3B42A

Periplasmic sensor domain of chemotaxis protein gsu0935
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
b'SSLDLQLKNARNLAGLIIHDIDGYMMKGDSSEVDRFISAVKSKNFIMDLRVFDEQAKEVSPTPSQTPNAKIQQAIAAGRTLEFKETLDGKRTLSLVLPFPNEQRCQSCHDAGAAYLGGLLVTTSIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein, putative
publication title Structures and solution properties of two novel periplasmic sensor domains with c-type heme from chemotaxis proteins of Geobacter sulfurreducens: implications for signal transduction.
pubmed doi rcsb
source organism Geobacter sulfurreducens
molecule tags Signaling protein
total genus 33
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.290 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3b42A00
3B47A 3B42A
chains in the Genus database with same CATH superfamily
4DDSA 2WKPA 1W5DA 3RXWA 1H3QA 1TS6A 3G34A 4HJ4A 1XFNA 1OTBA 3MZDA 5EM0A 1ESIA 5FDHA 1QMFA 4KUOA 2ZC7A 5HARA 1LSWA 3LY4A 1F2KA 3F1PB 1Y54A 4WBGA 4HNBA 1BSGA 2W27A 2W0NA 3P09A 4Q0IA 1YAXA 1MWRA 4CJNA 2LB9A 2W1TB 3ZVWA 4EBLA 1N4OA 4WF0A 3O5YA 1P0ZA 1TS8A 4KZ6A 1OMEA 5FQ9A 1KE3A 3PAEA 2HZ5A 4DE2A 1MXOA 1DJBA 2DRWA 2V2FF 3VE4A 1DP9A 4ZRRA 1K25A 4Y13A 3CJMA 2OLVA 2V1AA 2XFSA 1K0KA 1LL8A 1UWNX 1M40A 4KG6A 3GDIA 1U60A 3GTCA 2UV0E 2Q9NA 1FR1A 1KGGA 4X55A 1YLTA 3UE0A 3R7WB 4KG5A 2ZL1A 3CHWP 3ZNTA 1LT0A 4GZBA 2XROA 2V1BA 4S2OA 3EOIA 3WWXA 4KQRA 3V50A 1QMEA 1MPLA 3AGEA 2QWSA 4GOGA 2Z2LB 3C4PA 1TVFA 2OAP1 3T4SA 3MF0A 1SZVA 2Q9MA 1RP5A 1XJ6A 1OTDA 1CI9A 5FI2A 2GJ3A 5TR7A 4OPQA 4L9FA 4EERA 2XQZA 4UEYA 2WKIA 2HF6A 4EQ1A 4KZ3A 3C2WA 3MR0A 1NRFA 2JKGA 4DMZA 3E2LA 5EVEA 3CWFA 3F1NB 5E2GA 4X69A 2PYPA 1PZOA 1SHVA 2XFTA 1G6OA 1AXBA 4C3QA 3EGXC 3JPUA 2EFXA 1Z09A 5EVIC 1KE0A 1TDLA 2QPNA 3BFDA 1MWTA 3PXPA 1K57A 2OLUA 5TFQA 1T1BA 4XT2A 4HHDA 2JN7A 3UMDA 3TG9A 2PD7A 3WS2A 3MQ0A 3SH9A 3C4OA 3U2AA 5A90A 4MBKA 4YFMA 1PW1A 5HDCA 1HLUP 2Y79A 3IX8A 1CF0A 1XKZA 3N8RA 1T1AA 1IYPA 1DP6A 2HPBA 3N4IA 5EOEA 3DAVA 3WS0A 2XR0A 5MC7A 1ZHHB 2VEAA 2X01A 3P7NA 3PR6A 5GL9A 5GHXA 1IFQA 3DW0A 4ZJ1A 4AFIA 5HL6A 1HZOA 3IF6C 4GKUA 3ZG8B 2L0WA 4GHIA 3SS5A 1MKMA 2K2NA 4YOFA 2G7UA 3GQZA 3T1XA 4HIAA 4OOMA 4BL3A 1YM1A 5FI7A 4XXRA 2D02A 4OOYA 2ZQ7A 5EM1A 3UPOA 3PBSA 4QB8A 4DRTA 3A3JA 2WGVA 4LRYC 1MWSA 4P0MA 2NUTC 2EXAA 1M6KA 4IEDA 1GCEA 2JC7A 4DE0A 4N92A 3O87A 5HPFA 2FFFB 5HAIA 1JWZA 5FA7A 4K91A 1KDSA 1OJ5A 3S7QA 1L2SA 3LIBA 1L0EA 2ZD8A 3BEBA 3DTEA 4XUZA 4ZDXA 4KUKA 2W3EA 1V9YA 3KYQA 4HP9A 2Y55A 5DFXA 2W1RA 1E25A 5EPHA 3FC7A 3MFXA 3ICYA 3P98A 1DJCA 2WKEA 3VFHA 5DKLA 3VOLA 4EEUA 3KSGA 2VGLS 3BFFA 1SDNA 1IKGA 1CQAA 3FPWA 2OOLA 4IBXA 3EGDC 2KDKA 1E3UD 1K55C 4YINA 4ZTKA 2K7SA 1ZC2A 3VOZA 3EEAA 3LCEA 3BQ8A 2VGJA 4X1MA 2ZLYA 3A3EA 4II7A 4HBUA 5FASA 4JF6A 3UE6A 5JYPA 2L1MA 3C5AA 1OTAA 3QP8A 5A8BA 3BLSA 5HX9A 1S1YA 3Q81A 1EWZA 3Q82A 1Q2QA 4DDYA 3LIEA 1WYBA 4KZ9A 3GV9A 4OPRA 2VGLM 2XDMA 4E3NA 3F1OA 2Z6CA 5HWTA 2ZM8A 5HL1A 2PHYA 4LCLA 3VP0A 3Q7VB 5DFYA 3KO6A 3ZG7B 5M1AA 1BULA 1ES3A 1OPXA 4JGQA 4MN5A 3LIDA 3HLWA 5EVIB 4HQAA 3H82A 4R4RA 2VV6A 3NDEA 3GMWA 1CEGA 3IXBA 1XGJA 3K3CA 2KLIA 2V9AA 4RVAA 4NXEA 2OWJA 2PR5A 1P9RA 1ZTUA 3VP3A 5FEGA 1CJFA 1LL5A 2OAQ1 4QJGA 4LENA 1P9WA 4N1XA 4MN6A 5CGWA 4UA9A 1L0DA 3SW1A 1ES5A 4DXBA 2XRNA 3ZG5A 2HP5A 1S0WA 5HWVA 3ULFA 4HJ6A 5M19A 2IA2A 2HGVA 5FQJA 1JWVA 1VEUA 4OLGA 3IF6B 3NJAA 3NDGA 1CK3A 1J3WA 2E8IA 4NXFA 2H5SA 3SZTA 4EU0A 4P6BA 5FDSA 3IX4A 4O0PA 1XGIA 2HDSA 1BYWA 4E04A 2WADA 4JGOA 3MJQA 4E3LA 4BLMA 4KG2A 3IBRA 3A0SA 4R3JA 4LV1A 4LV0A 4H6JB 3E4OA 4LV2A 2R78A 2PRFA 3C7UA 3T4OA 2ZQ9A 2Y2IA 1G68A 1OT6A 1SCWA 3IWIA 4DN0A 2Z6DA 4I3JA 2O9BA 3IX3A 4PM9A 1IYOA 2A24A 1W8YA 4GS9A 5L09A 3NECA 5U47A 4CLCA 3Q7ZA 4PHTA 3IWOA 3HUOA 1C3BA 2UWXA 4FCFA 1GSVA 4CPKA 3EQUA 1KGEA 1S1ZA 5BOHA 3RH8B 1V9ZA 3HUMA 1IEMA 4HBTA 2FZ0A 4OPZA 1I2WA 4KZBA 3OLOA 3I7JA 3SS4A 4JXGA 2P9VA 3H7WB 1KE4A 3ZYTA 2R9XA 4CLCE 3KSFA 5TGFA 3HL9A 1DRMA 3UE1A 4MBHA 4X6TA 5I5LA 2HDUA 4OQ0A 3BFGA 3IH9A 1LI0A 1ODVA 4I5SA 2Y2LA 3HLEA 2WZZA 4EUVA 1W63M 3T4LA 1PI4A 1VETA 5L8MA 3O88A 3S7PA 3CUEA 3MKFA 2ZJ9A 2J8YA 1SKOB 5FL3A 3MZFA 4E6WA 1KOUA 1NYYA 3BW6A 2PDRA 1OT9A 4B88A 2VJWA 3CZDA 3VSKA 3NY4A 4MNRA 3CPTA 3BJNA 3LIAA 4Y0OA 3LY3A 1YLWA 2EX2A 3UMEA 4R3BA 5HDSA 5HD5A 1TEMA 3UY6A 3RXXA 1N9LA 4ETZA 2J3TC 5FAOA 1GSWA 5GLDA 3T1SA 3PYPA 4S2NA 2INWA 4C75A 4ESPA 4OOLA 4HP4A 1XJ2A 5F69A 1PWDA 2EA9A 1GHIA 4S2PA 5F5YA 4GW9A 1BUEA 1ZKJA 2IWBA 3IS2A 4EWFA 3E98A 1DY6A 3LEZA 3ITBA 3HVFA 3NC8A 5F6AA 2M7VA 4LLOB 4S2JA 3PAGA 5TJJA 4UAAA 4UA6A 4Z9QA 5G4YA 1NLZA 4IUHA 2XD5A 3IXDA 3QP1A 1CEFA 1YLYA 5CGXA 2E8JA 5E2HA 2Y2MA 4KZ5A 2XK1A 3DTMA 4NKPA 2PT7A 4LV3A 3G4PA 1K4FA 5CEDA 1DJAA 4HH3A 5DTTA 4EBNA 2VGKA 4WZ5A 1XPBA 2P74A 5EOOA 5TBMA 4JXWA 1ONHA 2B5RA 5E2EA 2MJ6A 3M6HA 3LR3A 5EFWA 2H0YA 2QYBA 3VE3A 5HAQA 2AVXA 1W63Q 3DWKA 5F68A 4Y7PA 2Y59A 5KMWA 3OPRA 1ZG6A 5EV0A 2VX8A 4OP5A 5EE8A 4D60A 3UDXA 1EROA 3UPNA 5LBRA 4Y0TA 4MEZA 1PNEA 3TW8A 5AQ9A 4HEFA 3GVBA 1IYSA 2V0UA 3N7WA 4RQ9A 4EXOA 4NETA 4NXBA 4KZAA 1PWCA 3LUQA 4MLLA 5AVEA 2J3TD 4S2KA 3F1PA 4ZJ3A 3BWLA 3RJUA 3OCNA 5CRFA 3ITAA 3KX0X 4U3TA 2O9AA 4DF6A 1PRQA 3UB6A 3C7VA 4WEKA 4B4ZA 4L9EA 2C5WB 4BMWA 3FKVA 1GHPA 3LR5A 3UDFA 1D1JA 3A0VA 5HDDA 1MY8A 5A92A 1JTGA 5F83A 3LI9A 3GRJA 1SKFA 4S2LA 4GN2A 4NXGA 4F94A 1HTZA 1FCOA 4PKYA 3UE3A 4BJPA 1W79A 3H9WA 1YSQA 4DE3A 2VV7A 5CEBA 2YKHA 3R7WA 3MXQA 2JE5A 1K56A 2M1CA 3A3IA 3MZEA 3NHQA 4RYEA 4OONA 5K5BA 3T4QA 3T1QB 5GLAA 2KOIA 3B3XA 3IHAA 5DF8A 3ZVTA 2Q0OA 4KQOA 3VMAA 4WYYA 5CHUA 4PM6A 2BASA 1JTDA 3W4PA 2XGNA 4JXVA 3IF5A 1ACFA 5L10A 3LICA 5CX7A 4C6YA 1NY0A 2XA7M 4PM8A 2V1ZA 5M18A 4O7DA 2O0YA 3W4QA 5JYOA 2EX6A 1T19A 4ME4A 3F1NA 3CG5A 2Y2JA 4G3VA 3UB5P 1GA0A 2LB5A 2GNXA 3OPPA 1SDEA 2H28A 4OH0A 3LR0A 3FG8A 2WKQA 4O01A 3V5MA 1N9BA 3HLBA 4DXCA 3CAXA 2HJEA 1FCNA 1IKIA 1IELA 1UWPX 4N1HA 5E2FA 3LI8A 2Y8HA 1K54A 2HDRA 4S2NC 2VZWA 1BLPA 1OTEA 3CMZA 4KZ4A 3KSIA 2ZMVA 1NRJA 3BRMA 4UQIS 1XXMA 4YWZA 3NBLA 5GHYA 4BD1A 2PYRA 4S2MA 3VOYA 5FI6A 4HH2A 1DP8A 5G18A 2V0WA 2QJ5A 1XX2A 3ZDJA 2PR6A 4P6ZS 2WGWB 1VEUB 3QNBA 3SS3A 4ARZB 3V3RA 2V8CA 2P04A 5J3WA 3V67A 2ZC3B 1TD5A 3G2YA 2ZQCA 5DKKA 2H10A 1LSVA 2HDQA 4P87A 1PFLA 1PYYA 3UB7A 4B9OA 4UQIM 3VP2A 3Q07A 4O8GA 5HW3A 1IYQA 1XA1A 2W3FA 3KYEA 3V3SA 2ZC6B 5KSCA 3HUNA 1O07A 1F5MA 4DE1A 3MSHA 5CXWA 2OSUA 4LPZA 5DTKA 5CTMA 4FOFA 4L9GA 1WE4A 4P6ZM 5IU1A 4Y2FA 5CECA 3M2JA 3WRZA 1HD8A 1W8QA 1VHMA 2A24B 3L7HA 4PM5A 5KIZA 3BM6A 4OQHA 1ES4A 1ESUA 2EX8A 3QP2A 2VK3A 3N8SA 4EUZA 2BG1A 3MQQA 2ZM2A 4F3LB 4NG2A 2WAFA 2WAEA 1H5XA 2J9OA 4OP8A 2R9WA 2EFUA 2WK0A 3LGOA 3KYZA 1YSPA 3QP4A 5FQKA 2ZQ8A 4Y15A 4IVIA 2Y2NA 3S1YA 5AQ7A 3UB8A 4EEPA 1K57C 1ERMA 3NOPC 3ZG9B 3T50A 4QHCA 2A3UA 2G2WA 5GLCA 4E3KA 3SH8A 1VM1A 3JVVA 3NOTC 5AJGA 3HLFA 4Q0JA 4X25A 5AQBA 3U4LP 3Q7VA 3NCKA 2XSSA 2PU2A 2BLSA 4X56A 3E2KA 1T1CA 4RX2A 3PBNA 2JBFA 5EVIA 4IJGA 1VQQA 4ZJ2A 5FATA 2Y91A 2OWHA 1Z6FA 4BL2A 4FH2A 3B47A 4OQGA 5J7EA 1FSYA 1XJ3A 4UHUA 3AGDA 4QU3A 4QY5A 4GD8A 4OVDA 1L0FA 4U0XA 2ACGA 2X71A 3WRTA 1F9IA 1BLSA 3ZQ5A 4JLFA 4WZ4A 3JYIA 5CTNA 1NXYA 2B02A 5KSHA 4R4SA 2EX9A 3LYXA 3OPHA 4IHQA 1FIKA 1I5QA 2XD1A 3IXHA 1WYCA 3NULA 4GLQA 3VFFA 1XFQA 1NJ4A 4WEJA 3BY8A 3D4FA 2VV8A 3LIFA 3C8CA 4EBPA 2XLNA 3IF6A 5AVFA 3S7NA 2I72A 1K38A 2HP6A 1H8MA 1JVJA 3IQAA 3BECA 5HPIA 3JVUA 2HJ9C 4JBFA 4X53A 4BWIA 2JHEA 2VLGA 3O3VA 5EVLA 1MZUA 1N9NA 2PBYA 4UA7A 1S67L 3QP6A 4JPMA 4GNUA 4WMCA 1BZAA 4I38A 4H6JA 2Y2HA 2DCFA 2ZL1B 4MBFA 4Y3IA 5A93A 2Y2PA 4IUKA 5AQAA 4DKIA 3ZNYA 1GSXA 4FD8A 4GB7A 3T4TA 3A0RA 2CC1A 4PPRA 5EUAA 3LEQA 1JNUA 4E3JA 2K31A 5FSRA 4B93A 4WUJA 1PZPA 4FUWA 4QD4A 1FQGA 3FYZA 1G28A 2C6WB 2V20A 3G31A 4DJ2A 1KVMA 2XF3A 3D72A 3S22A 1S6RA 2ZBBA 4R0QA 1L0GA 3MKEA 5CGSA 3HCYA 1GHMA 1NZOA 1KGFA 1EW0A 1VB6A 4Q8IA 1Q2PA 1YLPA 5E43A 1K55A 3C38A 3GSGA 1H8ZA 3FV7A 3EWKA 3P01A 1P97A 1YLJA 2JKFA 4P85A 2EXBA 2FFYA 4IBRA 2WZXA 3H7WA 4LCMA 1MWUA 3ZFZA 4XT2B 4I39A 2Y2OA 4U0TA 1BLHA 2ZQDA 2ZC5B 3IWQA 3OBFA 4JF5A 3SOIA 1MKIA 3ZG0A 2ZM0A 1Y28A 4E3MA 1PW8A 3E4PA 4DJ3A 3HLCA 1XP4A 3M6BA 2A49A 2GX5A 2QHKA 1I2SA 1NZUA 3DTIA 1PI5A 3QP5A 4R70A 1SKOA 2WUQA 4Y17A 2NUPC 3G2ZA 3ZGAB 3A3FA 4OPYA 4G3KA 5FQMA 1AWIA 5F82A 3VV4A 5GLBA 4HY8A 2XEPA 1MC0A 4MCWA 4JGPA 3MMHA 2JCHA 4KZ7A 3HLDA 3OC2A 4GHIB 2FH5A 5HWWA 4IVKA 5CHJA 3O86A 3BFCA 1XJ4A 3G30A 2ZQAA 5I94A 4E3OA 1LHYA 1J9MA 3TRCA 2ZMAA 3G35A 4MN7A 1LI9A 1FCMA 3TJZC 2EWWA 2DNSA 4OKPA 4X68A 1HVBA 4ETXA 2W1TA 2OV5A 4NK3A 1W7FA 3EEHA 3S4XA 3UB9A 2ZOIA 3UN7A 3TE8A 4PM7A 3MFDA 3BY9A 2O99A 1TDGA 3UPPA 3G6OA 5J8XA 3T4JA 1RGYA 4FSFA 3MQOA 4L0LA 1TS0A 4R3AA 2XA7S 3CITA 4E3IA 2QMIA 5GHZA 4CLCC 4JKTA 3W8KA 2Y4AA 1K6RA 3BFEA 3RFBA 4YNRA 4GJ4A 5IS1A 2BTFP 1N9OA 3BYDA 3OZHA 4ZAMA 4FTXA 5DJTA 2PD8A 3BLMA 2V8FA 3ISGA 4FH4A 2X02A 4RX3A 1FSWA 3DTKA 3IHBA 5L2FA 3G32A 2B18A 1MBLA 1BLCA 2P08A 4HI4A 3WS4A 4GDBA 2JKTI 4QY6A 4R23A 4ID4A 1KVLA 3HBRA 2WYXA 1F98A 1RCJA 1LLBA 4B4XA 1UGUA 3TSGA 3R4KA 1JWPA 3K3DA 5EECA 3F1OB 3B33A 2I9VA 4WM9A 1PWGA 1ALQA 5FAPA 3CUEC 2JKTM 4I3AA 4M3KA 1ERQA 1ZG4A 3C30A 4R6LA 1YKDA 1FOFA 3H82B 1H8YA 1O7EA 3OOVA 5DVAA 4K08A 1FILA 1YPRA 4KQDA 3NOUC 3HJKA 1IOUA 5HFOA 2GDNA 1S4SA 4LGWA 4QWOA 1ES2A 4WELA 3W4OA 2VKSA 5EVID 2H0TA 4Y5FA 2B95A 3AGFA 3M2KA 1NWZA 4PAUA 2W3GA 2EWVA 2J3WA 1S66L 3T12B 3WS1A 4WLAA 2ZC4B 3IT9A 4CLCD 3L9KA 3V39A 1GA9A 1H0MA 4LFUA 1K4EA 3N6IA 3T4KA 1A0KA 2RCXA 3LR4A 4MDZA 5FQIA 4KENB 4N9LA 1WA9A 4Q0HA 5DF7A 1E4DA 1STZA 4LRZE 5HSQA 3UO9A 2O9CA 1D7EA 5F1GA 3S7OA 2WKRA 2QKPA 4KQQA 4WZ5C 3HREA 2Y2GA 1BTLA 1NLYA 3E4QA 4R1GA 1XA7A 3IXGA 1YQSA 4M4XA 3FPVA 4K0XA 3VSLA 3ZCZA 4OQIA 5HD3A 4GS9B 3IBJA 2WKHA 4K0WA 4WN5A 2M7UA 4BQMA 4WMCD 3E0YA 4CQHA 4CLCB 4EW7A 1Y4OA 4I3IA 4BD0A 3Q1FA 2CMNA 2JKRI 3T1RA 1L3LA 3OCLA 2IWDA 3PHYA 3VP4A 3KSHA 1YLZA 3W2ZA 2W3DA 3UDIA 4D2OA 4KZ8A 3MBZA 4MMNA 1TS7A 4E6XA 3GR2A 2J9PA 4WL9A 2JKRM 1KDWA 5DJUA 2P9VB 4Y0UA 5HAPA 5IHVA 1LL9A 4PMAA 2WGWA 4EQIA 3HJIA 1D06A 1LSXA 2WGIA 1RGZA 5DF9A 4H8RA 4ARZA 5C5KA 3BQAA 4BBVA 2DMWA 3QHYA 3MXSA 2PAVP 1VETB 2Z2MB 2PU4A 4NEED 4OLDA 5DTSA 1G6AA 2P7JA 4LRXC 4QPRA 3CPTB 4EETB 1YMXA 2HP9A 5FAQA 1E3UA 4GDNA 5FQQA 3D3OA 5CHMA 5FEFA 3CI6A 3RTYA 4BBTA 2VA0A 2IWCA 4X1LA 4EV4A 1TF1A 2D01A 2GZAA 3PBOA 4N9KA 5A91A 3CLOA 4HESA 4Z1WA 1CI8A 3FZCA 4F3LA 1EI5A 4XUXA 2Y2KA 3NIAA 3IS2B 3DBAA 3OPLA 2ZMFA 3K2NA 1G5UA 2J80A 2HV1A 3FKWA 2QJ7A 2XH9A 3LFVA 4JGRA 4G3WA 1T18A 1YMSA 4GD6A 5HZHA 1OJGA 2QZ6A 3DWZA 3PBRA 3NI9A 5KZHA 4EESA 3IH8A 3ZHHA 2Y2QA 1FR6A 4JXSA 3TOIA 5G4ZA 4HJ3A 2A2LA 4A5RA 5CERA 1YT4A 5L07A 5F1FA 3QNCA 3MXRA 3A3DA 2W3HA 3MS6A 1NYMA 3D9YA 1S4RA 1OTIA 1K6SA 2PBDP 2G2UA 3LO7A 1K54C 4R38A 3FWLA 2ZOHA 3GECA 1PIOA 4GCZA 1X0OA 5IT5A 3PBTA 3VP1A 4S2IA 5TBMB 4BBUA 2RL3A 4ZBEA 3UNWA 5J4EA 3PTEA 2KX6A 3N8LA 3HLGA 1ONGA 3WS5A 4JF4A 3PBQA 3B42A 2YKFA 2L4RA 2J7VA 4BENA 1BT5A 3EQVA 5D3OA 4HOIA 4RA7A 1K56D 3SH7A 4PKYG
chains in the Genus database with same CATH topology
3IBRA 2WKPA 2PYRA 3A0SA 3G6OA 3T4JA 4H6JB 3E4OA 4HH2A 2R78A 1H3QA 1DP8A 4FSFA 1TS6A 2V0WA 4HJ4A 1XFNA 2QJ5A 1OTBA 2PR6A 3T4OA 3MQOA 4P6ZS 4L0LA 1TS0A 4R3AA 2XA7S 3CITA 4KUOA 1LSWA 4CLCC 3F1PB 1OT6A 4HNBA 2W27A 4DN0A 2Z6DA 4ARZB 2W0NA 4I3JA 3RFBA 2O9BA 2P04A 5J3WA 4YNRA 4Q0IA 3V67A 1YAXA 4GJ4A 5IS1A 1TD5A 2A24A 2LB9A 4GS9A 1N9OA 2W1TB 5DJTA 5DKKA 4WF0A 2PD8A 3O5YA 1LSVA 1P0ZA 4CLCA 1TS8A 4PHTA 3UB7A 4B9OA 4UQIM 4O8GA 2B18A 3VE4A 1DP9A 4ZRRA 2W3FA 1GSVA 2V1AA 2P08A 4HI4A 1LL8A 1UWNX 2JKTI 3EQUA 1F5MA 3GDIA 1S1ZA 3RH8B 4LPZA 1V9ZA 4FOFA 4L9GA 4P6ZM 1F98A 5IU1A 4Y2FA 2FZ0A 3OLOA 3R7WB 1UGUA 1VHMA 3R4KA 1LT0A 2A24B 3K3DA 3F1OB 3B33A 3H7WB 5KIZA 2XROA 2I9VA 2V1BA 3ZYTA 3EOIA 4CLCE 3CUEC 2JKTM 4I3AA 3KSFA 1DRMA 3MQQA 4F3LB 2QWSA 3C30A 4R6LA 5I5LA 2OAP1 1YKDA 3T4SA 3H82B 1ODVA 4I5SA 3MF0A 1XJ6A 1OTDA 4EUVA 2GJ3A 3OOVA 1W63M 4K08A 4L9FA 4EERA 4UEYA 3T4LA 4KQDA 5L8MA 3NOUC 3S7PA 2HF6A 3KYZA 3CUEA 4EQ1A 3HJKA 5FL3A 1IOUA 1YSPA 1S4SA 1KOUA 3C2WA 3BW6A 2PDRA 3MR0A 1OT9A 2VJWA 4DMZA 3UB8A 4EEPA 3BJNA 3LIAA 3CWFA 4WELA 3NOPC 3F1NB 3T50A 2PYPA 2VKSA 4Y5FA 3UMEA 1G6OA 5HDSA 1NWZA 5HD5A 4PAUA 3EGXC 1N9LA 4ETZA 2W3GA 2EWVA 2J3TC 2J3WA 1S66L 3JVVA 1GSWA 3NOTC 3PXPA 3PYPA 5AJGA 2INWA 4OOLA 4HP4A 4WLAA 4CLCD 1XJ2A 4Q0JA 1T1BA 4XT2A 5F69A 4HHDA 2EA9A 2JN7A 5F5YA 3UMDA 2XSSA 4GW9A 1T1CA 3PBNA 2PD7A 3IS2A 3E98A 3MQ0A 4IJGA 3T4KA 3U2AA 2OWHA 5HDCA 3LR4A 2Y79A 5F6AA 4MDZA 1T1AA 3B47A 5J7EA 2M7VA 1WA9A 4Q0HA 4LLOB 1XJ3A 1DP6A 1STZA 5TJJA 4LRZE 5HSQA 5MC7A 1ZHHB 5G4YA 1NLZA 2VEAA 4IUHA 2O9CA 1D7EA 3S7OA 3P7NA 3PR6A 2WKRA 2QKPA 1F9IA 3ZQ5A 1IFQA 4AFIA 5HL6A 2B02A 5KSHA 1NLYA 3E4QA 3LYXA 4IHQA 2L0WA 4GHIA 4M4XA 4NKPA 2PT7A 1MKMA 3FPVA 2K2NA 4YOFA 2G7UA 4HH3A 5HD3A 4GLQA 4GS9B 3IBJA 4HIAA 1XFQA 4WEJA 3BY8A 4OOMA 4WN5A 2VV8A 3LIFA 5TBMA 2D02A 2M7UA 3C8CA 2MJ6A 3E0YA 5AVFA 3LR3A 4CQHA 4CLCB 3S7NA 3PBSA 2QYBA 5EFWA 3VE3A 4EW7A 4I3IA 1W63Q 4LRYC 1H8MA 5F68A 2CMNA 2JKRI 3OCLA 3PHYA 2NUTC 3KSHA 5HPIA 3JVUA 3W2ZA 2HJ9C 2VX8A 2W3DA 5HPFA 4BWIA 2JHEA 2VLGA 4MMNA 1MZUA 1N9NA 1OJ5A 1TS7A 5LBRA 3S7QA 1S67L 3LIBA 3TW8A 4WL9A 4I38A 4H6JA 2JKRM 2V0UA 4RQ9A 5DJUA 4EXOA 4KUKA 4Y3IA 2W3EA 4NXBA 1V9YA 3KYQA 4HP9A 3LUQA 4IUKA 5AVEA 5DFXA 2J3TD 2W1RA 3HJIA 3FC7A 3MFXA 1D06A 3ICYA 1LSXA 3F1PA 1GSXA 3T4TA 5DKLA 5DF9A 3VOLA 3A0RA 3BWLA 4EEUA 3KSGA 2VGLS 3FPWA 4ARZA 3OCNA 5C5KA 3BQAA 4BBVA 3KX0X 2DMWA 2OOLA 2O9AA 3EGDC 2KDKA 1JNUA 3UB6A 2K31A 4B93A 4WUJA 4WEKA 2K7SA 1G28A 4NEED 3EEAA 4DJ2A 3D72A 3BQ8A 4L9EA 4BMWA 2ZBBA 3LR5A 3HCYA 3A0VA 5HDDA 2P7JA 1EW0A 4LRXC 1VB6A 4II7A 4QPRA 3LI9A 3UE6A 4EETB 2L1MA 3C38A 4NXGA 1OTAA 4PKYA 3UE3A 5A8BA 4BJPA 3D3OA 1S1YA 3H9WA 3CI6A 1YSQA 3EWKA 3P01A 1P97A 2VV7A 2YKHA 3RTYA 4BBTA 3R7WA 3MXQA 3LIEA 2M1CA 2VGLM 2VA0A 3F1OA 2Z6CA 3H7WA 3NHQA 1TF1A 2D01A 2GZAA 3PBOA 5HWTA 5K5BA 4XT2B 3T4QA 2PHYA 4I39A 3CLOA 2KOIA 4Z1WA 3OBFA 5DFYA 3KO6A 1OPXA 4JGQA 4F3LA 4MN5A 3LIDA 3IS2B 1Y28A 3DBAA 4KQOA 3E4PA 3H82A 2ZMFA 4HQAA 4DJ3A 2VV6A 3K2NA 2BASA 2J80A 2HV1A 2GX5A 2QHKA 2QJ7A 3LFVA 3K3CA 2KLIA 2V9AA 4G3WA 4JGRA 1T18A 4NXEA 4R70A 5HZHA 1OJGA 3LICA 2NUPC 5CX7A 2XA7M 3PBRA 4G3KA 2OWJA 2PR5A 1P9RA 1ZTUA 4EESA 2O0YA 3VV4A 2OAQ1 1P9WA 4HY8A 4MN6A 5G4ZA 4HJ3A 2A2LA 1MC0A 1T19A 4MCWA 4ME4A 3F1NA 4JGPA 3MMHA 4G3VA 3OC2A 4GHIB 2FH5A 2W3HA 1S4RA 2LB5A 5HWWA 3SW1A 2GNXA 1OTIA 2H28A 3LR0A 4R38A 2XRNA 3FG8A 2WKQA 4O01A 1XJ4A 2ZOHA 3GECA 4GCZA 1X0OA 5IT5A 5HWVA 3ULFA 4HJ6A 3PBTA 2IA2A 2HGVA 5TBMB 4BBUA 3CAXA 2HJEA 3TRCA 1UWPX 3NJAA 5J4EA 2KX6A 4MN7A 3LI8A 4NXFA 4EU0A 2Y8HA 3PBQA 3B42A 2YKFA 2O99A 3TJZC 2EWWA 4O0PA 2L4RA 1BYWA 4ETXA 2W1TA 2VZWA 4E04A 1OTEA 3KSIA 3EEHA 3UB9A 3EQVA 2ZMVA 1NRJA 2ZOIA 4UQIS 4JGOA 3MJQA 4HOIA 3TE8A 4YWZA 3BY9A 4PKYG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B47 A;  3B42 A; 
#chains in the Genus database with same CATH topology
 4DDS A;  2WKP A;  1W5D A;  3RXW A;  1H3Q A;  1TS6 A;  3G34 A;  4HJ4 A;  1XFN A;  1OTB A;  3MZD A;  5EM0 A;  1ESI A;  5FDH A;  1QMF A;  4KUO A;  2ZC7 A;  5HAR A;  1LSW A;  3LY4 A;  1F2K A;  3F1P B;  1Y54 A;  4WBG A;  4HNB A;  1BSG A;  2W27 A;  2W0N A;  3P09 A;  4Q0I A;  1YAX A;  1MWR A;  4CJN A;  2LB9 A;  2W1T B;  3ZVW A;  4EBL A;  1N4O A;  4WF0 A;  3O5Y A;  1P0Z A;  1TS8 A;  4KZ6 A;  1OME A;  5FQ9 A;  1KE3 A;  3PAE A;  2HZ5 A;  4DE2 A;  1MXO A;  1DJB A;  2DRW A;  2V2F F;  3VE4 A;  1DP9 A;  4ZRR A;  1K25 A;  4Y13 A;  3CJM A;  2OLV A;  2V1A A;  2XFS A;  1K0K A;  1LL8 A;  1UWN X;  1M40 A;  4KG6 A;  3GDI A;  1U60 A;  3GTC A;  2UV0 E;  2Q9N A;  1FR1 A;  1KGG A;  4X55 A;  1YLT A;  3UE0 A;  3R7W B;  4KG5 A;  2ZL1 A;  3CHW P;  3ZNT A;  1LT0 A;  4GZB A;  2XRO A;  2V1B A;  4S2O A;  3EOI A;  3WWX A;  4KQR A;  3V50 A;  1QME A;  1MPL A;  3AGE A;  2QWS A;  4GOG A;  2Z2L B;  3C4P A;  1TVF A;  2OAP 1;  3T4S A;  3MF0 A;  1SZV A;  2Q9M A;  1RP5 A;  1XJ6 A;  1OTD A;  1CI9 A;  5FI2 A;  2GJ3 A;  5TR7 A;  4OPQ A;  4L9F A;  4EER A;  2XQZ A;  4UEY A;  2WKI A;  2HF6 A;  4EQ1 A;  4KZ3 A;  3C2W A;  3MR0 A;  1NRF A;  2JKG A;  4DMZ A;  3E2L A;  5EVE A;  3CWF A;  3F1N B;  5E2G A;  4X69 A;  2PYP A;  1PZO A;  1SHV A;  2XFT A;  1G6O A;  1AXB A;  4C3Q A;  3EGX C;  3JPU A;  2EFX A;  1Z09 A;  5EVI C;  1KE0 A;  1TDL A;  2QPN A;  3BFD A;  1MWT A;  3PXP A;  1K57 A;  2OLU A;  5TFQ A;  1T1B A;  4XT2 A;  4HHD A;  2JN7 A;  3UMD A;  3TG9 A;  2PD7 A;  3WS2 A;  3MQ0 A;  3SH9 A;  3C4O A;  3U2A A;  5A90 A;  4MBK A;  4YFM A;  1PW1 A;  5HDC A;  1HLU P;  2Y79 A;  3IX8 A;  1CF0 A;  1XKZ A;  3N8R A;  1T1A A;  1IYP A;  1DP6 A;  2HPB A;  3N4I A;  5EOE A;  3DAV A;  3WS0 A;  2XR0 A;  5MC7 A;  1ZHH B;  2VEA A;  2X01 A;  3P7N A;  3PR6 A;  5GL9 A;  5GHX A;  1IFQ A;  3DW0 A;  4ZJ1 A;  4AFI A;  5HL6 A;  1HZO A;  3IF6 C;  4GKU A;  3ZG8 B;  2L0W A;  4GHI A;  3SS5 A;  1MKM A;  2K2N A;  4YOF A;  2G7U A;  3GQZ A;  3T1X A;  4HIA A;  4OOM A;  4BL3 A;  1YM1 A;  5FI7 A;  4XXR A;  2D02 A;  4OOY A;  2ZQ7 A;  5EM1 A;  3UPO A;  3PBS A;  4QB8 A;  4DRT A;  3A3J A;  2WGV A;  4LRY C;  1MWS A;  4P0M A;  2NUT C;  2EXA A;  1M6K A;  4IED A;  1GCE A;  2JC7 A;  4DE0 A;  4N92 A;  3O87 A;  5HPF A;  2FFF B;  5HAI A;  1JWZ A;  5FA7 A;  4K91 A;  1KDS A;  1OJ5 A;  3S7Q A;  1L2S A;  3LIB A;  1L0E A;  2ZD8 A;  3BEB A;  3DTE A;  4XUZ A;  4ZDX A;  4KUK A;  2W3E A;  1V9Y A;  3KYQ A;  4HP9 A;  2Y55 A;  5DFX A;  2W1R A;  1E25 A;  5EPH A;  3FC7 A;  3MFX A;  3ICY A;  3P98 A;  1DJC A;  2WKE A;  3VFH A;  5DKL A;  3VOL A;  4EEU A;  3KSG A;  2VGL S;  3BFF A;  1SDN A;  1IKG A;  1CQA A;  3FPW A;  2OOL A;  4IBX A;  3EGD C;  2KDK A;  1E3U D;  1K55 C;  4YIN A;  4ZTK A;  2K7S A;  1ZC2 A;  3VOZ A;  3EEA A;  3LCE A;  3BQ8 A;  2VGJ A;  4X1M A;  2ZLY A;  3A3E A;  4II7 A;  4HBU A;  5FAS A;  4JF6 A;  3UE6 A;  5JYP A;  2L1M A;  3C5A A;  1OTA A;  3QP8 A;  5A8B A;  3BLS A;  5HX9 A;  1S1Y A;  3Q81 A;  1EWZ A;  3Q82 A;  1Q2Q A;  4DDY A;  3LIE A;  1WYB A;  4KZ9 A;  3GV9 A;  4OPR A;  2VGL M;  2XDM A;  4E3N A;  3F1O A;  2Z6C A;  5HWT A;  2ZM8 A;  5HL1 A;  2PHY A;  4LCL A;  3VP0 A;  3Q7V B;  5DFY A;  3KO6 A;  3ZG7 B;  5M1A A;  1BUL A;  1ES3 A;  1OPX A;  4JGQ A;  4MN5 A;  3LID A;  3HLW A;  5EVI B;  4HQA A;  3H82 A;  4R4R A;  2VV6 A;  3NDE A;  3GMW A;  1CEG A;  3IXB A;  1XGJ A;  3K3C A;  2KLI A;  2V9A A;  4RVA A;  4NXE A;  2OWJ A;  2PR5 A;  1P9R A;  1ZTU A;  3VP3 A;  5FEG A;  1CJF A;  1LL5 A;  2OAQ 1;  4QJG A;  4LEN A;  1P9W A;  4N1X A;  4MN6 A;  5CGW A;  4UA9 A;  1L0D A;  3SW1 A;  1ES5 A;  4DXB A;  2XRN A;  3ZG5 A;  2HP5 A;  1S0W A;  5HWV A;  3ULF A;  4HJ6 A;  5M19 A;  2IA2 A;  2HGV A;  5FQJ A;  1JWV A;  1VEU A;  4OLG A;  3IF6 B;  3NJA A;  3NDG A;  1CK3 A;  1J3W A;  2E8I A;  4NXF A;  2H5S A;  3SZT A;  4EU0 A;  4P6B A;  5FDS A;  3IX4 A;  4O0P A;  1XGI A;  2HDS A;  1BYW A;  4E04 A;  2WAD A;  4JGO A;  3MJQ A;  4E3L A;  4BLM A;  4KG2 A;  3IBR A;  3A0S A;  4R3J A;  4LV1 A;  4LV0 A;  4H6J B;  3E4O A;  4LV2 A;  2R78 A;  2PRF A;  3C7U A;  3T4O A;  2ZQ9 A;  2Y2I A;  1G68 A;  1OT6 A;  1SCW A;  3IWI A;  4DN0 A;  2Z6D A;  4I3J A;  2O9B A;  3IX3 A;  4PM9 A;  1IYO A;  2A24 A;  1W8Y A;  4GS9 A;  5L09 A;  3NEC A;  5U47 A;  4CLC A;  3Q7Z A;  4PHT A;  3IWO A;  3HUO A;  1C3B A;  2UWX A;  4FCF A;  1GSV A;  4CPK A;  3EQU A;  1KGE A;  1S1Z A;  5BOH A;  3RH8 B;  1V9Z A;  3HUM A;  1IEM A;  4HBT A;  2FZ0 A;  4OPZ A;  1I2W A;  4KZB A;  3OLO A;  3I7J A;  3SS4 A;  4JXG A;  2P9V A;  3H7W B;  1KE4 A;  3ZYT A;  2R9X A;  4CLC E;  3KSF A;  5TGF A;  3HL9 A;  1DRM A;  3UE1 A;  4MBH A;  4X6T A;  5I5L A;  2HDU A;  4OQ0 A;  3BFG A;  3IH9 A;  1LI0 A;  1ODV A;  4I5S A;  2Y2L A;  3HLE A;  2WZZ A;  4EUV A;  1W63 M;  3T4L A;  1PI4 A;  1VET A;  5L8M A;  3O88 A;  3S7P A;  3CUE A;  3MKF A;  2ZJ9 A;  2J8Y A;  1SKO B;  5FL3 A;  3MZF A;  4E6W A;  1KOU A;  1NYY A;  3BW6 A;  2PDR A;  1OT9 A;  4B88 A;  2VJW A;  3CZD A;  3VSK A;  3NY4 A;  4MNR A;  3CPT A;  3BJN A;  3LIA A;  4Y0O A;  3LY3 A;  1YLW A;  2EX2 A;  3UME A;  4R3B A;  5HDS A;  5HD5 A;  1TEM A;  3UY6 A;  3RXX A;  1N9L A;  4ETZ A;  2J3T C;  5FAO A;  1GSW A;  5GLD A;  3T1S A;  3PYP A;  4S2N A;  2INW A;  4C75 A;  4ESP A;  4OOL A;  4HP4 A;  1XJ2 A;  5F69 A;  1PWD A;  2EA9 A;  1GHI A;  4S2P A;  5F5Y A;  4GW9 A;  1BUE A;  1ZKJ A;  2IWB A;  3IS2 A;  4EWF A;  3E98 A;  1DY6 A;  3LEZ A;  3ITB A;  3HVF A;  3NC8 A;  5F6A A;  2M7V A;  4LLO B;  4S2J A;  3PAG A;  5TJJ A;  4UAA A;  4UA6 A;  4Z9Q A;  5G4Y A;  1NLZ A;  4IUH A;  2XD5 A;  3IXD A;  3QP1 A;  1CEF A;  1YLY A;  5CGX A;  2E8J A;  5E2H A;  2Y2M A;  4KZ5 A;  2XK1 A;  3DTM A;  4NKP A;  2PT7 A;  4LV3 A;  3G4P A;  1K4F A;  5CED A;  1DJA A;  4HH3 A;  5DTT A;  4EBN A;  2VGK A;  4WZ5 A;  1XPB A;  2P74 A;  5EOO A;  5TBM A;  4JXW A;  1ONH A;  2B5R A;  5E2E A;  2MJ6 A;  3M6H A;  3LR3 A;  5EFW A;  2H0Y A;  2QYB A;  3VE3 A;  5HAQ A;  2AVX A;  1W63 Q;  3DWK A;  5F68 A;  4Y7P A;  2Y59 A;  5KMW A;  3OPR A;  1ZG6 A;  5EV0 A;  2VX8 A;  4OP5 A;  5EE8 A;  4D60 A;  3UDX A;  1ERO A;  3UPN A;  5LBR A;  4Y0T A;  4MEZ A;  1PNE A;  3TW8 A;  5AQ9 A;  4HEF A;  3GVB A;  1IYS A;  2V0U A;  3N7W A;  4RQ9 A;  4EXO A;  4NET A;  4NXB A;  4KZA A;  1PWC A;  3LUQ A;  4MLL A;  5AVE A;  2J3T D;  4S2K A;  3F1P A;  4ZJ3 A;  3BWL A;  3RJU A;  3OCN A;  5CRF A;  3ITA A;  3KX0 X;  4U3T A;  2O9A A;  4DF6 A;  1PRQ A;  3UB6 A;  3C7V A;  4WEK A;  4B4Z A;  4L9E A;  2C5W B;  4BMW A;  3FKV A;  1GHP A;  3LR5 A;  3UDF A;  1D1J A;  3A0V A;  5HDD A;  1MY8 A;  5A92 A;  1JTG A;  5F83 A;  3LI9 A;  3GRJ A;  1SKF A;  4S2L A;  4GN2 A;  4NXG A;  4F94 A;  1HTZ A;  1FCO A;  4PKY A;  3UE3 A;  4BJP A;  1W79 A;  3H9W A;  1YSQ A;  4DE3 A;  2VV7 A;  5CEB A;  2YKH A;  3R7W A;  3MXQ A;  2JE5 A;  1K56 A;  2M1C A;  3A3I A;  3MZE A;  3NHQ A;  4RYE A;  4OON A;  5K5B A;  3T4Q A;  3T1Q B;  5GLA A;  2KOI A;  3B3X A;  3IHA A;  5DF8 A;  3ZVT A;  2Q0O A;  4KQO A;  3VMA A;  4WYY A;  5CHU A;  4PM6 A;  2BAS A;  1JTD A;  3W4P A;  2XGN A;  4JXV A;  3IF5 A;  1ACF A;  5L10 A;  3LIC A;  5CX7 A;  4C6Y A;  1NY0 A;  2XA7 M;  4PM8 A;  2V1Z A;  5M18 A;  4O7D A;  2O0Y A;  3W4Q A;  5JYO A;  2EX6 A;  1T19 A;  4ME4 A;  3F1N A;  3CG5 A;  2Y2J A;  4G3V A;  3UB5 P;  1GA0 A;  2LB5 A;  2GNX A;  3OPP A;  1SDE A;  2H28 A;  4OH0 A;  3LR0 A;  3FG8 A;  2WKQ A;  4O01 A;  3V5M A;  1N9B A;  3HLB A;  4DXC A;  3CAX A;  2HJE A;  1FCN A;  1IKI A;  1IEL A;  1UWP X;  4N1H A;  5E2F A;  3LI8 A;  2Y8H A;  1K54 A;  2HDR A;  4S2N C;  2VZW A;  1BLP A;  1OTE A;  3CMZ A;  4KZ4 A;  3KSI A;  2ZMV A;  1NRJ A;  3BRM A;  4UQI S;  1XXM A;  4YWZ A;  3NBL A;  5GHY A;  4BD1 A;  2PYR A;  4S2M A;  3VOY A;  5FI6 A;  4HH2 A;  1DP8 A;  5G18 A;  2V0W A;  2QJ5 A;  1XX2 A;  3ZDJ A;  2PR6 A;  4P6Z S;  2WGW B;  1VEU B;  3QNB A;  3SS3 A;  4ARZ B;  3V3R A;  2V8C A;  2P04 A;  5J3W A;  3V67 A;  2ZC3 B;  1TD5 A;  3G2Y A;  2ZQC A;  5DKK A;  2H10 A;  1LSV A;  2HDQ A;  4P87 A;  1PFL A;  1PYY A;  3UB7 A;  4B9O A;  4UQI M;  3VP2 A;  3Q07 A;  4O8G A;  5HW3 A;  1IYQ A;  1XA1 A;  2W3F A;  3KYE A;  3V3S A;  2ZC6 B;  5KSC A;  3HUN A;  1O07 A;  1F5M A;  4DE1 A;  3MSH A;  5CXW A;  2OSU A;  4LPZ A;  5DTK A;  5CTM A;  4FOF A;  4L9G A;  1WE4 A;  4P6Z M;  5IU1 A;  4Y2F A;  5CEC A;  3M2J A;  3WRZ A;  1HD8 A;  1W8Q A;  1VHM A;  2A24 B;  3L7H A;  4PM5 A;  5KIZ A;  3BM6 A;  4OQH A;  1ES4 A;  1ESU A;  2EX8 A;  3QP2 A;  2VK3 A;  3N8S A;  4EUZ A;  2BG1 A;  3MQQ A;  2ZM2 A;  4F3L B;  4NG2 A;  2WAF A;  2WAE A;  1H5X A;  2J9O A;  4OP8 A;  2R9W A;  2EFU A;  2WK0 A;  3LGO A;  3KYZ A;  1YSP A;  3QP4 A;  5FQK A;  2ZQ8 A;  4Y15 A;  4IVI A;  2Y2N A;  3S1Y A;  5AQ7 A;  3UB8 A;  4EEP A;  1K57 C;  1ERM A;  3NOP C;  3ZG9 B;  3T50 A;  4QHC A;  2A3U A;  2G2W A;  5GLC A;  4E3K A;  3SH8 A;  1VM1 A;  3JVV A;  3NOT C;  5AJG A;  3HLF A;  4Q0J A;  4X25 A;  5AQB A;  3U4L P;  3Q7V A;  3NCK A;  2XSS A;  2PU2 A;  2BLS A;  4X56 A;  3E2K A;  1T1C A;  4RX2 A;  3PBN A;  2JBF A;  5EVI A;  4IJG A;  1VQQ A;  4ZJ2 A;  5FAT A;  2Y91 A;  2OWH A;  1Z6F A;  4BL2 A;  4FH2 A;  3B47 A;  4OQG A;  5J7E A;  1FSY A;  1XJ3 A;  4UHU A;  3AGD A;  4QU3 A;  4QY5 A;  4GD8 A;  4OVD A;  1L0F A;  4U0X A;  2ACG A;  2X71 A;  3WRT A;  1F9I A;  1BLS A;  3ZQ5 A;  4JLF A;  4WZ4 A;  3JYI A;  5CTN A;  1NXY A;  2B02 A;  5KSH A;  4R4S A;  2EX9 A;  3LYX A;  3OPH A;  4IHQ A;  1FIK A;  1I5Q A;  2XD1 A;  3IXH A;  1WYC A;  3NUL A;  4GLQ A;  3VFF A;  1XFQ A;  1NJ4 A;  4WEJ A;  3BY8 A;  3D4F A;  2VV8 A;  3LIF A;  3C8C A;  4EBP A;  2XLN A;  3IF6 A;  5AVF A;  3S7N A;  2I72 A;  1K38 A;  2HP6 A;  1H8M A;  1JVJ A;  3IQA A;  3BEC A;  5HPI A;  3JVU A;  2HJ9 C;  4JBF A;  4X53 A;  4BWI A;  2JHE A;  2VLG A;  3O3V A;  5EVL A;  1MZU A;  1N9N A;  2PBY A;  4UA7 A;  1S67 L;  3QP6 A;  4JPM A;  4GNU A;  4WMC A;  1BZA A;  4I38 A;  4H6J A;  2Y2H A;  2DCF A;  2ZL1 B;  4MBF A;  4Y3I A;  5A93 A;  2Y2P A;  4IUK A;  5AQA A;  4DKI A;  3ZNY A;  1GSX A;  4FD8 A;  4GB7 A;  3T4T A;  3A0R A;  2CC1 A;  4PPR A;  5EUA A;  3LEQ A;  1JNU A;  4E3J A;  2K31 A;  5FSR A;  4B93 A;  4WUJ A;  1PZP A;  4FUW A;  4QD4 A;  1FQG A;  3FYZ A;  1G28 A;  2C6W B;  2V20 A;  3G31 A;  4DJ2 A;  1KVM A;  2XF3 A;  3D72 A;  3S22 A;  1S6R A;  2ZBB A;  4R0Q A;  1L0G A;  3MKE A;  5CGS A;  3HCY A;  1GHM A;  1NZO A;  1KGF A;  1EW0 A;  1VB6 A;  4Q8I A;  1Q2P A;  1YLP A;  5E43 A;  1K55 A;  3C38 A;  3GSG A;  1H8Z A;  3FV7 A;  3EWK A;  3P01 A;  1P97 A;  1YLJ A;  2JKF A;  4P85 A;  2EXB A;  2FFY A;  4IBR A;  2WZX A;  3H7W A;  4LCM A;  1MWU A;  3ZFZ A;  4XT2 B;  4I39 A;  2Y2O A;  4U0T A;  1BLH A;  2ZQD A;  2ZC5 B;  3IWQ A;  3OBF A;  4JF5 A;  3SOI A;  1MKI A;  3ZG0 A;  2ZM0 A;  1Y28 A;  4E3M A;  1PW8 A;  3E4P A;  4DJ3 A;  3HLC A;  1XP4 A;  3M6B A;  2A49 A;  2GX5 A;  2QHK A;  1I2S A;  1NZU A;  3DTI A;  1PI5 A;  3QP5 A;  4R70 A;  1SKO A;  2WUQ A;  4Y17 A;  2NUP C;  3G2Z A;  3ZGA B;  3A3F A;  4OPY A;  4G3K A;  5FQM A;  1AWI A;  5F82 A;  3VV4 A;  5GLB A;  4HY8 A;  2XEP A;  1MC0 A;  4MCW A;  4JGP A;  3MMH A;  2JCH A;  4KZ7 A;  3HLD A;  3OC2 A;  4GHI B;  2FH5 A;  5HWW A;  4IVK A;  5CHJ A;  3O86 A;  3BFC A;  1XJ4 A;  3G30 A;  2ZQA A;  5I94 A;  4E3O A;  1LHY A;  1J9M A;  3TRC A;  2ZMA A;  3G35 A;  4MN7 A;  1LI9 A;  1FCM A;  3TJZ C;  2EWW A;  2DNS A;  4OKP A;  4X68 A;  1HVB A;  4ETX A;  2W1T A;  2OV5 A;  4NK3 A;  1W7F A;  3EEH A;  3S4X A;  3UB9 A;  2ZOI A;  3UN7 A;  3TE8 A;  4PM7 A;  3MFD A;  3BY9 A;  2O99 A;  1TDG A;  3UPP A;  3G6O A;  5J8X A;  3T4J A;  1RGY A;  4FSF A;  3MQO A;  4L0L A;  1TS0 A;  4R3A A;  2XA7 S;  3CIT A;  4E3I A;  2QMI A;  5GHZ A;  4CLC C;  4JKT A;  3W8K A;  2Y4A A;  1K6R A;  3BFE A;  3RFB A;  4YNR A;  4GJ4 A;  5IS1 A;  2BTF P;  1N9O A;  3BYD A;  3OZH A;  4ZAM A;  4FTX A;  5DJT A;  2PD8 A;  3BLM A;  2V8F A;  3ISG A;  4FH4 A;  2X02 A;  4RX3 A;  1FSW A;  3DTK A;  3IHB A;  5L2F A;  3G32 A;  2B18 A;  1MBL A;  1BLC A;  2P08 A;  4HI4 A;  3WS4 A;  4GDB A;  2JKT I;  4QY6 A;  4R23 A;  4ID4 A;  1KVL A;  3HBR A;  2WYX A;  1F98 A;  1RCJ A;  1LLB A;  4B4X A;  1UGU A;  3TSG A;  3R4K A;  1JWP A;  3K3D A;  5EEC A;  3F1O B;  3B33 A;  2I9V A;  4WM9 A;  1PWG A;  1ALQ A;  5FAP A;  3CUE C;  2JKT M;  4I3A A;  4M3K A;  1ERQ A;  1ZG4 A;  3C30 A;  4R6L A;  1YKD A;  1FOF A;  3H82 B;  1H8Y A;  1O7E A;  3OOV A;  5DVA A;  4K08 A;  1FIL A;  1YPR A;  4KQD A;  3NOU C;  3HJK A;  1IOU A;  5HFO A;  2GDN A;  1S4S A;  4LGW A;  4QWO A;  1ES2 A;  4WEL A;  3W4O A;  2VKS A;  5EVI D;  2H0T A;  4Y5F A;  2B95 A;  3AGF A;  3M2K A;  1NWZ A;  4PAU A;  2W3G A;  2EWV A;  2J3W A;  1S66 L;  3T12 B;  3WS1 A;  4WLA A;  2ZC4 B;  3IT9 A;  4CLC D;  3L9K A;  3V39 A;  1GA9 A;  1H0M A;  4LFU A;  1K4E A;  3N6I A;  3T4K A;  1A0K A;  2RCX A;  3LR4 A;  4MDZ A;  5FQI A;  4KEN B;  4N9L A;  1WA9 A;  4Q0H A;  5DF7 A;  1E4D A;  1STZ A;  4LRZ E;  5HSQ A;  3UO9 A;  2O9C A;  1D7E A;  5F1G A;  3S7O A;  2WKR A;  2QKP A;  4KQQ A;  4WZ5 C;  3HRE A;  2Y2G A;  1BTL A;  1NLY A;  3E4Q A;  4R1G A;  1XA7 A;  3IXG A;  1YQS A;  4M4X A;  3FPV A;  4K0X A;  3VSL A;  3ZCZ A;  4OQI A;  5HD3 A;  4GS9 B;  3IBJ A;  2WKH A;  4K0W A;  4WN5 A;  2M7U A;  4BQM A;  4WMC D;  3E0Y A;  4CQH A;  4CLC B;  4EW7 A;  1Y4O A;  4I3I A;  4BD0 A;  3Q1F A;  2CMN A;  2JKR I;  3T1R A;  1L3L A;  3OCL A;  2IWD A;  3PHY A;  3VP4 A;  3KSH A;  1YLZ A;  3W2Z A;  2W3D A;  3UDI A;  4D2O A;  4KZ8 A;  3MBZ A;  4MMN A;  1TS7 A;  4E6X A;  3GR2 A;  2J9P A;  4WL9 A;  2JKR M;  1KDW A;  5DJU A;  2P9V B;  4Y0U A;  5HAP A;  5IHV A;  1LL9 A;  4PMA A;  2WGW A;  4EQI A;  3HJI A;  1D06 A;  1LSX A;  2WGI A;  1RGZ A;  5DF9 A;  4H8R A;  4ARZ A;  5C5K A;  3BQA A;  4BBV A;  2DMW A;  3QHY A;  3MXS A;  2PAV P;  1VET B;  2Z2M B;  2PU4 A;  4NEE D;  4OLD A;  5DTS A;  1G6A A;  2P7J A;  4LRX C;  4QPR A;  3CPT B;  4EET B;  1YMX A;  2HP9 A;  5FAQ A;  1E3U A;  4GDN A;  5FQQ A;  3D3O A;  5CHM A;  5FEF A;  3CI6 A;  3RTY A;  4BBT A;  2VA0 A;  2IWC A;  4X1L A;  4EV4 A;  1TF1 A;  2D01 A;  2GZA A;  3PBO A;  4N9K A;  5A91 A;  3CLO A;  4HES A;  4Z1W A;  1CI8 A;  3FZC A;  4F3L A;  1EI5 A;  4XUX A;  2Y2K A;  3NIA A;  3IS2 B;  3DBA A;  3OPL A;  2ZMF A;  3K2N A;  1G5U A;  2J80 A;  2HV1 A;  3FKW A;  2QJ7 A;  2XH9 A;  3LFV A;  4JGR A;  4G3W A;  1T18 A;  1YMS A;  4GD6 A;  5HZH A;  1OJG A;  2QZ6 A;  3DWZ A;  3PBR A;  3NI9 A;  5KZH A;  4EES A;  3IH8 A;  3ZHH A;  2Y2Q A;  1FR6 A;  4JXS A;  3TOI A;  5G4Z A;  4HJ3 A;  2A2L A;  4A5R A;  5CER A;  1YT4 A;  5L07 A;  5F1F A;  3QNC A;  3MXR A;  3A3D A;  2W3H A;  3MS6 A;  1NYM A;  3D9Y A;  1S4R A;  1OTI A;  1K6S A;  2PBD P;  2G2U A;  3LO7 A;  1K54 C;  4R38 A;  3FWL A;  2ZOH A;  3GEC A;  1PIO A;  4GCZ A;  1X0O A;  5IT5 A;  3PBT A;  3VP1 A;  4S2I A;  5TBM B;  4BBU A;  2RL3 A;  4ZBE A;  3UNW A;  5J4E A;  3PTE A;  2KX6 A;  3N8L A;  3HLG A;  1ONG A;  3WS5 A;  4JF4 A;  3PBQ A;  3B42 A;  2YKF A;  2L4R A;  2J7V A;  4BEN A;  1BT5 A;  3EQV A;  5D3O A;  4HOI A;  4RA7 A;  1K56 D;  3SH7 A;  4PKY G; 
#chains in the Genus database with same CATH homology
 3IBR A;  2WKP A;  2PYR A;  3A0S A;  3G6O A;  3T4J A;  4H6J B;  3E4O A;  4HH2 A;  2R78 A;  1H3Q A;  1DP8 A;  4FSF A;  1TS6 A;  2V0W A;  4HJ4 A;  1XFN A;  2QJ5 A;  1OTB A;  2PR6 A;  3T4O A;  3MQO A;  4P6Z S;  4L0L A;  1TS0 A;  4R3A A;  2XA7 S;  3CIT A;  4KUO A;  1LSW A;  4CLC C;  3F1P B;  1OT6 A;  4HNB A;  2W27 A;  4DN0 A;  2Z6D A;  4ARZ B;  2W0N A;  4I3J A;  3RFB A;  2O9B A;  2P04 A;  5J3W A;  4YNR A;  4Q0I A;  3V67 A;  1YAX A;  4GJ4 A;  5IS1 A;  1TD5 A;  2A24 A;  2LB9 A;  4GS9 A;  1N9O A;  2W1T B;  5DJT A;  5DKK A;  4WF0 A;  2PD8 A;  3O5Y A;  1LSV A;  1P0Z A;  4CLC A;  1TS8 A;  4PHT A;  3UB7 A;  4B9O A;  4UQI M;  4O8G A;  2B18 A;  3VE4 A;  1DP9 A;  4ZRR A;  2W3F A;  1GSV A;  2V1A A;  2P08 A;  4HI4 A;  1LL8 A;  1UWN X;  2JKT I;  3EQU A;  1F5M A;  3GDI A;  1S1Z A;  3RH8 B;  4LPZ A;  1V9Z A;  4FOF A;  4L9G A;  4P6Z M;  1F98 A;  5IU1 A;  4Y2F A;  2FZ0 A;  3OLO A;  3R7W B;  1UGU A;  1VHM A;  3R4K A;  1LT0 A;  2A24 B;  3K3D A;  3F1O B;  3B33 A;  3H7W B;  5KIZ A;  2XRO A;  2I9V A;  2V1B A;  3ZYT A;  3EOI A;  4CLC E;  3CUE C;  2JKT M;  4I3A A;  3KSF A;  1DRM A;  3MQQ A;  4F3L B;  2QWS A;  3C30 A;  4R6L A;  5I5L A;  2OAP 1;  1YKD A;  3T4S A;  3H82 B;  1ODV A;  4I5S A;  3MF0 A;  1XJ6 A;  1OTD A;  4EUV A;  2GJ3 A;  3OOV A;  1W63 M;  4K08 A;  4L9F A;  4EER A;  4UEY A;  3T4L A;  4KQD A;  5L8M A;  3NOU C;  3S7P A;  2HF6 A;  3KYZ A;  3CUE A;  4EQ1 A;  3HJK A;  5FL3 A;  1IOU A;  1YSP A;  1S4S A;  1KOU A;  3C2W A;  3BW6 A;  2PDR A;  3MR0 A;  1OT9 A;  2VJW A;  4DMZ A;  3UB8 A;  4EEP A;  3BJN A;  3LIA A;  3CWF A;  4WEL A;  3NOP C;  3F1N B;  3T50 A;  2PYP A;  2VKS A;  4Y5F A;  3UME A;  1G6O A;  5HDS A;  1NWZ A;  5HD5 A;  4PAU A;  3EGX C;  1N9L A;  4ETZ A;  2W3G A;  2EWV A;  2J3T C;  2J3W A;  1S66 L;  3JVV A;  1GSW A;  3NOT C;  3PXP A;  3PYP A;  5AJG A;  2INW A;  4OOL A;  4HP4 A;  4WLA A;  4CLC D;  1XJ2 A;  4Q0J A;  1T1B A;  4XT2 A;  5F69 A;  4HHD A;  2EA9 A;  2JN7 A;  5F5Y A;  3UMD A;  2XSS A;  4GW9 A;  1T1C A;  3PBN A;  2PD7 A;  3IS2 A;  3E98 A;  3MQ0 A;  4IJG A;  3T4K A;  3U2A A;  2OWH A;  5HDC A;  3LR4 A;  2Y79 A;  5F6A A;  4MDZ A;  1T1A A;  3B47 A;  5J7E A;  2M7V A;  1WA9 A;  4Q0H A;  4LLO B;  1XJ3 A;  1DP6 A;  1STZ A;  5TJJ A;  4LRZ E;  5HSQ A;  5MC7 A;  1ZHH B;  5G4Y A;  1NLZ A;  2VEA A;  4IUH A;  2O9C A;  1D7E A;  3S7O A;  3P7N A;  3PR6 A;  2WKR A;  2QKP A;  1F9I A;  3ZQ5 A;  1IFQ A;  4AFI A;  5HL6 A;  2B02 A;  5KSH A;  1NLY A;  3E4Q A;  3LYX A;  4IHQ A;  2L0W A;  4GHI A;  4M4X A;  4NKP A;  2PT7 A;  1MKM A;  3FPV A;  2K2N A;  4YOF A;  2G7U A;  4HH3 A;  5HD3 A;  4GLQ A;  4GS9 B;  3IBJ A;  4HIA A;  1XFQ A;  4WEJ A;  3BY8 A;  4OOM A;  4WN5 A;  2VV8 A;  3LIF A;  5TBM A;  2D02 A;  2M7U A;  3C8C A;  2MJ6 A;  3E0Y A;  5AVF A;  3LR3 A;  4CQH A;  4CLC B;  3S7N A;  3PBS A;  2QYB A;  5EFW A;  3VE3 A;  4EW7 A;  4I3I A;  1W63 Q;  4LRY C;  1H8M A;  5F68 A;  2CMN A;  2JKR I;  3OCL A;  3PHY A;  2NUT C;  3KSH A;  5HPI A;  3JVU A;  3W2Z A;  2HJ9 C;  2VX8 A;  2W3D A;  5HPF A;  4BWI A;  2JHE A;  2VLG A;  4MMN A;  1MZU A;  1N9N A;  1OJ5 A;  1TS7 A;  5LBR A;  3S7Q A;  1S67 L;  3LIB A;  3TW8 A;  4WL9 A;  4I38 A;  4H6J A;  2JKR M;  2V0U A;  4RQ9 A;  5DJU A;  4EXO A;  4KUK A;  4Y3I A;  2W3E A;  4NXB A;  1V9Y A;  3KYQ A;  4HP9 A;  3LUQ A;  4IUK A;  5AVE A;  5DFX A;  2J3T D;  2W1R A;  3HJI A;  3FC7 A;  3MFX A;  1D06 A;  3ICY A;  1LSX A;  3F1P A;  1GSX A;  3T4T A;  5DKL A;  5DF9 A;  3VOL A;  3A0R A;  3BWL A;  4EEU A;  3KSG A;  2VGL S;  3FPW A;  4ARZ A;  3OCN A;  5C5K A;  3BQA A;  4BBV A;  3KX0 X;  2DMW A;  2OOL A;  2O9A A;  3EGD C;  2KDK A;  1JNU A;  3UB6 A;  2K31 A;  4B93 A;  4WUJ A;  4WEK A;  2K7S A;  1G28 A;  4NEE D;  3EEA A;  4DJ2 A;  3D72 A;  3BQ8 A;  4L9E A;  4BMW A;  2ZBB A;  3LR5 A;  3HCY A;  3A0V A;  5HDD A;  2P7J A;  1EW0 A;  4LRX C;  1VB6 A;  4II7 A;  4QPR A;  3LI9 A;  3UE6 A;  4EET B;  2L1M A;  3C38 A;  4NXG A;  1OTA A;  4PKY A;  3UE3 A;  5A8B A;  4BJP A;  3D3O A;  1S1Y A;  3H9W A;  3CI6 A;  1YSQ A;  3EWK A;  3P01 A;  1P97 A;  2VV7 A;  2YKH A;  3RTY A;  4BBT A;  3R7W A;  3MXQ A;  3LIE A;  2M1C A;  2VGL M;  2VA0 A;  3F1O A;  2Z6C A;  3H7W A;  3NHQ A;  1TF1 A;  2D01 A;  2GZA A;  3PBO A;  5HWT A;  5K5B A;  4XT2 B;  3T4Q A;  2PHY A;  4I39 A;  3CLO A;  2KOI A;  4Z1W A;  3OBF A;  5DFY A;  3KO6 A;  1OPX A;  4JGQ A;  4F3L A;  4MN5 A;  3LID A;  3IS2 B;  1Y28 A;  3DBA A;  4KQO A;  3E4P A;  3H82 A;  2ZMF A;  4HQA A;  4DJ3 A;  2VV6 A;  3K2N A;  2BAS A;  2J80 A;  2HV1 A;  2GX5 A;  2QHK A;  2QJ7 A;  3LFV A;  3K3C A;  2KLI A;  2V9A A;  4G3W A;  4JGR A;  1T18 A;  4NXE A;  4R70 A;  5HZH A;  1OJG A;  3LIC A;  2NUP C;  5CX7 A;  2XA7 M;  3PBR A;  4G3K A;  2OWJ A;  2PR5 A;  1P9R A;  1ZTU A;  4EES A;  2O0Y A;  3VV4 A;  2OAQ 1;  1P9W A;  4HY8 A;  4MN6 A;  5G4Z A;  4HJ3 A;  2A2L A;  1MC0 A;  1T19 A;  4MCW A;  4ME4 A;  3F1N A;  4JGP A;  3MMH A;  4G3V A;  3OC2 A;  4GHI B;  2FH5 A;  2W3H A;  1S4R A;  2LB5 A;  5HWW A;  3SW1 A;  2GNX A;  1OTI A;  2H28 A;  3LR0 A;  4R38 A;  2XRN A;  3FG8 A;  2WKQ A;  4O01 A;  1XJ4 A;  2ZOH A;  3GEC A;  4GCZ A;  1X0O A;  5IT5 A;  5HWV A;  3ULF A;  4HJ6 A;  3PBT A;  2IA2 A;  2HGV A;  5TBM B;  4BBU A;  3CAX A;  2HJE A;  3TRC A;  1UWP X;  3NJA A;  5J4E A;  2KX6 A;  4MN7 A;  3LI8 A;  4NXF A;  4EU0 A;  2Y8H A;  3PBQ A;  3B42 A;  2YKF A;  2O99 A;  3TJZ C;  2EWW A;  4O0P A;  2L4R A;  1BYW A;  4ETX A;  2W1T A;  2VZW A;  4E04 A;  1OTE A;  3KSI A;  3EEH A;  3UB9 A;  3EQV A;  2ZMV A;  1NRJ A;  2ZOI A;  4UQI S;  4JGO A;  3MJQ A;  4HOI A;  3TE8 A;  4YWZ A;  3BY9 A;  4PKY G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...