3B3VA

Crystal structure of the s228a mutant of the aminopeptidase from vibrio proteolyticus
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
291
structure length
291
Chain Sequence
b'MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACADHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 113
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b3vA00
4P4EA 2PJ1A 1ARLA 1BLLE 2O53A 3SJFA 3KGQA 2FVGA 2GLFA 1DE4C 4ZX9A 5JGFA 4PPZA 2NSMA 1QQ9A 4P4DA 2F8HA 3D7HA 3NH8A 3B3WA 1VHOA 2Q43A 3D7DA 3T8WA 3RBUA 2ZEGA 4P45A 5HVGA 2PCUA 4PXBA 4OC4A 1FNOA 2RB7A 3PFEA 4OKOA 2ZOFA 3FJUA 2IJZA 4PQAA 1Y7EA 3B3VA 1LOKA 3B3CA 3H8EA 2AFOA 2XEIA 3H8FA 1JQGA 2ZEMA 3ISZA 4WJBA 1PCAA 5I4MA 2PVVA 4ZI6A 2QYVA 4ONWA 2HB6A 4UIBA 4MRIA 3VATA 2PJ7A 3WT4A 4A37A 2V8HA 4Z65A 2PIZA 4W9YA 4TWEA 3PB7X 2V8GA 1F2PA 2AFUA 3IEHA 5D8NA 4ZYQA 1NSAA 4BD9A 4MXUA 4X2TA 1TKFA 1HEEA 3IC1A 3ISXA 7CPAA 3FF3A 2OR4A 3GB0A 1Z5RA 3FVLA 4FAIA 1HDUA 3D68A 2Q4ZA 2PJCA 4P4IA 2EK8A 2RFHA 2ZEHA 6CPAA 5IB9A 2ZENA 3FEEA 3KI9A 3MRUA 1XMBA 4IHMA 4EWTA 4F8ZA 1XBUA 3D7GA 4X8IA 5LYIA 2O4HA 4RUHA 1CBXA 3B35A 3TC8A 3S9LA 5HXDA 1R43A 3CPAA 3S9NA 5LYLA 2PJ8A 3SJEA 2AFMA 1F2OA 3CDXA 4FBEA 2BOAA 3FECA 1YSJA 2ABZA 1CX8A 3H8GA 3HUVA 1TKHA 5LYFA 1YW6A 3FH4A 3B3SA 2EK9A 3B2YA 3NFZA 4OC5A 1M4LA 1LAPA 1VIXA 1ZLHA 4FUUA 2G9DA 2CIJA 3L2NA 2ZEOA 4UF4A 2PJBA 4Q7AA 3V7ZA 4UIAA 3RAMA 4B6ZA 3D7FA 3D4UA 3PBBA 3PFOA 1CPXA 4R76A 4NGMA 2POKA 3FEDA 4TNUA 4JZ0A 3BHXA 4A38A 2Q51A 3KHZA 4PXEA 3B7IA 5J1QA 5HVFA 2ANPA 1KWMA 4MCRA 3IJ3A 3TX8A 2F7VA 2PVWA 1Z8LA 2GLJA 1F57A 1PYTB 2QVPA 4MCSA 4OMEA 3QNVA 3NA6A 3MN8A 1TF9A 1TF8A 1YW4A 1RTQA 4G1PA 3IIBA 4EFDA 3DLJA 2CF4A 4NGPA 3CT9A 4UEEA 4NGSA 2C6PA 2C6GA 1YMEA 3VARA 3PB4X 2ZEFA 4R7MA 1XJOA 2AFWA 1BAVA 1ELLP 3D66A 3HLPA 4NGNA 2C6CA 2V8VA 4AXVA 1YLOA 3BI0A 3VH9A 4P4JA 2VL1A 5JM6A 3FX6A 3PB9X 1ZLIA 1HDQA 1ZG9A 4H2KA 4ZX8A 4MHPA 3KASA 5DS0A 2C1CA 2IQ6A 1OBRA 1XRYA 3IO1A 4NFRA 3D67A 2J9AA 1IY7A 2XEJA 4MHNA 1IGBA 3SI0A 2AFXA 5CPAA 2PJ9A 1ZG7A 1GYTA 3K2KA 1Z2LA 2PE3A 4KSIA 1CP7A 4ZY2A 4WWVA 1Y0RA 1H8LA 2XEFA 4PXDA 3GLJA 3IWWA 1BPNA 2XEGA 4PXCA 2ZEEA 2PJ2A 3PEIA 1LFWA 4GM5A 2CTCA 2PJ0A 4P10A 4UEFA 2BCOA 4OIDA 2AFZA 2WYRA 3IFEA 4NJRA 4UEZA 2ZEPA 4OC0A 4NJQA 4R6TA 1VHEA 1QMUA 2AFSA 1ELMP 5ELYA 3SJXA 2I3CA 5LYDA 5LRJA 4ZY0A 5K8OA 4R8FA 4DYOA 5K8MA 2V77A 3SI1A 3FMCA 4MMOA 3KHXA 3SI2A 1CG2A 3WC6A 2PJ4A 4ZY1A 5CBMA 4JYWA 4MCQA 1EE3P 4NGRA 2PIYA 1TKJA 3KZWA 1AYEA 2ZELA 1CP6A 3KL9A 2WZNA 2PJ3A 5HVHA 1Q7LA 2ZOGA 3WC5A 5LRKA 5K8NA 2BO9A 3I1UA 3WABA 4A94A 2QJ8A 1ZG8A 4YU9A 3V38A 4P4BA 1Y0YA 2PJ6A 3B3TA 1LANA 2JBKA 2V8DA 4DJLA 4IK2A 2GU2A 3KR4A 4P44A 3CPXA 2IMOA 3LWUA 2PRQA 2GREA 2JBJA 3GUXA 3NH5A 3SJGA 3PBEA 4OC2A 3RZAA 4MHZA 4LQGA 4F9VA 3N5FA 3BXMA 2NYQA 5K8PA 3WC7A 1FT7A 5THWA 4DUKA 2HC9A 3PB8X 4O23A 3DGVA 1VGYA 3JRUA 8CPAA 1DTDA 1R3NA 5F09A 4P4FA 4CPAA 5D29A 4OIWA 2PJAA 4P6YA 2CTBA 3BI1A 4NGQA 2ZEDA 1BPMA 1LAMA 4OC3A 1TXRA 4A39A 3KQXA 2JEWA 3KR5A 5JH9A 1ARMA 4IAVA 4MCPA 1XFOA 1AMPA 2DEAA 4K3NA 4OP4A 4NGTA 4X3RA 2PJ5A 4F9UA 2OOTA 3NH4A 4EMEA 4FWUA 1CPSA 3PRTA 5LRGA 1UWYA 3S9MA 4MHYA 2EWBA 4YWYA 4OC1A 3PB6X 3KQZA 3K9TA 1LCPA 3LMSA
chains in the Genus database with same CATH superfamily
4II9A 1YK3A 1NE9A 1WWZA 4P4EA 2PJ1A 1ARLA 2B5GB 1BLLE 2O53A 4BINA 4CGOA 4UBRA 4B5PA 1Z4RA 3EY5A 3GY9A 3SJFA 1X12A 3KGQA 2FVGA 4MI4A 2VXKA 2FL4A 4UFXA 2GLFA 1DE4C 4ZX9A 4JXQA 2EBJA 4KOUA 5JGFA 1KUYA 4PPZA 2NSMA 4HNWB 1QQ9A 4P4DA 1Y9KA 2F8HA 3D7HA 3NH8A 3B3WA 1TIQA 4M3SA 1VHOA 2Q43A 2VQYA 3D7DA 4OLLA 3TTHA 4AVBA 3T8WA 1P4NA 2AE6A 4J3GA 2J8NA 3F0AA 5E96A 3CXSA 4PK2A 3RBUA 4KOTA 4KORA 4FD4A 2ZEGA 1QSNA 4YRHA 2I00A 3S6HA 2D4OA 2GFQA 4AG7A 5C88A 4P45A 5HVGA 2PCUA 4PXBA 5KTAA 4KLWA 1MJAA 4OC4A 4LQ6A 1FNOA 2RB7A 3PFEA 3R1KA 4KZTA 5AG7A 4A31A 4OKOA 2ZOFA 3FJUA 2GANA 2IJZA 4PQAA 5ISVA 2Q04A 1Y7EA 1I12A 4KVOE 1WK4A 4PV6A 3B8GA 3B3VA 1LOKA 3B3CA 3H8EA 2AFOA 4C2XA 4R3LA 2XEIA 3H8FA 1X10A 1PUAA 1JQGA 2ZEMA 1RO5A 2ZPAA 2DPSA 3ISZA 4WJBA 4F0XA 1Z9UA 4RN7A 1PCAA 5I4MA 4Y49C 4JJXA 2PVVA 3VWEA 2FIAA 2QYVA 4ZI6A 4QVTA 4ONWA 4C7IA 2HB6A 4UIBA 4NCZA 3IWGA 1QSTA 2FSRA 1SQHA 4KOSA 1IIDA 4MRIA 2CNTA 3EFAA 3SXNA 2OB0A 2PJ7A 1IB1E 2YGWA 3EXNA 3VATA 3W6SA 2DF5A 5H86A 4XPLA 5EMIA 4C68A 4FD5A 2FT0A 1CM0A 3RYOA 3WT4A 4A37A 2V8HA 4Z65A 1IICA 2PIZA 2R8VA 2WUUA 4W9YA 5IX3A 4TWEA 3PB7X 1J4JA 4HPSA 1Y9WA 2V8GA 3ZZIA 2K5TA 1UFHA 3R9FA 1B6BA 1F2PA 2AFUA 3IEHA 5D8NA 3T9YA 1NSAA 4KSFA 4ZYQA 3F8KA 4HKFA 4BD9A 1XE4A 4IF5A 4ORFA 3TFYA 5IB0A 4MXUA 4X2TA 5G21A 1TKFA 4B11A 1HEEA 3IC1A 3ISXA 7CPAA 3FF3A 1P0HA 2OR4A 4C2ZA 2PSWA 3GB0A 2Z3PA 3PP9A 5AG6A 5A28A 1Z5RA 2FXFA 3S6GA 4CAFA 3FIXA 3FVLA 4H89A 2OU2A 4FAIA 2ZW4A 5C82A 1HDUA 3D68A 2Q4ZA 2Z3MA 4CAWA 1YX0A 2PJCA 4P4IA 2EK8A 2RFHA 2YNEA 2Q4VA 2ZEHA 6CPAA 5IB9A 2ZENA 2JDCA 3FEEA 3PZJA 4XPDC 1S5KA 3KI9A 4B12A 4L89A 4AVCA 4EVYA 1M1DA 2B4DA 3MRUA 4DNCA 4HNXB 4CS0B 1XMBA 2WPWA 4IHMA 3I9SA 4C2YA 4EWTA 4CRZB 3R96A 4F8ZA 1S7LA 1XBUA 3D7GA 4X8IA 1PU9A 3EO4A 2P6EA 2Z0ZA 5G22A 5LYIA 3DSBA 2QMLA 2O4HA 4CGMA 1GHEA 4A32A 4RUHA 3E0KA 2Z10A 1CBXA 3B35A 5KTDA 3TC8A 3S9LA 3T90A 2ZXVA 1R43A 5HXDA 3CPAA 2KCWA 3CZXA 3H4QA 3S9NA 1LRZA 4I49A 5LYLA 2PJ8A 4MFLA 3SJEA 2AFMA 5AG5A 1F2OA 2JLMA 3JUWA 3ZJ0A 4L8AA 3CDXA 4FBEA 2BOAA 3FECA 4B5PB 1YSJA 2ABZA 1CX8A 1M44A 3H8GA 1Z8WA 3HUVA 2J8RA 2QECA 1TKHA 3I3GA 3W91A 2FIWA 3UY5A 2FCKA 2C27A 1KUXA 3CXPA 1L0CA 2IL4A 4CGLA 3D3SA 5LYFA 1YW6A 3FH4A 3G3SA 3K9UA 1IYKA 3B3SA 3LODA 4YGOA 4MFKA 2EK9A 4B10A 3B2YA 3NFZA 4OC5A 3IU1A 1IOFA 1M4LA 1LAPA 1VIXA 1ZLHA 4FUUA 1N71A 1Q2YA 2B5GA 2G9DA 2CIJA 2YNCA 2ZEOA 3L2NA 4UF4A 2PJBA 4R3KA 3S6KA 4Q7AA 3V7ZA 4UIAA 4Y49B 1MJ9A 3RAMA 4B6ZA 2WSAA 5J8FA 4UA3A 3D7FA 3D4UA 3PBBA 3PFOA 1QSOA 4KVME 1BOBA 4JLYA 1CPXA 4R76A 1Z8XA 4NGMA 1V0CA 3DDDA 4NSQA 2POKA 4MFPA 1M4DA 3FEDA 4TNUA 4JZ0A 3H5ZA 3BHXA 3IGRA 4A38A 2OZHA 5JPHA 2R7HA 2Q51A 3FB3A 2YNCC 3KHZA 2G0BA 4AVAA 2Z3KA 5IV0A 4PXEA 2RC4A 2Z3NA 3B7IA 4BMHA 2FE7A 5J1QA 1IOIA 2HUZA 3JVNA 3TOAA 5HVFA 2ANPA 1KWMA 2GIVA 4MCRA 2ARHA 3IJ3A 1QSRA 1B87A 3TX8A 2F7VA 2PVWA 4F0YA 1Z8LA 2GLJA 1F57A 1PYTB 2QVPA 1Z8TA 4MCSA 4OMEA 4UWJA 3QNVA 2B3UA 1M4GA 3NA6A 4ZGYB 3MN8A 1TF9A 4RI1A 4M6HA 1TF8A 5AG4A 2CNSA 1YW4A 1RTQA 1I1DA 4G1PA 4YFJA 1YVOA 3IIBA 2VZYA 2PDOA 4EFDA 3BLNA 3DLJA 2CF4A 4B13A 2H5MA 2GE3A 3C26A 2OH1A 4NGPA 2F5IA 3CT9A 5J8CA 2PR1A 1YLEA 4UEEA 4NGSA 4CYPA 3SXOA 4Q38A 2C6PA 4Q36A 4XNHB 2C6GA 1YMEA 3VARA 2B58A 5CNPA 3WR7A 3PB4X 1KUVA 2ZEFA 4R7MA 1XJOA 2AFWA 5GCNA 1BAVA 1ELLP 1ZO0A 1YR0A 4XPDB 3V8IA 4UFWA 3D66A 3HLPA 4NGNA 2C6CA 4E8OA 2V8VA 4AXVA 2DPTA 2DXQA 1YLOA 4JXRA 4A30A 4B5OA 3BI0A 3VH9A 2R98A 4P4JA 5FVJA 4E2AA 2VL1A 2BL1A 2P0WA 3D8PA 5JM6A 5F48A 4CYQA 2JDDA 3FX6A 3NE8A 4K30A 3PB9X 4BBHA 4QB9A 5A27A 2VEZA 1ZLIA 1NMTA 1HDQA 2CY2A 1ZG9A 4XNHC 4H2KA 3W6XA 4UWIA 4ZX8A 2Q7SA 1IU8A 3KASA 4MHPA 5DS0A 2C1CA 2IQ6A 2PR8A 1OBRA 1XRYA 2B4DB 1Q2DA 2CNMA 3IO1A 4NFRA 3D67A 4MY0A 2D4PA 3R9GA 2J9AA 1IY7A 1QSMA 2I79A 2XEJA 4U9ZA 4A2ZA 4CGNA 4MHNA 1IGBA 1MK4A 4A33A 1M4IA 2Q0YA 3SI0A 2AFXA 2Z11A 4CYOA 2REEA 1XF8A 2ODFA 2PJ9A 5CPAA 2PC1A 3R9EA 3CXQA 5KTCA 1ZG7A 2ZW6A 1GYTA 3K2KA 1Z2LA 2PE3A 2OZGA 4HNYB 4JWPA 1CP7A 4KSIA 3GKRA 4PSXA 4ZY2A 1Y7RA 4U9YA 4WWVA 1Y0RA 1H8LA 5BWAB 1R57A 2XEFA 1XEBA 4MFJA 2G3TA 4PXDA 2EO8A 3GLJA 5JQ4A 4KUBA 3TCVA 2VBQA 3IWWA 1BPNA 5F49A 2XEGA 4PXCA 2FS5A 2PJ2A 2ZEEA 3G8WA 3OWCA 3PEIA 3SHPA 1LFWA 4GM5A 2CTCA 2PJ0A 4P10A 4UEFA 2BCOA 3FRMA 4OIDA 5HMNA 4KVXA 2NMTA 2AFZA 4M6IA 5DWMA 4CAXA 4KUAA 3DR8A 3N7ZA 2WYRA 3IFEA 2P6GA 4NJRA 4UEZA 1FY7A 2ZEPA 4OC0A 4NJQA 4R6TA 3F5BA 1VHEA 5I0CA 1K4JA 3PGPA 1QMUA 4ONUA 2AFSA 4KOVA 2PQ8A 1ELMP 5ELYA 4OADA 3SJXA 3FNCA 2I3CA 5LYDA 5LRJA 3VWDA 4CRYB 2ZW5A 4ZY0A 4FD6A 5K8OA 3S6FA 4R8FA 1YREA 4DYOA 4NF1A 3FXTA 3TOBA 5K8MA 5G1ZA 3NE7A 3TO6A 2V77A 2CXAA 1BO4A 4ZBGA 3SI1A 3FMCA 2WPXA 4MMOA 4UCNA 3KHXA 1YQEA 2R1IA 3SI2A 4KOXA 4R87A 1CG2A 3LACA 4LUAA 4A95A 3WC6A 3QAYA 4UCMA 1S7NA 1VKCA 1ON0A 2B4BA 4F6AA 2PJ4A 4ZY1A 3TO7A 5CBMA 4JYWA 4MCQA 1EE3P 1S7FA 2PIYA 4NGRA 4B14A 1TKJA 2VI7A 3MGDA 3KZWA 1AYEA 2ZELA 3RO0A 1IYLA 1CP6A 3KL9A 2PJ3A 2WZNA 4H6UA 4R9MA 5HVHA 1Q7LA 4MY3A 1A2ZA 2ZOGA 2A4NA 3KKWA 3WC5A 5LRKA 3QB8A 5DWNA 4M6GA 5K8NA 2O28A 5F47A 4CYNA 2BO9A 3I1UA 3WABA 5G20A 4A94A 4AG9A 2QJ8A 3BJ8A 1ZG8A 5AGEA 4YU9A 3V38A 3FBUA 4P4BA 3TT2A 1Y0YA 2PJ6A 1YVKA 3BJ7A 2Q44A 3B3TA 2YNDA 1LANA 1S3ZA 2Q4YA 2JBKA 4UFVA 2V8DA 1Z4EA 4IK2A 4JD6A 2GU2A 3KR4A 1NSLA 4DJLA 4P44A 4IUSA 1AUGA 3CPXA 5H84A 1VHSA 2IMOA 3LWUA 2PRQA 2EVNA 2GREA 1MJBA 2JBJA 3GUXA 4KOWA 2Z3OA 4XPKA 4KOYA 1KZFA 3DR6A 3GYAA 3NH5A 3SJGA 1XOVA 3PBEA 4OC2A 3RZAA 4MHZA 4LQGA 2HV2A 2ZW7A 3BXMA 2Z3LA 3LD2A 3N5FA 4F9VA 2P6FA 2REFA 2NYQA 2X7BA 5K8PA 3WC7A 1FT7A 3QAHA 5THWA 4DUKA 4UCPA 4H6ZA 1RXTA 5EC4A 3IWEA 5EBVA 2HC9A 1OZPA 4PK3A 5F46A 3A9LA 3P2HA 3PB8X 3DGVA 4KSAA 4O23A 1VGYA 4MJ8A 3IU2A 2B3VA 3JRUA 3RNZA 8CPAA 2BEIA 1DTDA 1R3NA 5F09A 4NXYA 4P4FA 4CPAA 2VZZA 5D29A 4OIWA 2PJAA 4P6YA 2CTBA 3TO9A 4NEXA 3BI1A 3D2PA 3P2FA 4NGQA 2ZEDA 3TE4A 1BPMA 2BSWA 3D2MA 1LAMA 4FD7A 4GXHA 4OC3A 1TXRA 4A39A 1U6MA 3KQXA 4QC6A 3GIUA 2ATRA 4QUSA 2HQYA 4KS9A 4M85A 2JEWA 3KR5A 5JH9A 1ARMA 4C7HA 4IAVA 5HH1A 4CAVA 4MCPA 3FYNA 1XFOA 4E0AA 1AMPA 1XMTA 4OAEA 2DEAA 4K3NA 3DNSA 4RS2A 3EC4A 4OP4A 4NGTA 4R57A 4QBJA 4LX9A 2PJ5A 4X3RA 4F9UA 2OOTA 2JEVA 4GS4A 2Q7BA 4CAEA 3NH4A 4MFQA 4U5YA 2EUIA 4EMEA 4FWUA 1CPSA 3JTKA 2J8MA 1I21A 3PRTA 4PSWA 2BUEA 4MBUA 5LRGA 2AJ6A 4MHDA 2Y0MA 1UWYA 2PRBA 1S7KA 3S9MA 4MHYA 2EWBA 4YWYA 4OC1A 2QIRA 4CGPA 1S60A 1XIXA 1Q2CA 3R95A 4AB7A 1JWQA 3PB6X 2G3AA 2OZUA 1CJWA 1YGHA 3K9TA 1LCPA 3KQZA 3LMSA 4X5KA 4MFZA 4KLVA
chains in the Genus database with same CATH topology
4P4EA 2PJ1A 1ARLA 1BLLE 2O53A 3SJFA 3KGQA 2FVGA 2GLFA 1DE4C 4ZX9A 5JGFA 4PPZA 2NSMA 1QQ9A 4P4DA 2F8HA 3D7HA 3NH8A 3B3WA 1VHOA 2Q43A 3D7DA 3T8WA 3RBUA 2ZEGA 4P45A 5HVGA 2PCUA 4PXBA 4OC4A 1FNOA 2RB7A 3PFEA 4OKOA 2ZOFA 3FJUA 2IJZA 4PQAA 1Y7EA 3B3VA 1LOKA 3B3CA 3H8EA 2AFOA 2XEIA 3H8FA 1JQGA 2ZEMA 3ISZA 4WJBA 1PCAA 5I4MA 2PVVA 4ZI6A 2QYVA 4ONWA 2HB6A 4UIBA 4MRIA 3VATA 2PJ7A 3WT4A 4A37A 2V8HA 4Z65A 2PIZA 4W9YA 4TWEA 3PB7X 2V8GA 1F2PA 2AFUA 3IEHA 5D8NA 4ZYQA 1NSAA 4BD9A 4MXUA 4X2TA 1TKFA 1HEEA 3IC1A 3ISXA 7CPAA 3FF3A 2OR4A 3GB0A 1Z5RA 3FVLA 4FAIA 1HDUA 3D68A 2Q4ZA 2PJCA 4P4IA 2EK8A 2RFHA 2ZEHA 6CPAA 5IB9A 2ZENA 3FEEA 3KI9A 3MRUA 1XMBA 4IHMA 4EWTA 4F8ZA 1XBUA 3D7GA 4X8IA 5LYIA 2O4HA 4RUHA 1CBXA 3B35A 3TC8A 3S9LA 5HXDA 1R43A 3CPAA 3S9NA 5LYLA 2PJ8A 3SJEA 2AFMA 1F2OA 3CDXA 4FBEA 2BOAA 3FECA 1YSJA 2ABZA 1CX8A 3H8GA 3HUVA 1TKHA 5LYFA 1YW6A 3FH4A 3B3SA 2EK9A 3B2YA 3NFZA 4OC5A 1M4LA 1LAPA 1VIXA 1ZLHA 4FUUA 2G9DA 2CIJA 3L2NA 2ZEOA 4UF4A 2PJBA 4Q7AA 3V7ZA 4UIAA 3RAMA 4B6ZA 3D7FA 3D4UA 3PBBA 3PFOA 1CPXA 4R76A 4NGMA 2POKA 3FEDA 4TNUA 4JZ0A 3BHXA 4A38A 2Q51A 3KHZA 4PXEA 3B7IA 5J1QA 5HVFA 2ANPA 1KWMA 4MCRA 3IJ3A 3TX8A 2F7VA 2PVWA 1Z8LA 2GLJA 1F57A 1PYTB 2QVPA 4MCSA 4OMEA 3QNVA 3NA6A 3MN8A 1TF9A 1TF8A 1YW4A 1RTQA 4G1PA 3IIBA 4EFDA 3DLJA 2CF4A 4NGPA 3CT9A 4UEEA 4NGSA 2C6PA 2C6GA 1YMEA 3VARA 3PB4X 2ZEFA 4R7MA 1XJOA 2AFWA 1BAVA 1ELLP 3D66A 3HLPA 4NGNA 2C6CA 2V8VA 4AXVA 1YLOA 3BI0A 3VH9A 4P4JA 2VL1A 5JM6A 3FX6A 3PB9X 1ZLIA 1HDQA 1ZG9A 4H2KA 4ZX8A 4MHPA 3KASA 5DS0A 2C1CA 2IQ6A 1OBRA 1XRYA 3IO1A 4NFRA 3D67A 2J9AA 1IY7A 2XEJA 4MHNA 1IGBA 3SI0A 2AFXA 5CPAA 2PJ9A 1ZG7A 1GYTA 3K2KA 1Z2LA 2PE3A 4KSIA 1CP7A 4ZY2A 4WWVA 1Y0RA 1H8LA 2XEFA 4PXDA 3GLJA 3IWWA 1BPNA 2XEGA 4PXCA 2ZEEA 2PJ2A 3PEIA 1LFWA 4GM5A 2CTCA 2PJ0A 4P10A 4UEFA 2BCOA 4OIDA 2AFZA 2WYRA 3IFEA 4NJRA 4UEZA 2ZEPA 4OC0A 4NJQA 4R6TA 1VHEA 1QMUA 2AFSA 1ELMP 5ELYA 3SJXA 2I3CA 5LYDA 5LRJA 4ZY0A 5K8OA 4R8FA 4DYOA 5K8MA 2V77A 3SI1A 3FMCA 4MMOA 3KHXA 3SI2A 1CG2A 3WC6A 2PJ4A 4ZY1A 5CBMA 4JYWA 4MCQA 1EE3P 4NGRA 2PIYA 1TKJA 3KZWA 1AYEA 2ZELA 1CP6A 3KL9A 2WZNA 2PJ3A 5HVHA 1Q7LA 2ZOGA 3WC5A 5LRKA 5K8NA 2BO9A 3I1UA 3WABA 4A94A 2QJ8A 1ZG8A 4YU9A 3V38A 4P4BA 1Y0YA 2PJ6A 3B3TA 1LANA 2JBKA 2V8DA 4DJLA 4IK2A 2GU2A 3KR4A 4P44A 3CPXA 2IMOA 3LWUA 2PRQA 2GREA 2JBJA 3GUXA 3NH5A 3SJGA 3PBEA 4OC2A 3RZAA 4MHZA 4LQGA 4F9VA 3N5FA 3BXMA 2NYQA 5K8PA 3WC7A 1FT7A 5THWA 4DUKA 2HC9A 3PB8X 4O23A 3DGVA 1VGYA 3JRUA 8CPAA 1DTDA 1R3NA 5F09A 4P4FA 4CPAA 5D29A 4OIWA 2PJAA 4P6YA 2CTBA 3BI1A 4NGQA 2ZEDA 1BPMA 1LAMA 4OC3A 1TXRA 4A39A 3KQXA 2JEWA 3KR5A 5JH9A 1ARMA 4IAVA 4MCPA 1XFOA 1AMPA 2DEAA 4K3NA 4OP4A 4NGTA 4X3RA 2PJ5A 4F9UA 2OOTA 3NH4A 4EMEA 4FWUA 1CPSA 3PRTA 5LRGA 1UWYA 3S9MA 4MHYA 2EWBA 4YWYA 4OC1A 3PB6X 3KQZA 3K9TA 1LCPA 3LMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4E A;  2PJ1 A;  1ARL A;  1BLL E;  2O53 A;  3SJF A;  3KGQ A;  2FVG A;  2GLF A;  1DE4 C;  4ZX9 A;  5JGF A;  4PPZ A;  2NSM A;  1QQ9 A;  4P4D A;  2F8H A;  3D7H A;  3NH8 A;  3B3W A;  1VHO A;  2Q43 A;  3D7D A;  3T8W A;  3RBU A;  2ZEG A;  4P45 A;  5HVG A;  2PCU A;  4PXB A;  4OC4 A;  1FNO A;  2RB7 A;  3PFE A;  4OKO A;  2ZOF A;  3FJU A;  2IJZ A;  4PQA A;  1Y7E A;  3B3V A;  1LOK A;  3B3C A;  3H8E A;  2AFO A;  2XEI A;  3H8F A;  1JQG A;  2ZEM A;  3ISZ A;  4WJB A;  1PCA A;  5I4M A;  2PVV A;  4ZI6 A;  2QYV A;  4ONW A;  2HB6 A;  4UIB A;  4MRI A;  3VAT A;  2PJ7 A;  3WT4 A;  4A37 A;  2V8H A;  4Z65 A;  2PIZ A;  4W9Y A;  4TWE A;  3PB7 X;  2V8G A;  1F2P A;  2AFU A;  3IEH A;  5D8N A;  4ZYQ A;  1NSA A;  4BD9 A;  4MXU A;  4X2T A;  1TKF A;  1HEE A;  3IC1 A;  3ISX A;  7CPA A;  3FF3 A;  2OR4 A;  3GB0 A;  1Z5R A;  3FVL A;  4FAI A;  1HDU A;  3D68 A;  2Q4Z A;  2PJC A;  4P4I A;  2EK8 A;  2RFH A;  2ZEH A;  6CPA A;  5IB9 A;  2ZEN A;  3FEE A;  3KI9 A;  3MRU A;  1XMB A;  4IHM A;  4EWT A;  4F8Z A;  1XBU A;  3D7G A;  4X8I A;  5LYI A;  2O4H A;  4RUH A;  1CBX A;  3B35 A;  3TC8 A;  3S9L A;  5HXD A;  1R43 A;  3CPA A;  3S9N A;  5LYL A;  2PJ8 A;  3SJE A;  2AFM A;  1F2O A;  3CDX A;  4FBE A;  2BOA A;  3FEC A;  1YSJ A;  2ABZ A;  1CX8 A;  3H8G A;  3HUV A;  1TKH A;  5LYF A;  1YW6 A;  3FH4 A;  3B3S A;  2EK9 A;  3B2Y A;  3NFZ A;  4OC5 A;  1M4L A;  1LAP A;  1VIX A;  1ZLH A;  4FUU A;  2G9D A;  2CIJ A;  3L2N A;  2ZEO A;  4UF4 A;  2PJB A;  4Q7A A;  3V7Z A;  4UIA A;  3RAM A;  4B6Z A;  3D7F A;  3D4U A;  3PBB A;  3PFO A;  1CPX A;  4R76 A;  4NGM A;  2POK A;  3FED A;  4TNU A;  4JZ0 A;  3BHX A;  4A38 A;  2Q51 A;  3KHZ A;  4PXE A;  3B7I A;  5J1Q A;  5HVF A;  2ANP A;  1KWM A;  4MCR A;  3IJ3 A;  3TX8 A;  2F7V A;  2PVW A;  1Z8L A;  2GLJ A;  1F57 A;  1PYT B;  2QVP A;  4MCS A;  4OME A;  3QNV A;  3NA6 A;  3MN8 A;  1TF9 A;  1TF8 A;  1YW4 A;  1RTQ A;  4G1P A;  3IIB A;  4EFD A;  3DLJ A;  2CF4 A;  4NGP A;  3CT9 A;  4UEE A;  4NGS A;  2C6P A;  2C6G A;  1YME A;  3VAR A;  3PB4 X;  2ZEF A;  4R7M A;  1XJO A;  2AFW A;  1BAV A;  1ELL P;  3D66 A;  3HLP A;  4NGN A;  2C6C A;  2V8V A;  4AXV A;  1YLO A;  3BI0 A;  3VH9 A;  4P4J A;  2VL1 A;  5JM6 A;  3FX6 A;  3PB9 X;  1ZLI A;  1HDQ A;  1ZG9 A;  4H2K A;  4ZX8 A;  4MHP A;  3KAS A;  5DS0 A;  2C1C A;  2IQ6 A;  1OBR A;  1XRY A;  3IO1 A;  4NFR A;  3D67 A;  2J9A A;  1IY7 A;  2XEJ A;  4MHN A;  1IGB A;  3SI0 A;  2AFX A;  5CPA A;  2PJ9 A;  1ZG7 A;  1GYT A;  3K2K A;  1Z2L A;  2PE3 A;  4KSI A;  1CP7 A;  4ZY2 A;  4WWV A;  1Y0R A;  1H8L A;  2XEF A;  4PXD A;  3GLJ A;  3IWW A;  1BPN A;  2XEG A;  4PXC A;  2ZEE A;  2PJ2 A;  3PEI A;  1LFW A;  4GM5 A;  2CTC A;  2PJ0 A;  4P10 A;  4UEF A;  2BCO A;  4OID A;  2AFZ A;  2WYR A;  3IFE A;  4NJR A;  4UEZ A;  2ZEP A;  4OC0 A;  4NJQ A;  4R6T A;  1VHE A;  1QMU A;  2AFS A;  1ELM P;  5ELY A;  3SJX A;  2I3C A;  5LYD A;  5LRJ A;  4ZY0 A;  5K8O A;  4R8F A;  4DYO A;  5K8M A;  2V77 A;  3SI1 A;  3FMC A;  4MMO A;  3KHX A;  3SI2 A;  1CG2 A;  3WC6 A;  2PJ4 A;  4ZY1 A;  5CBM A;  4JYW A;  4MCQ A;  1EE3 P;  4NGR A;  2PIY A;  1TKJ A;  3KZW A;  1AYE A;  2ZEL A;  1CP6 A;  3KL9 A;  2WZN A;  2PJ3 A;  5HVH A;  1Q7L A;  2ZOG A;  3WC5 A;  5LRK A;  5K8N A;  2BO9 A;  3I1U A;  3WAB A;  4A94 A;  2QJ8 A;  1ZG8 A;  4YU9 A;  3V38 A;  4P4B A;  1Y0Y A;  2PJ6 A;  3B3T A;  1LAN A;  2JBK A;  2V8D A;  4DJL A;  4IK2 A;  2GU2 A;  3KR4 A;  4P44 A;  3CPX A;  2IMO A;  3LWU A;  2PRQ A;  2GRE A;  2JBJ A;  3GUX A;  3NH5 A;  3SJG A;  3PBE A;  4OC2 A;  3RZA A;  4MHZ A;  4LQG A;  4F9V A;  3N5F A;  3BXM A;  2NYQ A;  5K8P A;  3WC7 A;  1FT7 A;  5THW A;  4DUK A;  2HC9 A;  3PB8 X;  4O23 A;  3DGV A;  1VGY A;  3JRU A;  8CPA A;  1DTD A;  1R3N A;  5F09 A;  4P4F A;  4CPA A;  5D29 A;  4OIW A;  2PJA A;  4P6Y A;  2CTB A;  3BI1 A;  4NGQ A;  2ZED A;  1BPM A;  1LAM A;  4OC3 A;  1TXR A;  4A39 A;  3KQX A;  2JEW A;  3KR5 A;  5JH9 A;  1ARM A;  4IAV A;  4MCP A;  1XFO A;  1AMP A;  2DEA A;  4K3N A;  4OP4 A;  4NGT A;  4X3R A;  2PJ5 A;  4F9U A;  2OOT A;  3NH4 A;  4EME A;  4FWU A;  1CPS A;  3PRT A;  5LRG A;  1UWY A;  3S9M A;  4MHY A;  2EWB A;  4YWY A;  4OC1 A;  3PB6 X;  3KQZ A;  3K9T A;  1LCP A;  3LMS A; 
#chains in the Genus database with same CATH topology
 4II9 A;  1YK3 A;  1NE9 A;  1WWZ A;  4P4E A;  2PJ1 A;  1ARL A;  2B5G B;  1BLL E;  2O53 A;  4BIN A;  4CGO A;  4UBR A;  4B5P A;  1Z4R A;  3EY5 A;  3GY9 A;  3SJF A;  1X12 A;  3KGQ A;  2FVG A;  4MI4 A;  2VXK A;  2FL4 A;  4UFX A;  2GLF A;  1DE4 C;  4ZX9 A;  4JXQ A;  2EBJ A;  4KOU A;  5JGF A;  1KUY A;  4PPZ A;  2NSM A;  4HNW B;  1QQ9 A;  4P4D A;  1Y9K A;  2F8H A;  3D7H A;  3NH8 A;  3B3W A;  1TIQ A;  4M3S A;  1VHO A;  2Q43 A;  2VQY A;  3D7D A;  4OLL A;  3TTH A;  4AVB A;  3T8W A;  1P4N A;  2AE6 A;  4J3G A;  2J8N A;  3F0A A;  5E96 A;  3CXS A;  4PK2 A;  3RBU A;  4KOT A;  4KOR A;  4FD4 A;  2ZEG A;  1QSN A;  4YRH A;  2I00 A;  3S6H A;  2D4O A;  2GFQ A;  4AG7 A;  5C88 A;  4P45 A;  5HVG A;  2PCU A;  4PXB A;  5KTA A;  4KLW A;  1MJA A;  4OC4 A;  4LQ6 A;  1FNO A;  2RB7 A;  3PFE A;  3R1K A;  4KZT A;  5AG7 A;  4A31 A;  4OKO A;  2ZOF A;  3FJU A;  2GAN A;  2IJZ A;  4PQA A;  5ISV A;  2Q04 A;  1Y7E A;  1I12 A;  4KVO E;  1WK4 A;  4PV6 A;  3B8G A;  3B3V A;  1LOK A;  3B3C A;  3H8E A;  2AFO A;  4C2X A;  4R3L A;  2XEI A;  3H8F A;  1X10 A;  1PUA A;  1JQG A;  2ZEM A;  1RO5 A;  2ZPA A;  2DPS A;  3ISZ A;  4WJB A;  4F0X A;  1Z9U A;  4RN7 A;  1PCA A;  5I4M A;  4Y49 C;  4JJX A;  2PVV A;  3VWE A;  2FIA A;  2QYV A;  4ZI6 A;  4QVT A;  4ONW A;  4C7I A;  2HB6 A;  4UIB A;  4NCZ A;  3IWG A;  1QST A;  2FSR A;  1SQH A;  4KOS A;  1IID A;  4MRI A;  2CNT A;  3EFA A;  3SXN A;  2OB0 A;  2PJ7 A;  1IB1 E;  2YGW A;  3EXN A;  3VAT A;  3W6S A;  2DF5 A;  5H86 A;  4XPL A;  5EMI A;  4C68 A;  4FD5 A;  2FT0 A;  1CM0 A;  3RYO A;  3WT4 A;  4A37 A;  2V8H A;  4Z65 A;  1IIC A;  2PIZ A;  2R8V A;  2WUU A;  4W9Y A;  5IX3 A;  4TWE A;  3PB7 X;  1J4J A;  4HPS A;  1Y9W A;  2V8G A;  3ZZI A;  2K5T A;  1UFH A;  3R9F A;  1B6B A;  1F2P A;  2AFU A;  3IEH A;  5D8N A;  3T9Y A;  1NSA A;  4KSF A;  4ZYQ A;  3F8K A;  4HKF A;  4BD9 A;  1XE4 A;  4IF5 A;  4ORF A;  3TFY A;  5IB0 A;  4MXU A;  4X2T A;  5G21 A;  1TKF A;  4B11 A;  1HEE A;  3IC1 A;  3ISX A;  7CPA A;  3FF3 A;  1P0H A;  2OR4 A;  4C2Z A;  2PSW A;  3GB0 A;  2Z3P A;  3PP9 A;  5AG6 A;  5A28 A;  1Z5R A;  2FXF A;  3S6G A;  4CAF A;  3FIX A;  3FVL A;  4H89 A;  2OU2 A;  4FAI A;  2ZW4 A;  5C82 A;  1HDU A;  3D68 A;  2Q4Z A;  2Z3M A;  4CAW A;  1YX0 A;  2PJC A;  4P4I A;  2EK8 A;  2RFH A;  2YNE A;  2Q4V A;  2ZEH A;  6CPA A;  5IB9 A;  2ZEN A;  2JDC A;  3FEE A;  3PZJ A;  4XPD C;  1S5K A;  3KI9 A;  4B12 A;  4L89 A;  4AVC A;  4EVY A;  1M1D A;  2B4D A;  3MRU A;  4DNC A;  4HNX B;  4CS0 B;  1XMB A;  2WPW A;  4IHM A;  3I9S A;  4C2Y A;  4EWT A;  4CRZ B;  3R96 A;  4F8Z A;  1S7L A;  1XBU A;  3D7G A;  4X8I A;  1PU9 A;  3EO4 A;  2P6E A;  2Z0Z A;  5G22 A;  5LYI A;  3DSB A;  2QML A;  2O4H A;  4CGM A;  1GHE A;  4A32 A;  4RUH A;  3E0K A;  2Z10 A;  1CBX A;  3B35 A;  5KTD A;  3TC8 A;  3S9L A;  3T90 A;  2ZXV A;  1R43 A;  5HXD A;  3CPA A;  2KCW A;  3CZX A;  3H4Q A;  3S9N A;  1LRZ A;  4I49 A;  5LYL A;  2PJ8 A;  4MFL A;  3SJE A;  2AFM A;  5AG5 A;  1F2O A;  2JLM A;  3JUW A;  3ZJ0 A;  4L8A A;  3CDX A;  4FBE A;  2BOA A;  3FEC A;  4B5P B;  1YSJ A;  2ABZ A;  1CX8 A;  1M44 A;  3H8G A;  1Z8W A;  3HUV A;  2J8R A;  2QEC A;  1TKH A;  3I3G A;  3W91 A;  2FIW A;  3UY5 A;  2FCK A;  2C27 A;  1KUX A;  3CXP A;  1L0C A;  2IL4 A;  4CGL A;  3D3S A;  5LYF A;  1YW6 A;  3FH4 A;  3G3S A;  3K9U A;  1IYK A;  3B3S A;  3LOD A;  4YGO A;  4MFK A;  2EK9 A;  4B10 A;  3B2Y A;  3NFZ A;  4OC5 A;  3IU1 A;  1IOF A;  1M4L A;  1LAP A;  1VIX A;  1ZLH A;  4FUU A;  1N71 A;  1Q2Y A;  2B5G A;  2G9D A;  2CIJ A;  2YNC A;  2ZEO A;  3L2N A;  4UF4 A;  2PJB A;  4R3K A;  3S6K A;  4Q7A A;  3V7Z A;  4UIA A;  4Y49 B;  1MJ9 A;  3RAM A;  4B6Z A;  2WSA A;  5J8F A;  4UA3 A;  3D7F A;  3D4U A;  3PBB A;  3PFO A;  1QSO A;  4KVM E;  1BOB A;  4JLY A;  1CPX A;  4R76 A;  1Z8X A;  4NGM A;  1V0C A;  3DDD A;  4NSQ A;  2POK A;  4MFP A;  1M4D A;  3FED A;  4TNU A;  4JZ0 A;  3H5Z A;  3BHX A;  3IGR A;  4A38 A;  2OZH A;  5JPH A;  2R7H A;  2Q51 A;  3FB3 A;  2YNC C;  3KHZ A;  2G0B A;  4AVA A;  2Z3K A;  5IV0 A;  4PXE A;  2RC4 A;  2Z3N A;  3B7I A;  4BMH A;  2FE7 A;  5J1Q A;  1IOI A;  2HUZ A;  3JVN A;  3TOA A;  5HVF A;  2ANP A;  1KWM A;  2GIV A;  4MCR A;  2ARH A;  3IJ3 A;  1QSR A;  1B87 A;  3TX8 A;  2F7V A;  2PVW A;  4F0Y A;  1Z8L A;  2GLJ A;  1F57 A;  1PYT B;  2QVP A;  1Z8T A;  4MCS A;  4OME A;  4UWJ A;  3QNV A;  2B3U A;  1M4G A;  3NA6 A;  4ZGY B;  3MN8 A;  1TF9 A;  4RI1 A;  4M6H A;  1TF8 A;  5AG4 A;  2CNS A;  1YW4 A;  1RTQ A;  1I1D A;  4G1P A;  4YFJ A;  1YVO A;  3IIB A;  2VZY A;  2PDO A;  4EFD A;  3BLN A;  3DLJ A;  2CF4 A;  4B13 A;  2H5M A;  2GE3 A;  3C26 A;  2OH1 A;  4NGP A;  2F5I A;  3CT9 A;  5J8C A;  2PR1 A;  1YLE A;  4UEE A;  4NGS A;  4CYP A;  3SXO A;  4Q38 A;  2C6P A;  4Q36 A;  4XNH B;  2C6G A;  1YME A;  3VAR A;  2B58 A;  5CNP A;  3WR7 A;  3PB4 X;  1KUV A;  2ZEF A;  4R7M A;  1XJO A;  2AFW A;  5GCN A;  1BAV A;  1ELL P;  1ZO0 A;  1YR0 A;  4XPD B;  3V8I A;  4UFW A;  3D66 A;  3HLP A;  4NGN A;  2C6C A;  4E8O A;  2V8V A;  4AXV A;  2DPT A;  2DXQ A;  1YLO A;  4JXR A;  4A30 A;  4B5O A;  3BI0 A;  3VH9 A;  2R98 A;  4P4J A;  5FVJ A;  4E2A A;  2VL1 A;  2BL1 A;  2P0W A;  3D8P A;  5JM6 A;  5F48 A;  4CYQ A;  2JDD A;  3FX6 A;  3NE8 A;  4K30 A;  3PB9 X;  4BBH A;  4QB9 A;  5A27 A;  2VEZ A;  1ZLI A;  1NMT A;  1HDQ A;  2CY2 A;  1ZG9 A;  4XNH C;  4H2K A;  3W6X A;  4UWI A;  4ZX8 A;  2Q7S A;  1IU8 A;  3KAS A;  4MHP A;  5DS0 A;  2C1C A;  2IQ6 A;  2PR8 A;  1OBR A;  1XRY A;  2B4D B;  1Q2D A;  2CNM A;  3IO1 A;  4NFR A;  3D67 A;  4MY0 A;  2D4P A;  3R9G A;  2J9A A;  1IY7 A;  1QSM A;  2I79 A;  2XEJ A;  4U9Z A;  4A2Z A;  4CGN A;  4MHN A;  1IGB A;  1MK4 A;  4A33 A;  1M4I A;  2Q0Y A;  3SI0 A;  2AFX A;  2Z11 A;  4CYO A;  2REE A;  1XF8 A;  2ODF A;  2PJ9 A;  5CPA A;  2PC1 A;  3R9E A;  3CXQ A;  5KTC A;  1ZG7 A;  2ZW6 A;  1GYT A;  3K2K A;  1Z2L A;  2PE3 A;  2OZG A;  4HNY B;  4JWP A;  1CP7 A;  4KSI A;  3GKR A;  4PSX A;  4ZY2 A;  1Y7R A;  4U9Y A;  4WWV A;  1Y0R A;  1H8L A;  5BWA B;  1R57 A;  2XEF A;  1XEB A;  4MFJ A;  2G3T A;  4PXD A;  2EO8 A;  3GLJ A;  5JQ4 A;  4KUB A;  3TCV A;  2VBQ A;  3IWW A;  1BPN A;  5F49 A;  2XEG A;  4PXC A;  2FS5 A;  2PJ2 A;  2ZEE A;  3G8W A;  3OWC A;  3PEI A;  3SHP A;  1LFW A;  4GM5 A;  2CTC A;  2PJ0 A;  4P10 A;  4UEF A;  2BCO A;  3FRM A;  4OID A;  5HMN A;  4KVX A;  2NMT A;  2AFZ A;  4M6I A;  5DWM A;  4CAX A;  4KUA A;  3DR8 A;  3N7Z A;  2WYR A;  3IFE A;  2P6G A;  4NJR A;  4UEZ A;  1FY7 A;  2ZEP A;  4OC0 A;  4NJQ A;  4R6T A;  3F5B A;  1VHE A;  5I0C A;  1K4J A;  3PGP A;  1QMU A;  4ONU A;  2AFS A;  4KOV A;  2PQ8 A;  1ELM P;  5ELY A;  4OAD A;  3SJX A;  3FNC A;  2I3C A;  5LYD A;  5LRJ A;  3VWD A;  4CRY B;  2ZW5 A;  4ZY0 A;  4FD6 A;  5K8O A;  3S6F A;  4R8F A;  1YRE A;  4DYO A;  4NF1 A;  3FXT A;  3TOB A;  5K8M A;  5G1Z A;  3NE7 A;  3TO6 A;  2V77 A;  2CXA A;  1BO4 A;  4ZBG A;  3SI1 A;  3FMC A;  2WPX A;  4MMO A;  4UCN A;  3KHX A;  1YQE A;  2R1I A;  3SI2 A;  4KOX A;  4R87 A;  1CG2 A;  3LAC A;  4LUA A;  4A95 A;  3WC6 A;  3QAY A;  4UCM A;  1S7N A;  1VKC A;  1ON0 A;  2B4B A;  4F6A A;  2PJ4 A;  4ZY1 A;  3TO7 A;  5CBM A;  4JYW A;  4MCQ A;  1EE3 P;  1S7F A;  2PIY A;  4NGR A;  4B14 A;  1TKJ A;  2VI7 A;  3MGD A;  3KZW A;  1AYE A;  2ZEL A;  3RO0 A;  1IYL A;  1CP6 A;  3KL9 A;  2PJ3 A;  2WZN A;  4H6U A;  4R9M A;  5HVH A;  1Q7L A;  4MY3 A;  1A2Z A;  2ZOG A;  2A4N A;  3KKW A;  3WC5 A;  5LRK A;  3QB8 A;  5DWN A;  4M6G A;  5K8N A;  2O28 A;  5F47 A;  4CYN A;  2BO9 A;  3I1U A;  3WAB A;  5G20 A;  4A94 A;  4AG9 A;  2QJ8 A;  3BJ8 A;  1ZG8 A;  5AGE A;  4YU9 A;  3V38 A;  3FBU A;  4P4B A;  3TT2 A;  1Y0Y A;  2PJ6 A;  1YVK A;  3BJ7 A;  2Q44 A;  3B3T A;  2YND A;  1LAN A;  1S3Z A;  2Q4Y A;  2JBK A;  4UFV A;  2V8D A;  1Z4E A;  4IK2 A;  4JD6 A;  2GU2 A;  3KR4 A;  1NSL A;  4DJL A;  4P44 A;  4IUS A;  1AUG A;  3CPX A;  5H84 A;  1VHS A;  2IMO A;  3LWU A;  2PRQ A;  2EVN A;  2GRE A;  1MJB A;  2JBJ A;  3GUX A;  4KOW A;  2Z3O A;  4XPK A;  4KOY A;  1KZF A;  3DR6 A;  3GYA A;  3NH5 A;  3SJG A;  1XOV A;  3PBE A;  4OC2 A;  3RZA A;  4MHZ A;  4LQG A;  2HV2 A;  2ZW7 A;  3BXM A;  2Z3L A;  3LD2 A;  3N5F A;  4F9V A;  2P6F A;  2REF A;  2NYQ A;  2X7B A;  5K8P A;  3WC7 A;  1FT7 A;  3QAH A;  5THW A;  4DUK A;  4UCP A;  4H6Z A;  1RXT A;  5EC4 A;  3IWE A;  5EBV A;  2HC9 A;  1OZP A;  4PK3 A;  5F46 A;  3A9L A;  3P2H A;  3PB8 X;  3DGV A;  4KSA A;  4O23 A;  1VGY A;  4MJ8 A;  3IU2 A;  2B3V A;  3JRU A;  3RNZ A;  8CPA A;  2BEI A;  1DTD A;  1R3N A;  5F09 A;  4NXY A;  4P4F A;  4CPA A;  2VZZ A;  5D29 A;  4OIW A;  2PJA A;  4P6Y A;  2CTB A;  3TO9 A;  4NEX A;  3BI1 A;  3D2P A;  3P2F A;  4NGQ A;  2ZED A;  3TE4 A;  1BPM A;  2BSW A;  3D2M A;  1LAM A;  4FD7 A;  4GXH A;  4OC3 A;  1TXR A;  4A39 A;  1U6M A;  3KQX A;  4QC6 A;  3GIU A;  2ATR A;  4QUS A;  2HQY A;  4KS9 A;  4M85 A;  2JEW A;  3KR5 A;  5JH9 A;  1ARM A;  4C7H A;  4IAV A;  5HH1 A;  4CAV A;  4MCP A;  3FYN A;  1XFO A;  4E0A A;  1AMP A;  1XMT A;  4OAE A;  2DEA A;  4K3N A;  3DNS A;  4RS2 A;  3EC4 A;  4OP4 A;  4NGT A;  4R57 A;  4QBJ A;  4LX9 A;  2PJ5 A;  4X3R A;  4F9U A;  2OOT A;  2JEV A;  4GS4 A;  2Q7B A;  4CAE A;  3NH4 A;  4MFQ A;  4U5Y A;  2EUI A;  4EME A;  4FWU A;  1CPS A;  3JTK A;  2J8M A;  1I21 A;  3PRT A;  4PSW A;  2BUE A;  4MBU A;  5LRG A;  2AJ6 A;  4MHD A;  2Y0M A;  1UWY A;  2PRB A;  1S7K A;  3S9M A;  4MHY A;  2EWB A;  4YWY A;  4OC1 A;  2QIR A;  4CGP A;  1S60 A;  1XIX A;  1Q2C A;  3R95 A;  4AB7 A;  1JWQ A;  3PB6 X;  2G3A A;  2OZU A;  1CJW A;  1YGH A;  3K9T A;  1LCP A;  3KQZ A;  3LMS A;  4X5K A;  4MFZ A;  4KLV A; 
#chains in the Genus database with same CATH homology
 4P4E A;  2PJ1 A;  1ARL A;  1BLL E;  2O53 A;  3SJF A;  3KGQ A;  2FVG A;  2GLF A;  1DE4 C;  4ZX9 A;  5JGF A;  4PPZ A;  2NSM A;  1QQ9 A;  4P4D A;  2F8H A;  3D7H A;  3NH8 A;  3B3W A;  1VHO A;  2Q43 A;  3D7D A;  3T8W A;  3RBU A;  2ZEG A;  4P45 A;  5HVG A;  2PCU A;  4PXB A;  4OC4 A;  1FNO A;  2RB7 A;  3PFE A;  4OKO A;  2ZOF A;  3FJU A;  2IJZ A;  4PQA A;  1Y7E A;  3B3V A;  1LOK A;  3B3C A;  3H8E A;  2AFO A;  2XEI A;  3H8F A;  1JQG A;  2ZEM A;  3ISZ A;  4WJB A;  1PCA A;  5I4M A;  2PVV A;  4ZI6 A;  2QYV A;  4ONW A;  2HB6 A;  4UIB A;  4MRI A;  3VAT A;  2PJ7 A;  3WT4 A;  4A37 A;  2V8H A;  4Z65 A;  2PIZ A;  4W9Y A;  4TWE A;  3PB7 X;  2V8G A;  1F2P A;  2AFU A;  3IEH A;  5D8N A;  4ZYQ A;  1NSA A;  4BD9 A;  4MXU A;  4X2T A;  1TKF A;  1HEE A;  3IC1 A;  3ISX A;  7CPA A;  3FF3 A;  2OR4 A;  3GB0 A;  1Z5R A;  3FVL A;  4FAI A;  1HDU A;  3D68 A;  2Q4Z A;  2PJC A;  4P4I A;  2EK8 A;  2RFH A;  2ZEH A;  6CPA A;  5IB9 A;  2ZEN A;  3FEE A;  3KI9 A;  3MRU A;  1XMB A;  4IHM A;  4EWT A;  4F8Z A;  1XBU A;  3D7G A;  4X8I A;  5LYI A;  2O4H A;  4RUH A;  1CBX A;  3B35 A;  3TC8 A;  3S9L A;  5HXD A;  1R43 A;  3CPA A;  3S9N A;  5LYL A;  2PJ8 A;  3SJE A;  2AFM A;  1F2O A;  3CDX A;  4FBE A;  2BOA A;  3FEC A;  1YSJ A;  2ABZ A;  1CX8 A;  3H8G A;  3HUV A;  1TKH A;  5LYF A;  1YW6 A;  3FH4 A;  3B3S A;  2EK9 A;  3B2Y A;  3NFZ A;  4OC5 A;  1M4L A;  1LAP A;  1VIX A;  1ZLH A;  4FUU A;  2G9D A;  2CIJ A;  3L2N A;  2ZEO A;  4UF4 A;  2PJB A;  4Q7A A;  3V7Z A;  4UIA A;  3RAM A;  4B6Z A;  3D7F A;  3D4U A;  3PBB A;  3PFO A;  1CPX A;  4R76 A;  4NGM A;  2POK A;  3FED A;  4TNU A;  4JZ0 A;  3BHX A;  4A38 A;  2Q51 A;  3KHZ A;  4PXE A;  3B7I A;  5J1Q A;  5HVF A;  2ANP A;  1KWM A;  4MCR A;  3IJ3 A;  3TX8 A;  2F7V A;  2PVW A;  1Z8L A;  2GLJ A;  1F57 A;  1PYT B;  2QVP A;  4MCS A;  4OME A;  3QNV A;  3NA6 A;  3MN8 A;  1TF9 A;  1TF8 A;  1YW4 A;  1RTQ A;  4G1P A;  3IIB A;  4EFD A;  3DLJ A;  2CF4 A;  4NGP A;  3CT9 A;  4UEE A;  4NGS A;  2C6P A;  2C6G A;  1YME A;  3VAR A;  3PB4 X;  2ZEF A;  4R7M A;  1XJO A;  2AFW A;  1BAV A;  1ELL P;  3D66 A;  3HLP A;  4NGN A;  2C6C A;  2V8V A;  4AXV A;  1YLO A;  3BI0 A;  3VH9 A;  4P4J A;  2VL1 A;  5JM6 A;  3FX6 A;  3PB9 X;  1ZLI A;  1HDQ A;  1ZG9 A;  4H2K A;  4ZX8 A;  4MHP A;  3KAS A;  5DS0 A;  2C1C A;  2IQ6 A;  1OBR A;  1XRY A;  3IO1 A;  4NFR A;  3D67 A;  2J9A A;  1IY7 A;  2XEJ A;  4MHN A;  1IGB A;  3SI0 A;  2AFX A;  5CPA A;  2PJ9 A;  1ZG7 A;  1GYT A;  3K2K A;  1Z2L A;  2PE3 A;  4KSI A;  1CP7 A;  4ZY2 A;  4WWV A;  1Y0R A;  1H8L A;  2XEF A;  4PXD A;  3GLJ A;  3IWW A;  1BPN A;  2XEG A;  4PXC A;  2ZEE A;  2PJ2 A;  3PEI A;  1LFW A;  4GM5 A;  2CTC A;  2PJ0 A;  4P10 A;  4UEF A;  2BCO A;  4OID A;  2AFZ A;  2WYR A;  3IFE A;  4NJR A;  4UEZ A;  2ZEP A;  4OC0 A;  4NJQ A;  4R6T A;  1VHE A;  1QMU A;  2AFS A;  1ELM P;  5ELY A;  3SJX A;  2I3C A;  5LYD A;  5LRJ A;  4ZY0 A;  5K8O A;  4R8F A;  4DYO A;  5K8M A;  2V77 A;  3SI1 A;  3FMC A;  4MMO A;  3KHX A;  3SI2 A;  1CG2 A;  3WC6 A;  2PJ4 A;  4ZY1 A;  5CBM A;  4JYW A;  4MCQ A;  1EE3 P;  4NGR A;  2PIY A;  1TKJ A;  3KZW A;  1AYE A;  2ZEL A;  1CP6 A;  3KL9 A;  2WZN A;  2PJ3 A;  5HVH A;  1Q7L A;  2ZOG A;  3WC5 A;  5LRK A;  5K8N A;  2BO9 A;  3I1U A;  3WAB A;  4A94 A;  2QJ8 A;  1ZG8 A;  4YU9 A;  3V38 A;  4P4B A;  1Y0Y A;  2PJ6 A;  3B3T A;  1LAN A;  2JBK A;  2V8D A;  4DJL A;  4IK2 A;  2GU2 A;  3KR4 A;  4P44 A;  3CPX A;  2IMO A;  3LWU A;  2PRQ A;  2GRE A;  2JBJ A;  3GUX A;  3NH5 A;  3SJG A;  3PBE A;  4OC2 A;  3RZA A;  4MHZ A;  4LQG A;  4F9V A;  3N5F A;  3BXM A;  2NYQ A;  5K8P A;  3WC7 A;  1FT7 A;  5THW A;  4DUK A;  2HC9 A;  3PB8 X;  4O23 A;  3DGV A;  1VGY A;  3JRU A;  8CPA A;  1DTD A;  1R3N A;  5F09 A;  4P4F A;  4CPA A;  5D29 A;  4OIW A;  2PJA A;  4P6Y A;  2CTB A;  3BI1 A;  4NGQ A;  2ZED A;  1BPM A;  1LAM A;  4OC3 A;  1TXR A;  4A39 A;  3KQX A;  2JEW A;  3KR5 A;  5JH9 A;  1ARM A;  4IAV A;  4MCP A;  1XFO A;  1AMP A;  2DEA A;  4K3N A;  4OP4 A;  4NGT A;  4X3R A;  2PJ5 A;  4F9U A;  2OOT A;  3NH4 A;  4EME A;  4FWU A;  1CPS A;  3PRT A;  5LRG A;  1UWY A;  3S9M A;  4MHY A;  2EWB A;  4YWY A;  4OC1 A;  3PB6 X;  3KQZ A;  3K9T A;  1LCP A;  3LMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...