WY6A 1SPPA 3PJQA 4CP0A 5C71A 4LUMA 1QJU3 4N90A 4YW5A 4IUGA 5HCAA 1YQ5A 4Q1PA 2J22A 1UMZA 1LHWA 2VZOA 1B35B 2AREA 3O7OA 5JSRA 2OUJA 2RS11 2JWPA 3FBMA 5FDBA 4GQ7A 4UOJA 4YM1A 1O5LA 4QWNA 4AEDA 4HMZA 3NL1A 1VJ2A 2VW0A 3DYMA 3AXDA 5KC6A 2ZKNA 3EYPA 1Z7S1 3CO2A 5BNPC 4LIVA 4LUKA 3NNJA 4NOTA 1SHWB 2G9FA 1AXZA 4P00B 4B4PA 2XL7A 2HEWF 3K4AA 1HXS1 2DVAA 3WW2A 5J98B 4NIIA 1MQTA 1O7FA 4GMP1 1IOAA 2ZGTA 4A3XA 4CU6A 3QACA 5AC92 2B42B 2RMU1 4Q4Y1 4SLIA 3JB4C 4HFSA 4XETA 1YEWA 2KXLA 3P6BA 4G9SB 2XLAA 4JHTA 4MV2A 4BU2A 4XJZA 1OQ1A 5IAVA 3WX5A 3POFA 5FTTC 3ZN5A 2GNMA 2VY0A 1XXNA 2Z79A 4XF1A 4Y3OA 1CAUA 3LPFA 1W2AX 3RMXA 1EPWA 4IEUA 1FOD2 1H2LA 2BNMA 1ZBA2 2V4VA 1PZ9A 1SPPB 2R16A 3DPRA 1ZZ9A 1J58A 2E53A 1RUJ3 5JZGC 1PIV3 2WQ4A 3LE0A 5CFCC 1GWKA 5FV3A 1WBFA 3WDTA 1SLTA 5KHKA 5L73A 3DXUA 5FZ4A 1CAWA 3VBHA 2R30A 1U5YA 4JDOA 3ZXLA 3GCXA 4M3CB 4AI2A 4AVAA 5FZFA 1WMEA 1ULPA 4A44A 2JKBA 1DGWX 1R1ZA 4CCLA 3VDDA 4UFLA 4LPLA 3BPZA 2LUWA 1DHKB 1LOCA 2J1TA 3ZFGC 3AZYA 1BVVA 4YVWC 4XF9A 3TNQA 1OQEA 1Q8OA 2P4EA 4QGNA 1GWLA 5FREA 4CCOA 4Y1UA 2IVIB 3NMBA 5ERLA 4DB5A 2YC2A 4GXLA 1UX6A 3VBSA 1G9CA 3PVEA 4HKWA 1IS4A 5F5IA 5FYBA 5IT6A 2A1XA 1NCQA 3SHRA 1LENA 1G9AA 1JU4A 2LTNA 4AGGA 2GNTA 3WF3A 5IW0A 1HIXA 3BI3A 4XW3A 1OT5A 4KWUA 2E63A 4QXBA 5AC91 4D94A 1WZXA 3MLJA 3MBWA 2ARCA 2ZHMA 1IHMA 5L9RA 3RI9A 3AL6A 5AFBA 2GMMA 1LOBA 1B09A 1GMMA 2AZ5A 1OKQA 2Z42A 2D93A 2WT1A 2WC2A 4LIUA 4XBLA 4XFFA 1DGRN 4OULA 4KI5M 2HEYF 1RL3A 4DRVA 1ZBA1 2QUOA 2WZR3 2JG8B 1XB9A 4HK8A 3ZYPA 4AI1A 5EIYB 2GALA 2X29A 2NPIA 4XAAA 2NLRA 2HWE1 3O0WA 4RYDA 2AUYA 3I2IA 3UL2A 2WS93 4QHZA 3TEWA 1N3OA 4OUMA 4QQ2A 2Y6GA 2WZR1 1GUIA 3LPGA 1WW4A 5JOWA 1WCQA 2ZMNA 4R52A 3RG0A 3I2OA 3PHMA 4MH0E 1S4CA 2CGOA 5C4WA 3I8TA 1OVSA 2KM2A 3K46A 5IAXA 5FZ6A 1WA4A 3J8F2 2ZEYA 4XUOA 4MXVA 2BU9A 4EYUA 5BNOB 3DF0A 4IV1A 1ND2C 2AACA 2WLQA 2Z2SB 5IVCA 2JXAA 1SFNA 3ROUA 3WG2A 5A32A 1W6QA 5IK4A 1X36A 1KD7A 2E9QA 2W0XA 1XNDA 1NCRA 2F4LA 4NR1A 5LB6A 5BNOA 4AEJA 5KR7A 1W6PB 1XRUA 4MGQA 1O3QA 4QB2A 3WXPA 1X8MA 4BCUA 2VG9A 4Q8LA 3QOPA 5JOYA 1CX4A 4IGOA 4IV3C 3D8CA 3NV4A 3AMPA 1HB2A 1CESA 3TNPB 1E5IA 5BNPA 5CFDC 3MPPG 4N7IA 2EA7A 4NMIA 5C9AB 1PK6B 3BKZA 4IESA 3B01A 1RVF1 4ORFA 3SCGA 2IVJA 1VB4A 2P6HA 3LCPA 2VMFA 4MGTA 2EXHA 1SBFA 5LASA 2WYFA 3RFRA 4XF4A 2JIGA 4Q4V3 1ND3B 5D1IA 1EUTA 5FOJB 5I8TA 2PHDA 4W8JA 5F32A 2ES3A 2V09A 2RR12 4BB3A 5I8YA 1J1TA 3MZHA 2D6OX 5TSWA 5IVJA 2HWE2 1J59A 4JTNA 1Z0HA 1RUF1 4FBFA 2W1UA 2YV8A 3ZXJA 2QE3A 1QDOA 2VBDA 3PMEA 4K40A 4IV3B 5FAXA 4HL0A 5GZDA 4NVPA 2UWBA 1V9U2 1WD4A 5GLVA 2VULA 3MUY1 1W04A 1YFUA 2VBBA 3IM0A 4OI1A 1X9TA 4EROA 1JH5A 3HNBM 1EUUA 3S5AA 4RHV2 1Q8QA 2QQPA 2G19A 4AGVA 3KV5A 3JB8A 5CYYA 3KMHA 1GQGA 1LNSA 4XYXA 1S0DA 1LJ7A 2Z4FA 1TG7A 1SG3A 3POJA 5FZ7A 3AL5A 3FFQA 3FHAA 4FP3A 4QT6A 3J7NA 1XU1A 3KVAA 1DYPA 4XDQA 1S2BA 2OXBA 3I3BA 4FFHA 1GICA 1GP5A 3KGZA 3ELNA 3BCWA 4ZU5A 3MFCA 4OHZA 1UD1A 2P3IA 2YZ4A 4M3CF 5FUNA 2AEYA 3TOJA 4CCMA 4E4DX 1CIYA 2VTXA 4CDWB 5BYNA 3NKTA 3VDAA 5CISA 2ZGSA 5EV7A 1PVC2 4Y5Z0 4D0QA 3MV01 1NA1C 1LHNA 3PUIA 1NAEA 1UKRA 1DZRA 2IXKA 2BFUL 2OVUA 2Y33A 4NPLA 2L9LA 1ZRFA 1MS3A 4ZZ5A 2BNNA 2DTYA 4LBQA 3T1MA 1AJKA 4YZ5A 5FLHA 1C1FA 4KGQA 3RMYA 2QZ2A 4QX2A 2P2KA 5FZGA 1HRV1 5A3OA 4C0BA 4DXTA 4LKDA 2Q8EA 3LIHA 2WSVA 4QM9A 2GSYA 1TNRA 4NUBA 5FPXA 1AX1A 2RR11 4EN8B 2JB4A 3I59A 1LOGA 5T5OA 5IHRA 4XTPA 3BALA 3C7EA 2QZ3A 4KWJA 3FX3A 2X5IB 5F5AA 1DQ1A 4X6RB 4AFBA 5BXXA 5L19A 1UZZA 4J6GA 3NV3A 3VKNA 4E8DA 1K5MA 1CAXA 3LKJA 4FPCA 2VPVA 3WW1A 1RUF3 2PN5A 1I1EA 3U07A 4BQ5A 4CU8A 4E4ZA 2A6WA 2GZWA 1NUKA 1O8SA 2RG4A 1VBA1 1X50A 5FOBB 1UNBA 1RUG2 1WBLA 4R4XA 2PTMA 4L11A 4LO8A 1W3VA 1JYIA 1KFUL 4LO4B 3M4FA 1MACA 4S2FA 5FY8A 3VBOC 2VVDA 2R041 3M8LA 5KXCA 1S0JA 1W2UA 3ME2A 2QQLA 1MZ5A 5GZGA 3VBRB 1NLQA 1HN1A 1IG0A 4Z92B 4AFAA 1QU0A 5FK8A 2A3YA 2F4PA 5JR2A 3AFGA 2UY9A 1PNFA 4XJWA 5E1RA 4XDOA 4HPKA 3I3MA 4XZUG 1AR91 3WHTA 5C7GA 1MS8A 1PK6A 4R9BA 4RR3C 5C5TA 4XACA 3H8OA 2BV4A 4UYBA 5CNAA 1RJ8A 3LFIA 4H55A 1AR63 4F8AA 2MEV2 4XFCA 1S0BA 5JLVA 3IB3A 4TYSA 3O1RA 4HVRA 3WNOA 1FT9A 3NV2A 5FY4A 3ZFEC 3VBRC 1W6PA 2A7AA 3J7HA 3Q8BA 2BNOA 1PMJX 5I0UA 3HNMA 5M0TA 5GZEA 5BNNA 3UYJA 5J1XA 2YB7A 3NNMA 5FYMA 2OZ6A 3PVNA 3T3YA 3WG3A 1AXKA 3X29B 4OZXA 4AE2A 4B1LA 1FV3A 2WNVA 5FRAA 3CBNA 5GLZA 1A34A 2JDKA 2DV9A 2WJSA 3JBG2 2JDUA 4PI0A 4RR3B 5I93A 2WO2A 2WL1A 3U78A 1N1TA 4BISA 4IGQA 1HV1A 1MS9A 2BDRA 2GP3A 2X8KA 2D44A 3A0KA 4FQZA 4RQPB 1XNBA 4E2SA 5FZMA 3H3LA 3OCPA 2ZCWA 3U11A 4IE6A 4DUXA 1C8M2 2TUNA 5CA6A 1QJY1 4FOQA 2O8QA 3OD0A 2YG0A 1D7PM 5EFUA 4CVUA 1VBE1 3T4HB 5B4XA 4XJAA 4DOUA 1HW5A 2VZVA 3B94A 4N43A 1R1A3 1S0FA 2KD7A 3GBGA 5J3UA 3O1TA 3KWVA 2ZTNA 3SEPA 1UY1A 4EN7B 2R072 4GWIA 4DZGA 1AR92 4N8MA 2BFUS 5SV8A 2WZEA 3C7HA 1DQ2A 3UKTA 2DVBA 3C2UA 1H0BA 3CHXA 5A7WA 4F3JA 4RQPC 4BQWA 5EQUA 4EZ4A 3MIGA 2WWSA 4UW3A 3H1WA 3OGRA 4AFDA 1X9PA 4K1YA 1DGLA 5LBBA 4CDQB 2MEV3 3BIWE 4K8RB 4XQDA 1NY71 4AVTA 1W06A 1J1LA 3PMSA 5JDBA 2Y6LA 2FQPA 3OEBA 2VQ0A 4YWAA 3RJRA 2VCMA 4DEVA 1ZRCA 1KJRA 3ZSMA 2W39A 2ATFA 4JQRA 1Y9MA 2Y6KA 3THPA 2VU9A 4JRLA 3VZMA 5J96B 1M4WA 4NWVA 3RZKA 3VDDC 3AKRA 2P3KA 3WUDA 2RS52 3HT2A 2PFWA 1LKNA 3POYA 2D97A 4A6OA 4UF0B 1RUNA 4I0AA 5DZEA 4GIQA 5DAQA 4DIQA 1OOPB 5F3GA 4YZ2A 5LY1A 2CSGA 3ETQA 1UZ0A 1RHI2 1UZVA 4CP1A 2IXIA 1O4TA 4HOOA 2R061 4WVVA 1V6OA 3WP6A 3TN92 5J37A 1S0GA 1VPHA 3O0XA 1YXWA 5B4NA 1QIQA 3UESA 5FZ8A 3W5NA 1GNYA 2GAUA 3J9SA 3K75B 4KWLA 4YGCA 1CR7A 1BXHA 2CY6A 4FTSA 4MHRA 2YMZA 4ZY9A 1QJY3 2FBEA 2NYYA 1PMIA 4Q0PA 2JD9A 3WD5A 5LA0A 1QQP3 3KZ4C 2HH9A 3P1IA 5GZFA 3F95A 3RZJA 2K46A 5FP7A 1F2NA 4QQLA 3IDBB 2E7QA 5LCWL 1QJZA 1UX7A 4OQ9A 1DU3D 4D69A 3AYCA 4YG3A 5I0SA 2LROA 3AKPA 4MGIE 4N43B 1Q43A 2ZMLA 3GZUC 4XFBA 5D8AA 5DAWA 2E31A 1NY72 4DUVA 1DDLA 2MHFA 2OW4A 1OF3A 5CKNA 2VUJA 1JW6A 2JG8A 2X5IA 4V2WA 4MG2A 3MF9A 3H0OA 2HWB3 4QHOA 1ENQA 3WNPA 3G7DA 1UAIA 1AR93 2YBKA 5FR3A 5A7OA 3ZO0B 3AP9A 3AP5A 1DZQA 4OCTA 5LK5A 4CU9A 3AMHA 3NKGA 1UL9A 2SBAA 1R1A2 4UW5A 3HOBA 3ZFEA 1CAVB 1JXNA 1DZTA 1NE6A 3JCIA 5J09A 3MICA 2VOKA 3AYEA 3UK9A 1TQ5A 2ZX1A 2VZTA 4QGMA 2ZABA 2J1VA 2Z69A 1FYUA 5FZ0A 1RHI1 5BNOC 1QHDA 3CJIB 2R062 4ZONA 3DKWA 4A4AA 1W8NA 3JU9A 3TN91 2XMLA 1QXJA 3VB9A 1W6MA 3FLPA 1BBT2 4IQPA 4LR4A 3AVRA 3VHOA 4KBBA 5KHGA 2ET1A 4INDA 3OOXA 1TZOA 3OGSA 3LWCA 5JUVA 1MS0A 2BGCA 4FPGA 3ZYIB 3OD4A 4K20A 4XHBA 2QKDA 2YGMA 3HNYM 5JMCA 4IEQA 4XIKA 1AYM3 3T1LA 1SLIA 3VDDB 5L9BA 4FPYA 1YQCA 4Y24A 1AYN1 1OH4A 3THCA 2TBVA 4BK5A 4M3CA 5FZOA 1QJEA 1JOPA 3H50A 4Y4RA 4AVCA 4DXSA 4F7ZA 4XFAA 2NM1A 4KQ7A 2WS91 4M0NA 4WM7A 3MDPA 4PDWB 4PIZA 4XCBA 2HWE3 2AH2A 3LSDA 4CEYA 1JTZX 3T2OA 2Q1FA 3ACFA 1V6LA 2ZA9A 4MGSA 2J1AA 2DUPA 3T30A 1O4YA 3LZZA 2ET7A 5EHDA 4EV0A 2EIGA 3WP3A 3BUCA 1UWWA 5DMYA 2WIIB 5LBFA 1POV3 2VUAA 2A70A 1COV1 5EP9A 3VL9A 5C3QA 3SKVA 1D4M2 4RGKA 4A42A 3HN1A 4YVWA 1WW5A 4LMFA 4B29A 5EYYA 1NXD1 3M7AA 3ZFGB 2SLIA 2ZX2A 1BKZA 3ILFA 3OUIA 4D3WA 2G9ZA 4PIYA 4Z2AA 5FY0A 2QQKA 5HCFA 3GBFA 5CADA 2RS12 2DDUA 4CDQC 3VBFB 2VD7A 4P9GA 2XL9A 2X09A 4JC1A 4MADA 4NHMA 1F4HA 2QQJA 3ZPOA 2UWCA 3FWEA 4NHKA 4M00A 1PO21 1OC1A 1ZM1A 1W8TA 2AR6A 3N7MA 1POV0 2BJSA 3V0BA 3KS7A 1HXS2 3QCWA 4XCAA 5C6CA 5IK7A 1RHI3 1QGLA 1NZCA 3ON7A 1ZRIA 4U2AA 2D6LX 1OLME 3N9LA 3KCCA 5FPUA 1QJU1 4QKDA 2DFCA 3ZXFA 4GKXA 2VQTA 4IV1B 5LEJA 1J3RA 5D2AA 1W03A 5FY9A 5JPNB 2WS92 4N9HA 2VTXJ 2RMU2 4Q4Y2 4P5HA 3T2TA 1X8EA 3H7YA 4M4RA 5GJ6A 1AR62 4LLFA 3RWNA 1ZZ6A 3B9CA 4GJZA 3THDA 3WNLA 1LEDA 1UMHA 2DBIA 5A7PA 2XBO3 4FAGA 5CFCB 3SCFA 1K5MC 4L2NA 4TWTA 5HPOA 1UOJA 5JXJA 4C1XA 5HCBA 1JOJA 3PIJA 4YW4A 5IFPA 1QJX3 2QDNA 4QQPA 1ENSA 5A70A 2BTVC 3V0AB 2JG8C 2VUDA 4A41A 1Q8PA 2BZDA 3ZYHA 1JHNA 3PVBB 4GMP3 3QD6A 4OHXA 1F5FA 5BUVA 1JMUB 4BQXA 3KT7A 4XHXA 5DAVA 5FYTA 1WCUA 5IJRA 3VBOA 3ZFFA 3LFMA 2RM23 2RVAA 2DFBA 1PO11 2A6VA 4IV3A 4BLJA 1SBDA 2EF6A 1FNYA 1KFXL 1SQ4A 1F31A 3C8XA 4PIXA 1PO22 4FPOB 3PTRB 1RMU1 2YDEA 3USUA 1OLRA 1MVEA 2XJQA 3CL1A 3LA2A 4YPJA 2I45A 4RS5B 4XURA 4AXOA 1ND3A 3FUOA 4D6QA 1QJU2 1YI7A 1H1MA 1TMF1 3ZX7A 4GB33 3UKVA 4XF3A 1NKGA 3KHCA 2XJUA 2P3YA 2ZX0A 3KB5A 3NNFA 4JGZA 3NJXA 2BVVA 4O65A 1CZTA 4QKFA 1GP6A 2W47A 4MUVA 1JUHA 3VBHB 1CAWB 2OUHA 1HLCA 2XONA 5L7OC 3VUOA 3S5QA 5IFTA 2JJ6A 3UT0A 1AXYA 1L7LA 1KS4A 4MSVA 5FIXA 2J1EA 1JODA 2VXJA 2VZPA 1JYNA 4LE4A 4Q4V1 3B7MA 4XXPA 4GKYA 1IG3A 5JVVA 1C4RA 4A7YA 1C1LA 2D5HA 4M3CE 4CEYC 2BBAA 4FFFA 1X82A 2WZR2 4WVMB 2XQXA 4MXWB 4HKOA 1U5XA 2ORXA 2ZGQA 1LTEA 4LKSA 1I9RA 1VR3A 1TVGA 4G4FA 2CDPA 2NMOA 4URTA 1ZRDA 4KGGA 4LE3A 5A3TA 2WQZC 2PMWB 3J8F1 1OF4A 3DN7A 3ZXAC 3P5BA 1PM4A 2W1WA 4YLZA 2B9VA 1NA1A 2DCTA 1SLBA 5T50A 1W2OA 3WQBA 1WMFA 4JDNA 5HV4A 1XOYA 2R043 3WR0A 1URXA 4FTBA 3WZ1A 1LODA 2RS53 2VNRA 1E57A 4UBHA 4LHKA 4XJ8A 3MIBA 3ZFGA 2FDJA 1QF3A 1TMF2 1N47A 2HWB1 1ZNPA 2YU1A 2J1SA 5FYIA 1U12A 3AZXA 4XEZA 3SKJE 1GP4A 1W8HA 2J42A 1AJOA 1HKDA 4GMP0 4LBLA 3H3ZA 1ULOA 3AZWA 4LHLA 2QFEA 4NO4A 3SEEA 1POV1 3ETPA 5DUXA 2MPFA 1ULDA 3WF2A 4EWDA 2BGPA 4HLTA 4QPYA 1UIJA 1MQTC 2WFF3 2PHTA 2XPJA 1RINA 5GKAC 3ZFFB 1V6MA 2VTFA 3MW3A 4JZRA 5JOZA 5E89A 1ZVFA 1YI9A 3VBSB 1O6UA 5FUIA 1W6NB 1US2A 3OPWA 3IWZA 4F83A 3HBKA 1MEC1 2BW8A 3FBYA 2PA7A 5FO8B 3ZYFA 1V9U1 2OA2A 4HETA 2ZXQA 5DQ0A 3IBMA 4BQ4A 5T54A 3DPRC 1GOHA 1AUYA 1BJQA 1UIKA 3W5MA 4IEOA 3NJZA 4XUTA 2JDZA 2VAUA 2ZGMA 3JQXA 1W8FA 2RDNA 5F39A 1HB4A 4X6QB 3ZN4A 5L7OB 4XIOA 1XYOA 4EN6B 1JYTA 3AVSA 4LKEA 1WWYA 4JGYC 4H3WA 3BODA 1QJX1 4P9IA 5A1FA 4ONUA 3J8F3 5F3EA 4QXHA 2AYHA 5J36A 1ZREA 4QM8A 3UNPA 2IZWA 3S6PA 1PVC1 1W39A 1PK6C 1UYXA 4FO9A 4EN0A 1REEA 3FN9A 4AHXA 1G9BA 2A3WA 3IT8A 1MR5A 1CPMA 3EO6A 1C57A 1S0CA 4Q4W3 4QX7A 2E6VA 5H9PA 4A45A 3JUUA 5FMCA 1A78A 3A23A 2WRAA 4RHV3 4Y20A 5DUWA 1GWMA 1RUJ1 3BB6A 5D8AC 3VL8A 1HRV2 4GJYA 2FCUA 3UETA 1BCXA 2O14A 1XNAA 2FCVA 3IN9A 4FPKA 3LAGA 4K9SA 4V1PA 4A2UA 2VMIA 2D43A 2YC4A 3RYKA 3ZOIA 3U14A 5CFDA 5F7UA 1QQP2 4QDRA 2BBVA 2NQYA 3J7LA 4ASMB 1VP6A 3LDRA 5J7MA 1WLDA 3EB7A 5A3NA 1OA2A 4AGRA 2RR13 2VW1A 2JKXA 1IPSA 3CIHA 3V65A 1RTVA 4HKLA 2B5HA 4YVWB 1E5RA 1HV0A 2DU1A 2B8MA 3FHQA 5JWPA 2VOTA 4QPIB 1F5JA 1OXCA 5FYHA 4AEKA 3J7MA 2X53S 3LDKA 4PBPA 4XUQA 1YFYA 1RVF3 3FUQA 3IMMA 4KG0A 4E9KA 1W8UA 4FXKB 4CUAA 4NAMA 2XHKA 2GMEA 1K12A 4IE5A 5C3RA 2JB8A 4I09A 1UU4A 5F5QA 3S7IA 3VKFC 4CEYB 1DP0A 2G1MA 3I3EA 3NW4A 3ZMNA 1AR73 1OLMA 3MLKA 3AZVA 5IWFA 2RS13 5FYZA 1KGYA 2BP6A 1RUI1 3DXTA 1KXGA 2J7MA 1C5HA 1KRIA 4XFGA 4PLNA 4QX1A 4R9CA 1Q3EA 1CVNA 3MHZA 4QX3A 1OOPC 1ONAA 4BZ4A 4CCCA 1KEXA 1W9FA 1OD3A 2FHRA 2P34A 4N7UA 4R9AA 2HYXA 4LA2A 4B7KA 4WM7C 1W9WA 3MGUA 5FQ0A 5JCTA 3ZXGA 4MGYE 1PX4A 4PF1A 5A33B 4LLOA 3BU0A 4TLFA 1HX6A 3FZ3A 5K8SA 1RYYA 5FY1A 3ILRA 2WZPP 4FOVA 1XNKA 2B45X 1LHVA 3UGGA 5EZWA 1UQXA 3H3UA 5A32B 2MEV1 2IFWA 2C9KA 4A7KA 4JGYB 4CA9A 3O14A 4OHVA 2G9GA 3AXEA 3FMGA 4QMAA 2D98A 4O7XA 1H2KA 1APNA 4PCRA 2VO5A 3N9PA 5FPLA 4DNYA 4DXZA 1HN0A 5LY2A 3R4UA 1I5PA 4W65A 5FJKA 2FCTA 1UPIA 2QQVA 3SLIA 4K3UA 1UO9A 4I3GA 2EICA 3TEYA 4KBZA 1LOFA 2Q0AA 1R091 1FNZA 4JAAA 2CAVA 5A6XA 3OBAA 1YQ2A 2D3PA 2DVDA 2IXLA 4YZ3A 2LALA 2I74A 2VECA 4Y22B 3P3NA 1HDKA 4OUSA 4TZDA 3VBSC 2CL2A 2P17A 1RUI2 5ANNA 4TSVA 1UZYA 3INAA 4OVEA 5A6ZA 2VW2A 3N36A 4HSJA 3OTFA 1JZ4A 4AWDA 4KMQA 3I97A 1N3PA 3EXUA 1LOEA 3N9QA 2XJSA 4HONA 2O8OA 3BVCA 2ZGNA 4RGAA 4BQ1A 4CEWC 4IERA 3Q8AA 1GZWA 2K9ZA 3E97A 1XPWA 4ITCA 2R071 1EY2A 4CXXA 2I2SA 3AC0A 4LQRA 5T5LA 4BE3A 3N9MA 3D6EA 1JI6A 2A3XA 1VAMA 5A33A 5KWRA 5J48A 1AX2A 4FP2A 3F2ZA 4LBKA 3A7QA 2ZHNA 2WLPA 1DCSA 1UPSA 5A3WA 3WDXA 5LEKA 1W8ZA 2QQNA 1G9FA 5ABJC 2D7FA 5HBAA 2WNOA 4TTGA 4FPFA 4NPMA 4RGGA 4DFSA 4WM8A 3WCRA 2XLGA 3WNKA 5LRSA 1XBFA 3VBUA 1UY2A 5HI0A 1NE4A 1ENXA 5IVYA 3WDVA 1EAH1 1H9PA 4OI4A 4OZOA 4HXCA 5I0DA 2F17A 1PVXA 2D40A 1EYBA 3KQRA 1SCRA 2RS51 3RSJA 1PNGA 3WQ1A 3POIA 4UI9L 3O1UA 2TEPA 3VBRA 5JAXA 4HBNA 4LBQD 3C3VA 4X8NA 2D3RA 1O5UA 5BNQA 1Q8SA 4EWEA 2O0OA 4Y4YA 2W94A 2EIDA 2RM22 4GZ9A 4COYA 3TN93 1EV11 4CEWA 3ZSEA 3HWJA 1VLNA 1HB1A 3NO8A 1BK0A 5LA2A 4AVSA 5IK5A 1ND3C 5F3IA 5I8SA 2OZJA 5A1LA 1OURA 2Q4SA 1JYXA 1W90A 4QX0A 2VL4A 4V2VA 3M1HA 2ZAAA 3HPNA 4Z1VA 3AK0A 4XUNA 5CFDB 1UOFA 2XG3A 2JDYA 3GCWA 4I3PA 5FP3A 4R4ZA 3W9AA 1OBNA 1IQAA 2HWF1 3HN3A 1HQNA 2RE9A 4BLIA 2QQWA 1FATA 4FCAA 4R8HA 2BUKA 1OUXA 2QQMA 3MPBA 3RZZA 2VZ3A 4N43C 4Y20B 4CCKA 1CIWA 1Y3TA 4YM3A 1VAVA 1NZIA 1SBEA 1RGSA 4NIDA 5CG8A 2GMPA 2RMU3 4Q4Y3 2ZKLA 4YFWA 1UF2C 2QCSB 1F35A 2Y6JA 3KF5A 3ABZA 4RR3A 3ALQA 4GALA 2WNUC 1AHSA 4EJRA 3EJKA 2D5FA 2A6ZA 2HYKA 1PMHX 2DTWA 2XVKA 1H4GA 3OBTA 5JSOA 3ACIA 2ILMA 3I3DA 4JRAA 3BU7A 5IYYA 2W1SA 1R1A1 3K4DA 5DXDA 3IPVB 3BOPA 4FVVA 4GH4A 1JYWA 3Q8CA 1OH3A 1VBE3 1YIPA 1JUIA 2JECA 2RM21 4YRDA 5FQ0B 4LBMA 3W21A 1EV12 3PUAA 1SZBA 4IEVA 3W59A 1C8M3 3ZLIA 1NCQC 1VBD3 2XJVA 3AKSA 3KCYA 1BBT1 3HEIA 2OPWA 4FXGB 2ZAHA 4AHWA 1AL23 3LEIA 2JDMA 1JYVA 4D6SA 3ZN6A 4JQTA 5HXMA 4P9WA 3FJSA 1KJLA 5I0TA 5GM0A 1QOTA 1QJFA 1QY4A 1UCXA 4GAZA 3T2PA 2IXCA 2ZGUA 2VOXA 1V6NA 1NG0A 3LEMA 2RV9A 3D0SA 4FQ4A 5FMOL 3VZKA 5FPBA 4KG8A 4NIHA 1FOD3 1V0AA 4YNIA 4MGZE 5T5PA 1MZFA 4YGBA 3RWKX 2PHFA 5ACA3 4RA0A 3N4MA 4K1ZA 1RC6A 2XWJB 1BYHA 4LOTA 1O59A 4YVSB 1AYM1 1PGSA 3CLPA 4QB1A 3EMRA 3WF4A 2H6CA 1LULA 1Y4WA 3ZFEB 2XGXA 1VRBA 4CDXB 1ULGA 1OFSA 4AQ2A 3FLTA 2OPKA 2CDOA 3R0RA 4YSFA 1WA6X 3S0MA 1WUVA 2GC1A 4BA6A 4BQYA 3K4ZA 4D7YA 5E6HA 2NP0A 2W3JA 2GN3A 3OSDA 3U0ZA 2P1BA 4IEPA 1XSRA 5ABJA 5FUPA 5BNPB 1COV2 4B3NA 1RB8G 4JKKA 1VBB2 1D4M1 5AC93 4ZS2A 3GYDA 1K3IA 2FDKA 1TME2 1AR83 1HB3A 1NCRC 3NSTA 5H9RA 3WSOA 3SITA 1H4HA 3GZEA 3KGLA 2D6NA 4ASLA 3OJBA 3BOWA 3CQOA 5FK7A 5CB7A 3UV9A 5F1RA 4AFCA 3VKOA 4WVMA 3AYAA 2ZGLA 1UU5A 2CGNA 3ZYBA 3IAQA 4C1WA 5H9QA 2OKXA 1ACCA 1K42A 4CDUB 2P6CA 2DCYA 2H6BA 1ZRRA 2WT0A 1QMJA 1XE0A 4CP2A 2WAAA 4M01A 1RJ7A 4Y5TA 1W2NA 5FZBA 5L7OA 4ISRA 2QQUA 4FPJA 1GZTA 3I4IA 2CTVA 4FOWA 3H9AA 1TMF3 4GWNA 5FWEA 4UWDA 1AYM2 4BHPA 1RITA 2CHHA 1HRV3 1D2SA 4NE9A 1VBD1 1OMIA 3NNGA 2CU5A 4XJ9A 1VMHA 1AR61 2ADEA 3U4SA 2PHXA 4XFHA 1UYZA 4TN7A 3SMHA 4XFIA 3WT3A 2PHUA 1SDDB 1W9TA 1PZ7A 1ZZBA 3KCXA 2WO1A 4EZHA 4WV8A 4KU7A 1DLLA 1H8TC 2VM9A 1H2NA 3MUZ1 4LBJA 2KA3A 4S2GA 1TME1 5FZEA 5FMDA 3L9JT 1A8DA 1REDA 4ZS3A 1WKYA 5FO7B 3K2OA 3URFA 5KXDA 5FXWA 4JTOA 4QPIC 3ZMOA 3NAPB 1MS5A 3ATGA 4RSUA 1PO12 5DG1A 1CJDA 2CV6A 4DEQA 2XBO1 1OPMA 5JI9A 1VBA3 4Y22A 1UZWA 3E6BA 5EJZB 3VV1A 5ACA2 1X33A 3RNSA 2ZHLA 4LHNA 3LD8A 2VOVA 2WNUB 4AFMA 4C8DA 1RMU2 4BWOA 1JZ7A 4QDQA 2XB6C 4HT1T 3VD3A 2HBUA 2B39A 3ORJA 2IXJA 2VVFA 4AVBA 4AEDC 1XNTA 4ARXA 4XMAA 1XU2A 2FMDA 4RQPA 3EBRA 1DYKA 1JHJA 2IFRA 2WQ8A 5FZ3A 3ACGA 4YG0A 5K0UA 3TWIA 4OQ8A 2LM3A 3WEZA 3WP5A 3IAPA 3OB8A 4A3ZA 2R1BA 2TNFA 1YQ8A 1ASJ2 1TNFA 4XTMA 3ZKUA 4CEWB 1KDMA 3AX4A 3OBRA 2VMHA 1UMIA 4Q4X3 1A3KA 2BWCA 4Q4V2 2OYZA 1RUD3 3HJRA 3SNMA 5BNNB 2ZX4A 4Q2FA 1QOSA 2UYBA 3V0BB 2GNBA 4BQ2A 5K0UB 3RYRA 4DO0A 1BVP1 3DCQA 1D2QA 3TYJA 5F37A 1GZ9A 3AMMA 3LEGA 2HWC3 4S2DA 5C8WA 4JVAA 1TME3 4UXAA 4CDWC 3C7GA 1XYNA 1RUC1 1GQHA 4OHWA 3VBUB 4PF5A 5ABJB 4SBVA 4JV4A 2GC3A 2JG9C 3P3PA 4YW6A 2VNGA 2JIJA 1BZWA 3HAGA 3M3EA 4B7EA 2J1RA 4PI2A 2CWMA 2XBO2 3ENRA 2FDGA 5LBEA 1IPKA 3M2MA 3WHUA 4RS5A 5LA9A 2ZGOA 3NAPA 3KD4A 1H9WA 1WCKA 3PU8A 2WBKA 1SDWA 3BGAA 5IVVA 1BMV1 1GR3A 5IVFA 5IK8A 4HZFA 1UYPA 4P9JA 1VB2A 3DUIA 3KLSA 4BH9A 4AG4A 4QGLA 3HQXA 4CDQA 1CPNA 2BYVE 1VRH3 2HWB2 3AYDA 3K3NA 3ZSLA 1H1AA 3HBZA 1JZ8A 4CSWA 4RS5C 2VJXA 2RJLA 5KXEA 2D6KA 2YYOA 1SACA 2WYSA 1YNAA 5A7WB 4J25A 1LECA 2XVLA 4BDVB 2JENA 4IEZA 1QEXA 3GZTB 5A3LA 3CF6E 1M06G 2P3JA 5FZDA 3DYPA 4QPGC 3GDBA 3V0AA 1IKPA 1CAXB 3IDEA 3O1VA 1RUOA 3SH4A 1C5IA 2W68A 2VZ1A 2GNDA 4P14A 3T09A 4HSLA 4O61A 5DPNA 2YBPA 1MEC2 5FJHA 3UGFA 3WDUA 5HCHA 1LB2A 1H6YA 1NOVA 2VCCA 5FPZA 4URAA 2WA3A 3EQEA 4N53A 4WZCA 3ZYJB 3O5SA 3I59B 4MO3M 2DVGA 2QBXA 3IPVA 1W6MB 1KS5A 2QVSB 1W05A 3H7JA 2VQAA 5BV6A 1O3SA 4UFMA 5APAA 4NHLA 1LHOA 4AK3A 4IEXA 1Y43B 3GJAA 1QDCA 2RS32 5F2SA 1JS9A 1Z78A 4C0HA 2WABA 2BVBA 4LITA 4CDUA 3WOGA 2JE7A 4QX5A 3W20A 1ODNA 3AP4A 3SH5A 4QKNA 3ZDSA 3GHMA 3ZIXA 3K3OA 1VALA 4LTAA 3RJ2X 3HT1A 2V5DA 2ID4A 2A6XA 2C26A 1O91A 4LKFA 4PLOA 3WQ7A 1QJX2 1RXGA 5C4WC 1BMV2 5CEHA 4Q1RA 3OY8B 3ZM8A 5L36A 5SV5A 1RUH2 3K51A 3U75A 1T6BX 2GH2A 1Q8VA 1DIWA 2D6MA 4JKLA 5LZ6A 2VMEA 2W87A 4CE8A 1UW8A 1W8WA 4BXSV 4RN5A 2JG9B 1QNWA 3I54A 5CU1A 3JD72 2ORZA 3NV1A 4XXAA 2HBTA 2CAUA 1RUJ2 4IL7A 3CDZB 2R0FA 3TRSB 5H9SA 5FLJA 1SEFA 4DQAA 3USSA 1P8JA 4EWAA 3B5LB 5ISLA 3OUHA 1YC61 3QH6A 4KWKA 4Z82A 3VZJA 3OEAA 4DS0A 1SLLA 1PO13 1QQP1 1R081 2OQ6A 2A6YA 4Z2WA 1AZDA 5E88A 1JU3A 4W50A 1LGBA 2BRTA 2ZGPA 3M70A 1V70A 2I07B 4YVSA 5LK7B 3BTZA 2Y60A 1S1AA 2JEMA 4YG6A 3WNNA 1R083 3TAYA 5K9YA 5DUVA 4LBOA 4MX3A 5LA1A 2QNKA 2LRPA 3KT4A 2ZEZA 3N7KA 4Q4X1 4Q0UA 2QTWB 1BQPA 3RGBA 2OIIA 3POBA 5LBCA 4CP9B 1LRHA 4YFZA 2GC0A 2HWD1 1F15A 3ZN6B 4GD4A 4BMEA 1A8MA 3POEA 2VNVA 1IS5A 1GOGA 4YW3A 2CGPA 1WGPA 1XSQA 1VMJA 5C9AA 5DN2A 2DUQA 1UU6A 4KL1A 3PNAA 3DECA 2W9XA 3PUQA 5A3MA 5CAZA 3ZKYA 2VBPA 5ANQA 3H1MA 4U36A 4YYOA 1PM7A 1TE1B 3H1YA 4COUA 2RJ2A 3GJBA 4XAEA 1EP0A 3OY8A 1BEV2 3H8UA 4Q0QA 2ZACA 2C6SA 4LT5A 2ZEWA 3NAPC 1FMD2 2J1UA 2V72A 4AL9A 3ACLA 4B4RA 2DURA 4NHXA 3JD71 5C8CB 2WN3A 1ZZCA 1PX3A 2HJIA 3I2JA 3WG4A 2A75A 1NLRA 1US3A 2WO7A 1RUE1 1XE8A 4H2AA 1V6KA 4LBQB 2XJTA 1AR81 2B4KA 1GBGA 5C4WB 5FXXA 1R082 2XUMA 1DGRA 3OG2A 4BPZA 4CDXC 4J1XA 4AYUA 5JMOA 1WLCA 2PHRA 1D4VB 1J3QA 3APBA 1UXXX 5KHHA 2ZEXA 3VKLA 2VH9A 3O1PA 2R32A 2WDBA 3NJVA 3R05A 4UBGA 4CCJA 1CGPA 1EAH3 4JGZB 3EHKA 3J26N 5FZAA 3VZLA 2YBSA 4Q4X2 3WDWA 2O1QA 1JZ5A 2Q8DA 2P5BA 3OGJA 3VHRA 1OQDA 4HN0A 2ZGRA 4Q5OA 5C8CC 4C90A 1YQ6A 3I3QA 1S2KA 4UFIA 2W95A 4P08A 2BWAA 2VXRA 2IWGB 3LDBA 4UT5A 4AI3A 1R092 1YLLA 3N9OA 1RUG3 1T6GC 5FYSA 2JDPA 4YZ1A 3BN6A 3GZAA 4E27A 3TB0A 1BEV3 2WFF1 1LEMA 3KV9A 2FDIA 5F5CA 2DU0A 3WW4A 4AW7A 5C8CA 3VDCA 5F2WA 5DDJ2 5LWBA 4P9LA 1VBC2 3PIGA 1WMDA 2MNGA 5EJ3A 1HRI2 2E33A 3POWA 3VD7A 1O3TA 4X8PA 2ZJCA 2PAMA 5JPMB 4IEWA 3E5XA 1JZ3A 1KQRA 2EIEA 3I2GA 1H6XA 5E8AA 4I02A 1FX5A 3WCSA 2BEOA 2C5DA 1F8VA 2K2SA 2FD8A 4LO5B 1RUE2 1C3HA 2XHNA 1L7QA 4QQHA 1OHFA 4Y1XA 5GZCA 4UF0A 1AR71 1K45A 3PUSA 1IKQA 3GALA 2YFUA 1AR82 1RXFA 2ZGKA 1SFPA 1S2EA 1S0EA 2OQ7A 2P37A 2PAKA 4N9IA 4P9XA 4LORA 4MOAA 1U5IA 3WQ0A 5K7PA 4MLOA 3GXUA 2XQRA 4DPNA 3ZSJA 4WZFA 5C3PA 1FXZA 1H30A 2AC1A 1L7RA 3BIEA 3J4UH 3ACHA 3R6SA 3CJIC 5I0RA 3B69A 2IC1A 4GH4C 2VQUA 3DPRB 1WLTA 5IVBA 1EAH2 3ST7A 5FXVA 3OGVA 4AHYA 2Y0IA 1D4M3 4DY3A 3TEZA 3LGRA 1SLAA 1RUE3 1ZA7A 3Q8EA 4I30A 4FAHA 1E5HA 4QPIA 3S30A 4CU7A 3V64A 2ZMKA 1AL0G 3AJZA 1DQ4A 4PJYA 5F9TA 3KT1A 3NQHA 2WFF2 2XH6A 4BIFA 1ZZ8A 5DDJ1 5FZCA 5T52A 3QH7A 4HVQA 1PIV1 1HRI1 3AJYA 2WA4A 2BOIA 3NRUA 1CQ9A 3LF7A 4Q8KA 4JHZA 5CBLA 4COZA 3VLBB 4KU8A 4GB31 4QKBA 1W28A 4ZZ8A 1AL21 2Z5WA 3E6CC 2G4IA 3MIFA 1DFQA 3GGLA 1CONA 2RS33 4LA3A 4WVWA 4AEDB 4EN9B 2D6PA 2VC9A 3A0NA 4HK9A 2HWF2 1RMU3 1G86A 3KHBA 1AR72 1SFYA 4AOCA 3VGIA 4CTEA 1YFWA 2UURA 2ZZJA 2EXKA 5A80A 3OPTA 3O1MA 4YM2A 1DBNA 2E26A 2WNVB 1BBT3 1DYOA 1VBB3 1LGCA 2D3SA 3I2KA 4JKMA 1IGOA 3JZVA 5JZGA 2K0GA 1CN1A 5FPAA 4Q27A 4ARYA 3N7LA 4YW2A 5FWJA 2W08A 1RUD1 5JOXA 4QDSA 2WNEA 2AENA 2UY8A 5FZOB 4CDWA 2CNAA 4PHZA 5EJ1B 3N7JA 5DAPA 1XE7A 2GP5A 3THTA 3WNXA 2EXIA 4MVTA 4YM0A 3POGA 4FOYA 5DUUA 3OBZA 2E32A 4WM8C 4LK6A 3HQRA 1JZ6A 1DQ0A 1U5ZA 2ERFA 3LEKA 4IE4A 3VBUC 1PGW2 3IIIA 4Z8BA 3M3QA 5FY5A 4NPRA 1YUDA 3DKQA 3JBG3 3KQ4B 4QHBA 4RFRB 3D5OA 4S2HA 3U37A 3RZGA 5HV0A 1CWPA 1W6NA 2W5FA 1O8PA 1OVPA 1VBC3 3M3OA 2Q8CA 3IZOA 5KXBA 5FZHA 1W0OA 4K21A 1LOAA 4META 4YW7A 3RVHA 3ZVXA 3AKQA 2HEVF 1ZBE2 4E2GA 4WM8B 4GB32 1H2MA 4JCKA 4PLMA 2Y6FA 3LB9A 1W0PA 1EPZA 2EIBA 2ARXA 1DG6A 4QU1A 4HN1A 4Y1ZA 3SH3A 3GNEA 4CUGA 1G7YA 1N1VA 3DYOA 3UJQA 1VIWB 4OYUA 4GULA 1HJGA 1C28A 3HR9A 2PLV3 5FYUA 1R64A 4BMBA 4CCDA 4FFGA 1WW6A 4E8CA 1LESA 2X05A 4UFHA 1UY4A 1ZA4A 3E5UA 1W2TA 3OF1A 4CXWA 3VBFA 1D0HA 4LK7A 2BERA 3IDCB 1ALYA 4AEMA 2VMGA 3HQUA 3GM8A 1ODMA 2YUEA 2PELA 3ILNA 4P9YA 3ZIWA 1GSLA 3M3IA 2XR4A 3DEMA 2UYAA 4FPHA 3PJYA 3WV6A 4H7LA 4J1WA 5C3SA 3H8RA 4XOGA 3LSEA 1Q5OA 4AVVA 1KITA 4IGPA 1QH7A 4D8MA 3SQOA 4EQVA 4B4QA 2XUEA 4BK4A 1VBB1 1JZ2A 2N7GA 2IXHA 3AMQA 3E5QA 4IV1C 5GLUA 3WVJA 1AX0A 4XQ4A 4I2OA 2PLV2 1MZEA 1PGW1 1RIRA 1V9U3 3GF6A 5BNNC 2X5IC 4O9EA 4XC9A 5AFEA 1N1SA 4LEJA 5JSPA 4QAWA 1N3QA 3VZNA 1V6JA 1C8NA 3IIAA 4NHYA 4OMCA 1ND2B 2Y26A 3KF3A 1DLCA 2V5YA 4E4HA 3MI8A 1FI2A 3SCHA 5IVEA 2RJKA 2B9UA 3NNLA 1ZBE1 2Q5TA 4WM7B 1CZVA 1MVQA 4FPLA 4QX8A 5FKCA 1I6XA 1XYPA 1ZBE3 1OOPA 3V56A 5F3CA 1LGNA 4FT8A 3MIDA 4YGDA 1UY3A 2LS6A 1GYKA 3KVBA 2PQQA 1KDKA 2R073 3ECQA 3Q8FA 2GU9A 1VMFA 2LW8A 1PHMA 2PXJA 2E7TA 4PQ9A 5DDJ3 5EYXA 5I91A 3OUJA 5A7NA 1ZBA3 3B9IA 4CXYA 1BK1A 4AHZA 3O0VA 1V6IA 2ARBA 3RZHA 1OFNA 2HKXA 2FZ1A 2XWBB 2XVGA 3QBQA 4L99A 4UW6A 2DVFA 2C24A 1UOBA 1VBD2 3MLLA 5LW9A 1FAYA 2W1QA 4Q29A 4Y5SA 2RHPA 1J84A 1NXMA 2BOJA 3D3AA 4FI9A 4YVSC 1WMXA 5FMOS 3WINE 3C7OA 2C9AA 5JZGB 4NRMA 3L2HA 1GZWB 4AI8A 3K77A 2UWAA 4XILA 1WD3A 1A6CA 3ES1A 2DWRA 1H8VA 2GH8A 3FC0A 1ENRA 4GA9A 4OFGA 3WNMA 4XABA 3ZR5A 1G6NA 2PAEA 2Q1MA 1STMA 2V4AA 3I2DA 4CCNA 1LOFC 2JD4A 1T2XA 3GHNA 2CWSA 4NIGA 2PLV1 4AQTA 2Y38A 2ARAA 4DY5A 4LOSA 3HMYA 1ZYBA 1DQ5A 4OMDA 3UKNA 1MS4A 2VZRA 1ZX5A 1TEIA 2C4XA 3N35A 1RUH3 1ULCA 2BQPA 2XJRA 3ASIA 1UKGA 4BXFA 4IE0A 1ULFA 5CFCA 4JDMA 4XZPA 4Z07A 1Y9GA 2VCBA 2WWJA 5D8AB 5BPXA 2R0HA 1LAJA 2QQOA 4R9DA 2VCAA 5CG9A 5ACA1 4AQSA 1GKBA 2EAKA 2YPDA 1QH6A 1FPN1 1NYWA 4ZU4A 5CKQA 3MEPA 4KNCA 2W91A 4K6BA 2BGOA 2WO3A 1J83A 2EVXA 4Q0VA 1RUI3 5FP9A 3SC7X 4NRPA 4EE2A 2ZZQA 3O12A 1W6QB 4XVHA 2AEZA 1Y9QA 2VGDA 3RZLA 2JDHA 4L9BA 1REFA 1PGL1 5FYYA 4GWMA 2NMNA 3CNAA 4L97A 4IETA 3ZYRA 1HXS3 2PQSA 1RVF2 4XQWA 5EPAA 4I01A 4Y1VA 4H7MA 5IATA 3I2FA 4QU2A 5C33A 1ASJ1 4Q0SA 5DG2A 2PHLA 5A6YA 2E7AA 4E2QA 4ZPIA 1MPXA 4PQQA 4MHUA 4LNVA 5JIAA 3HIFA 2A5ZA 3VHPA 2R49A 1Q56A 2WWUA 4XPVA 3OGGA 1NQDA 3A21A 2OS2A 2WNVC 3H42B 4QPGB 1RUF2 5E16A 2WT2A 3ZSKA 4AI0A 1OPOA 4P02B 4CP9A 5FZ9A 3AM2A 3T08A 1FMD3 4FFIA 4OUEA 2DBNA 4DRRA 1RUC2 5A3PA 1UXZA 4ET7A 1H8TA 5GALA 4ASKA 2XLFA 4RHV1 5JXGA 2Y34A 3C7FA 2X10A 2FMYA 5AVPA 1YCIA 3VD4A 3M3CA 4UFKA 4IXLA 5F8PA 4HVOA 3BTAA 3S7EA 1IS3A 1W6OA 4I0WB 4Y1YA 4E4SA 3QLQA 1FPN2 1DF0A 1NCQB 2YPJA 2ZBJA 4NWWA 4BJ0A 4I0BA 4MZUA 4JX0A 5FZ1A 3LIGA 1EV13 1OI6A 4LO6B 4P5YA 4AI9A 5BY5A 1O3RA 2EXJA 1PO23 3JQWA 1FV2A 4Q26A 1CX1A 2W92A 5JI7A 3WLUA 1WCDJ 2W2IA 3Q9OA 1PGL2 4IE7A 3O1SA 5HXVA 3JXSA 3FFZA 4Y26A 1GZCA 1MS1A 1XC6A 2C1FA 2Y6HA 3B02A 2OX0A 5FCCA 3G6JB 1XJAA 2NZ9A 1O4ZA 1ULEA 4RD7A 3ZXDA 4ZU7A 1HQWA 2R6QA 4D7SA 3WF1A 2DYCA 2HLEA 3HVDA 4XMIA 3DV8A 1Y7BA 3ZXEA 3ZXKA 4CZSA 4OI0A 1ASJ3 5FP8A 1YYNA 2VOWA 2XDVA 4JGZC 1COV3 1UN1A 2Q30A 3I49A 4QD2A 1QXPA 1IZ3A 4TLGA 1BLZA 1G9DA 5B2GB 3T0AA 3TEXA 1CAVA 1XNCA 2R1DA 4XDPA 5FYCA 2EAAA 1S0IA 3A22A 4IW3A 5A3UA 1DGWA 2DCKA 2XOMA 1W9SA 2RS31 2XXZA 3FE5A 3RS6A 3IMNA 1W99A 3R4SA 1NT0A 1NX9A 3HD8B 4AAXA 2W46A 2YGLA 3OYWA 1VBA2 3BYWA 4MYEA 2JDNA 4H14A 5A7SA 1RUG1 3RPQA 1NLSA 3WDYA 4ES9A 5KHIA 5K4LA 1W8OA 4DMIA 3U1XA 1QWRA 2XKOA 3KM5A 1RUH1 4GWJA 1K5JA 3MO4A 4HPKB 4ATFA 4CPBA 1J3PA 1GV9A 2R042 2E51A 1RUC3 2DCZA 4K8FA 5CVRA 3B00A 3W58A 3E1F1
chains in the Genus database with same CATH topology
1PZ8A 2ZOEB 2CYFA 4CDXA 1HQLA 4C91A 1B35A 2ZPXA 1R093 3KSCA 4K7JA 5FFOC 2R063 1MZ6A 4YARA 3VZOA 5KHJA 3NWKA 3PLQA 1H8TB 4LULA 1XQNA 3MF6A 4PDWA 4IEYA 1WLWA 1OD5A 1V00A 4QPGA 2QDRA 3B3QE 4PBOA 4G3YC 1I3HA 1K5MB 2ZS6B 2V73A 2XKPA 4YGEA 1VRH1 1CD3G 3RQ0A 4PDWC 2YROA 2ZX3A 2HWD2 3ES4A 1QOOA 4N53C 4DINB 3RRDA 3VN4A 3VKMA 1OLQA 3JBG1 1JBCA 2A71A 5DZGA 2HWD3 1C8M1 4CDUC 1QJY2 2Q1ZB 3SISA 1GANA 2ZHKA 3D4KA 1BEV1 4Q4W2 1VBE2 1FMD1 3RYPA 2GN7A 2HWC1 2YY1A 3AMNA 3UJOA 2WKKA 3CEWA 4FTEA 4ZXKA 2JICA 3OPZA 3B93A 2YC0A 1IPJA 4N53B 3VBFC 3RI8A 4A7ZA 1QXRA 3LOBA 2WNUA 1I5ZA 4YZ4A 3U4XA 4O9GA 5LRRA 4ZKTB 1D0GA 5T5JA 1MEC3 4RFT0 4XBNA 4QXKA 4COVA 1Z7S3 3I7DA 4WVZA 1OA4A 3N3HA 4XBQA 1FPN3 1QKQA 3CJXA 2UU8A 4FSJA 1AVBA 2QJVA 3AP6A 1VRH2 2F6BA 5AVAA 4ATEA 2JX9A 2HWF3 1W6OB 4XE9A 3ZYGA 1QNYA 5EXOA 4XJUA 3GBWA 4ISQA 2W52A 3VBOB 2H0VA 1GNZA 1VAKA 3R4DB 3MYXA 3K48A 2DCJA 5CIRA 4WBBA 4L8QA 4RL7A 2Q8OA 4YW1A 1HRI3 5FO9B 2WFPA 1LU2A 1VBC1 2WSUA 3CU7A 4BIOA 2A73B 3U10A 3TBDA 1SMVA 1YIFA 2ETEA 4Q4W1 4ES8A 4XF0A 1YJLA 3SXWA 3AB0A 5DZFA 2HWC2 1WCSA 2VNOA 1PVC3 1NA1B 2XJPA 5GLWA 5K0UC 3MW2A 3PTYA 1GNHA 1AF9A 2PYTA 3WW3A 2Y0OA 1F9KA 3IKWA 1JN2P 4HANA 3AP7A 1YRZA 4COWA 3A4UA 3MIHA 3AKTA 4AF9A 4MGKE 4B8EA 3LA3A 1NCRB 1DQ6A 1B35C 1CAUB 2DUOA 4MXWA 1SLCA 2C0ZA 1YHFA 5FBZA 1LU1A 2H0BA 2VVEA 3AZZA 3VBHC 4CYDA 1LCLA 1N1YA 3MW4A 4W6WA 5EWSA 1OA3A 3NVCA 1MQTB 1WW7A 2NN8A 3WUCA 3D0JA 2JG9A 4L92A 3ZFFC 5F6LB 3OYWB 1NQJA 1LHUA 1JYCA 5JIUA 1G8WA 3ZPYA 3D82A 3WP4A 2PHWA 3AFKA 1YWKA 2YHJA 3E6DA 5IUQA 2FZ2A 2BPA2 4W6YA 3FLRA 5KBFA 4OLLA 1PIV2 3PVOA 4UW4A 5GLTA 4D7TA 3RDIA 1S55A 3USUB 5T55A 5F6KA 5C9AC 4LBNA 1AYN3 2GDFA 4AQ6A 1AL22 1GLHA 1YJKA 5KC5A 4JGYA 2WINB 1Z7S2 3VHNA 1LR5A 4FPEA 4OI2A 3LOIA 3FHIB 2EALA 1AYN2 1YO8A 2B7YA 2ENRA 4BYYA 4BM8A 4QQOA 2JE9A 4M0HA 3POSA 2DF7A 1OSGA 1CJPA 1ZZ7A 3LA7A 3MFAA 3WG1A 2AGSA 3DGTA 4LO7A 1RUD2 2GC2A 1SCSA 1L3JA 2B46X 1X7NA 5T3NA 4NN0A 1FOD1 3DL3A 1U0AA 4GH4B 4OHYA 3L2YA 1IS6A 4W6XA 5FLIA 1YFXA 3JD73 3MIEA 1GFF2 4KH9A 5JR7B 1ND2A 3CJIA 4CRQA 2YXSA 1H1IA 3WY6A 4CP0A 3PJQA 4LUMA 1QJU3 4N90A 4YW5A 5HCAA 4Q1PA 1UMZA 1LHWA 1B35B 2AREA 3O7OA 5JSRA 2OUJA 2RS11 3FBMA 5FDBA 4GQ7A 4YM1A 4AEDA 1O5LA 4HMZA 3NL1A 1VJ2A 2VW0A 3AXDA 5KC6A 2ZKNA 1Z7S1 3CO2A 5BNPC 4LUKA 4NOTA 2G9FA 1AXZA 4B4PA 2XL7A 2HEWF 1HXS1 2DVAA 3WW2A 5J98B 1MQTA 1O7FA 4GMP1 1IOAA 2ZGTA 4A3XA 3QACA 5AC92 2B42B 2RMU1 4Q4Y1 4SLIA 3JB4C 4HFSA 4XETA 2KXLA 4G9SB 2XLAA 4MV2A 4XJZA 1OQ1A 3WX5A 5FTTC 3ZN5A 2GNMA 2VY0A 1XXNA 2Z79A 4XF1A 1CAUA 3RMXA 1EPWA 4IEUA 1FOD2 1H2LA 2BNMA 1ZBA2 1PZ9A 2R16A 3DPRA 1ZZ9A 1J58A 2E53A 1RUJ3 5JZGC 1PIV3 2WQ4A 5CFCC 1WBFA 3WDTA 1SLTA 5KHKA 5L73A 1CAWA 3VBHA 2R30A 1U5YA 4JDOA 3ZXLA 4M3CB 4AI2A 4AVAA 1WMEA 2JKBA 1DGWX 1R1ZA 3VDDA 3BPZA 2LUWA 1DHKB 1LOCA 3ZFGC 3AZYA 1BVVA 4YVWC 4XF9A 3TNQA 1OQEA 1Q8OA 4QGNA 5FREA 4Y1UA 4DB5A 1G9CA 4GXLA 1UX6A 3VBSA 3PVEA 4HKWA 1IS4A 5IT6A 1NCQA 3SHRA 1LENA 1G9AA 2LTNA 4AGGA 2GNTA 1HIXA 4XW3A 5AC91 2E63A 4D94A 3MLJA 2ZHMA 1IHMA 3RI9A 5AFBA 2GMMA 1LOBA 1B09A 2AZ5A 1OKQA 2Z42A 2D93A 2WT1A 2WC2A 4XBLA 4XFFA 1DGRN 4OULA 4DRVA 2HEYF 1RL3A 1ZBA1 2QUOA 2WZR3 2JG8B 4HK8A 3ZYPA 4AI1A 2GALA 2X29A 2NPIA 2NLRA 2HWE1 3O0WA 2AUYA 3UL2A 2WS93 1N3OA 4OUMA 4QQ2A 2WZR1 1WW4A 5JOWA 2ZMNA 4R52A 3RG0A 3PHMA 4MH0E 2CGOA 5C4WA 3I8TA 2KM2A 1WA4A 3J8F2 5BNOB 4MXVA 3DF0A 4IV1A 1ND2C 2WLQA 2Z2SB 2JXAA 1SFNA 3ROUA 3WG2A 5A32A 1W6QA 5IK4A 1X36A 1KD7A 2E9QA 2W0XA 1XNDA 1NCRA 4NR1A 5BNOA 4AEJA 1W6PB 1XRUA 1O3QA 3WXPA 1X8MA 4BCUA 2VG9A 4Q8LA 3QOPA 5JOYA 1CX4A 4IV3C 3D8CA 3NV4A 3AMPA 1CESA 3TNPB 5BNPA 5CFDC 3MPPG 4N7IA 2EA7A 5C9AB 1PK6B 4IESA 3B01A 1RVF1 4ORFA 3SCGA 1VB4A 3LCPA 2EXHA 1SBFA 4XF4A 4Q4V3 1ND3B 5D1IA 5FOJB 5I8TA 2PHDA 2ES3A 2V09A 2RR12 5I8YA 3MZHA 1J1TA 2D6OX 5TSWA 1J59A 2HWE2 4JTNA 1Z0HA 1RUF1 4FBFA 2YV8A 3ZXJA 2QE3A 1QDOA 4K40A 3PMEA 5FAXA 4IV3B 5GZDA 4HL0A 4NVPA 2UWBA 1V9U2 1WD4A 5GLVA 2VULA 4OI1A 1YFUA 3IM0A 4EROA 1JH5A 4RHV2 1Q8QA 2QQPA 4AGVA 3JB8A 3KMHA 1GQGA 4XYXA 1S0DA 1LJ7A 3FFQA 4QT6A 4FP3A 4XDQA 1XU1A 1DYPA 4FTSA 1S2BA 4FTBA 4OHZA 1GICA 3KGZA 3ELNA 3BCWA 4ZU5A 3MFCA 1UD1A 2P3IA 2YZ4A 4M3CF 3TOJA 4E4DX 4CDWB 5BYNA 3NKTA 2ZGSA 5EV7A 1PVC2 4Y5Z0 1NA1C 1LHNA 1UKRA 1DZRA 2IXKA 2BFUL 2OVUA 1ZRFA 1MS3A 2BNNA 2DTYA 4LBQA 3T1MA 1AJKA 4YZ5A 5FLHA 1C1FA 4KGQA 3RMYA 2QZ2A 2P2KA 1HRV1 4C0BA 2WSVA 4QM9A 2GSYA 1TNRA 5FPXA 1AX1A 2RR11 4EN8B 3I59A 1LOGA 5T5OA 4XTPA 3BALA 4KWJA 2QZ3A 3FX3A 2X5IB 1DQ1A 4X6RB 4AFBA 5BXXA 5L19A 1UZZA 4J6GA 3NV3A 3VKNA 1K5MA 1CAXA 3LKJA 4FPCA 2VPVA 3WW1A 1RUF3 2PN5A 1I1EA 3U07A 4E4ZA 2A6WA 2GZWA 1VBA1 1X50A 5FOBB 1WBLA 1RUG2 4R4XA 2PTMA 4L11A 4LO8A 1JYIA 1KFUL 4LO4B 3M4FA 1MACA 4S2FA 3VBOC 2VVDA 2R041 3M8LA 5KXCA 1S0JA 1W2UA 3ME2A 1MZ5A 5GZGA 3VBRB 4Z92B 4AFAA 1QU0A 2A3YA 2F4PA 3AFGA 2UY9A 1PNFA 4XJWA 5E1RA 4HPKA 3WHTA 1AR91 1MS8A 1PK6A 4R9BA 4RR3C 5CNAA 1RJ8A 4H55A 1AR63 4F8AA 2MEV2 4XFCA 1S0BA 5JLVA 4TYSA 4HVRA 1FT9A 3NV2A 3ZFEC 3VBRC 1W6PA 2A7AA 5I0UA 2BNOA 5GZEA 5BNNA 2OZ6A 3PVNA 3WG3A 3X29B 1AXKA 4OZXA 4AE2A 1FV3A 2WNVA 5FRAA 5GLZA 2DV9A 2WJSA 3JBG2 4RR3B 5I93A 2WL1A 1N1TA 1HV1A 1MS9A 2X8KA 4FQZA 4RQPB 2D44A 3A0KA 1XNBA 4E2SA 3OCPA 2ZCWA 3U11A 1C8M2 2TUNA 5CA6A 1QJY1 4FOQA 2O8QA 3OD0A 5EFUA 1VBE1 4XJAA 4DOUA 1HW5A 3B94A 4N43A 1R1A3 1S0FA 3GBGA 5J3UA 2ZTNA 4EN7B 2R072 4DZGA 1AR92 2BFUS 5SV8A 1DQ2A 3UKTA 2DVBA 3C2UA 1H0BA 4F3JA 4RQPC 3MIGA 2WWSA 4UW3A 3H1WA 4AFDA 4K1YA 1DGLA 4CDQB 2MEV3 3BIWE 4XQDA 1NY71 4AVTA 1J1LA 3PMSA 2FQPA 2VQ0A 3RJRA 1ZRCA 1KJRA 3ZSMA 2W39A 2ATFA 4JQRA 3THPA 2VU9A 4JRLA 3VZMA 5J96B 1M4WA 4NWVA 3VDDC 3AKRA 2P3KA 3WUDA 2RS52 3HT2A 2PFWA 1LKNA 3POYA 2D97A 1RUNA 4I0AA 5DZEA 4GIQA 1OOPB 4YZ2A 3ETQA 1RHI2 4CP1A 2IXIA 1O4TA 2R061 4WVVA 1V6OA 3WP6A 3TN92 5J37A 1S0GA 3O0XA 1YXWA 3J9SA 2GAUA 4YGCA 4KWLA 1CR7A 1BXHA 2CY6A 2YMZA 1QJY3 2FBEA 2NYYA 1PMIA 4Q0PA 3WD5A 1QQP3 3KZ4C 5GZFA 1F2NA 4QQLA 3IDBB 2E7QA 1QJZA 4D69A 1DU3D 3AYCA 4YG3A 5I0SA 3AKPA 4MGIE 4N43B 1Q43A 2ZMLA 3GZUC 4XFBA 5D8AA 1DDLA 1NY72 2MHFA 2OW4A 2VUJA 1JW6A 2JG8A 2X5IA 3MF9A 3H0OA 2HWB3 1ENQA 3G7DA 1UAIA 1AR93 3ZO0B 3AP9A 3AP5A 1DZQA 5LK5A 3AMHA 3NKGA 1UL9A 2SBAA 1R1A2 4UW5A 3ZFEA 1CAVB 1JXNA 1DZTA 1NE6A 3JCIA 5J09A 3MICA 2VOKA 3AYEA 3UK9A 1TQ5A 2ZX1A 4QGMA 2ZABA 5BNOC 2Z69A 1FYUA 1RHI1 1QHDA 3CJIB 2R062 3DKWA 3JU9A 3TN91 1QXJA 5KHGA 1W6MA 3FLPA 1BBT2 4IQPA 4LR4A 3VHOA 4KBBA 2ET1A 4INDA 3LWCA 1MS0A 2BGCA 4FPGA 3ZYIB 3OD4A 4K20A 4XHBA 2QKDA 2YGMA 5JMCA 4IEQA 4XIKA 1AYM3 3T1LA 1SLIA 3VDDB 4FPYA 4Y24A 1AYN1 2TBVA 4M3CA 3H50A 4AVCA 4F7ZA 4XFAA 2NM1A 4KQ7A 2WS91 4M0NA 4WM7A 3MDPA 4PDWB 4PIZA 2HWE3 2AH2A 3LSDA 4CEYA 1JTZX 1V6LA 2ZA9A 2DUPA 1O4YA 3LZZA 2ET7A 4EV0A 2EIGA 3WP3A 2WIIB 1POV3 2VUAA 2A70A 1COV1 3VL9A 1D4M2 3HN1A 4YVWA 1WW5A 4B29A 5EYYA 1NXD1 3M7AA 3ZFGB 2SLIA 2ZX2A 1BKZA 3ILFA 4D3WA 4PIYA 5HCFA 3GBFA 5CADA 2RS12 4CDQC 3VBFB 4P9GA 2XL9A 4JC1A 4NHMA 2UWCA 3FWEA 4NHKA 4M00A 1PO21 1ZM1A 3N7MA 2AR6A 1POV0 3V0BA 3KS7A 1HXS2 3QCWA 5C6CA 5IK7A 1RHI3 1QGLA 1NZCA 4U2AA 2D6LX 3KCCA 1QJU1 2DFCA 3ZXFA 4GKXA 4IV1B 5LEJA 1J3RA 5JPNB 2WS92 4N9HA 2RMU2 4Q4Y2 4P5HA 3T2TA 1X8EA 3H7YA 5GJ6A 1AR62 4LLFA 3RWNA 1ZZ6A 3B9CA 1LEDA 2XBO3 4FAGA 5CFCB 3SCFA 1K5MC 4L2NA 4TWTA 4C1XA 5HCBA 1JOJA 4YW4A 1QJX3 2QDNA 4QQPA 1ENSA 2BTVC 3V0AB 2JG8C 1Q8PA 1JHNA 3PVBB 4GMP3 3QD6A 4OHXA 1F5FA 5BUVA 3KT7A 4XHXA 3VBOA 3ZFFA 2RM23 2DFBA 1PO11 2A6VA 4IV3A 4BLJA 1SBDA 2EF6A 1FNYA 1KFXL 1SQ4A 1F31A 4PIXA 1PO22 4FPOB 1RMU1 2YDEA 3USUA 1OLRA 3CL1A 1MVEA 2XJQA 3LA2A 2I45A 4RS5B 4AXOA 1ND3A 3FUOA 1QJU2 1YI7A 1H1MA 1TMF1 3ZX7A 4GB33 3UKVA 4XF3A 2XJUA 2ZX0A 3KB5A 4JGZA 2BVVA 4MUVA 1JUHA 3VBHB 1CAWB 2OUHA 1HLCA 5L7OC 3VUOA 2JJ6A 1AXYA 1KS4A