3B42A

Periplasmic sensor domain of chemotaxis protein gsu0935
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
SSLDLQLKNARNLAGLIIHDIDGYMMKGDSSEVDRFISAVKSKNFIMDLRVFDEQAKEVSPTPSQTPNAKIQQAIAAGRTLEFKETLDGKRTLSLVLPFPNEQRCQSCHDAGAAYLGGLLVTTSIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures and solution properties of two novel periplasmic sensor domains with c-type heme from chemotaxis proteins of Geobacter sulfurreducens: implications for signal transduction.
pubmed doi rcsb
source organism Geobacter sulfurreducens
molecule tags Signaling protein
molecule keywords Methyl-accepting chemotaxis protein, putative
total genus 33
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.290 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3b42A00
3B42A 3B47A
chains in the Genus database with same CATH superfamily
4IUHA 3B33A 3DW0A 3WWXA 3HREA 3CHWP 3IS2B 3IS2A 3HCYA 2WGWA 4Y15A 3RH8B 3F1NA 1XFNA 4JBFA 1LI0A 2Y8HA 4KZ4A 3NBLA 4DXCA 3S7PA 4K08A 3ZYTA 2XROA 2QWSA 4HEFA 4X6TA 1N9OA 1G5UA 2FFYA 3ZG0A 5HZHA 2YKHA 1IYQA 1PFLA 4BQMA 1PZOA 1UWPX 2XD1A 3C5AA 3IF6A 2G2WA 2ZOIA 2QKPA 4WZ5A 3P98A 3VP1A 5DFXA 3UE3A 4LFUA 4IVIA 4B9OA 4GHIA 1NY0A 4L9GA 3UO9A 3IWOA 3IXBA 5L07A 3ITBA 4X56A 4DRTA 4R0QA 2ZBBA 2Y2KA 2RCXA 4HI4A 1SDEA 5C5KA 4EESA 1K0KA 3ICYA 5A91A 1SKOA 3NJAA 3MJQA 4LENA 2JN7A 4YFMA 4RVAA 1PI5A 1WYCA 4OQHA 1CJFA 3VOZA 2C6WB 2HPBA 5EPHA 3E2KA 2K31A 4OPZA 3VFHA 2VGJA 1DJBA 2B18A 2WKIA 4PM5A 3OC2A 1NZUA 3F1OB 1RGZA 2W3FA 2XF3A 3V39A 2CMNA 4AFIA 3IWQA 2JC7A 4MN6A 5HL6A 1ONGA 4N1HA 4OQIA 3MQ0A 5MC7A 1GSXA 1JWZA 1VHMA 3FC7A 4NXGA 5CEDA 1TDLA 4JXVA 1TEMA 3QP5A 5DTKA 3IWIA 2KDKA 2Z6DA 2V0UA 3C2WA 4EERA 1MWUA 2ZL1A 3CUEA 3ZHHA 1V9YA 2EX2A 4GW9A 2DCFA 2A49A 3GDIA 4HNBA 4E3NA 2PBYA 1F2KA 2VK3A 3S4XA 3GQZA 3N6IA 1TD5A 1S4SA 3P7NA 4P6ZM 4MBFA 4M3KA 3VP3A 1S6RA 5EVIB 1I5QA 2R78A 3AGFA 2ZMFA 1QMFA 3ITAA 2O9CA 1SDNA 1CI9A 3IHAA 5EFWA 3E98A 4GD8A 1RGYA 3T4LA 2A3UA 4KENB 1K6RA 2P08A 4HJ3A 3C7UA 1DJAA 4LRZE 4UAAA 1XFQA 4LCMA 1S67L 1ZG6A 5HD5A 1K56D 4H6JB 4LGWA 3BY9A 1SKOB 4FD8A 1T19A 1YPRA 4PMAA 3T4TA 2AVXA 3BWLA 3R7WA 2J7VA 5L8MA 2JHEA 3IF6C 3RJUA 3T50A 1YLZA 1E3UA 3RTYA 3JVVA 4S2NC 1S1ZA 2W1TA 2HP5A 2A2LA 2YKFA 1ZHHB 2RL3A 2PU2A 1LLBA 3CZDA 3W4QA 4E3KA 4E3LA 5F1GA 5FEFA 4OH0A 1OTDA 2C5WB 4MLLA 1MXOA 4PM6A 3FWLA 2H0YA 3MZFA 1YLTA 1YMXA 4BLMA 2Y2MA 4B4ZA 2UWXA 3HBRA 4D60A 3UPNA 1W8QA 3ZVWA 4X1LA 5A93A 4FOFA 2BLSA 1KDSA 1KGFA 1T1CA 4OQGA 4O8GA 3HLEA 3WS5A 4YINA 5HWTA 5JYOA 2V1BA 2ZMAA 3PXPA 2Y2PA 4DJ3A 1H5XA 5DKKA 1N4OA 3NOPC 4GS9B 1TF1A 4UA6A 4JGRA 5EVID 4PAUA 3DBAA 3SH7A 3ZG7B 1YMSA 5IHVA 3UDIA 3ZCZA 4HBTA 5GLAA 4XT2B 2VX8A 2EFUA 3CJMA 2ZLYA 3HVFA 2GDNA 3ISGA 1Y54A 2Y2NA 3BECA 4PM9A 4Y7PA 1J9MA 5IU1A 3UB9A 4YWZA 4IBXA 1GHPA 2ZQAA 2VKSA 4YNRA 1VETA 3N7WA 3IH8A 4F94A 2DNSA 4MDZA 4BENA 3L9KA 4XXRA 3EGDC 4OONA 2J3WA 1N9BA 1MBLA 4BBTA 3SH9A 1K54C 4FUWA 1DY6A 5G18A 1KVMA 4MMNA 1PW8A 5CXWA 5HFOA 4DE2A 1FQGA 1S1YA 5GLBA 2P9VA 5L2FA 2HV1A 4CLCC 1CQAA 2PHYA 3LEQA 3IBJA 3DTMA 5CERA 1OJGA 4Y0UA 5J7EA 4D2OA 5E2EA 2HP9A 3CPTA 5DVAA 3FG8A 1MZUA 2QHKA 4PKYA 2PAVP 1YQSA 2IWBA 4KG5A 5E2HA 4RQ9A 1XJ4A 3NC8A 4OQ0A 4DE3A 1T1AA 2PT7A 1YM1A 1Z09A 2M7UA 3GTCA 4GN2A 5HDDA 3MS6A 2PD8A 2QPNA 2Y59A 1SKFA 3GECA 4UA7A 5FAPA 4R3JA 2L4RA 3S1YA 5E2GA 2JKTM 3E2LA 4O01A 3LO7A 4OP8A 3MXRA 5AVFA 3UE1A 2WGVA 1VETB 3KO6A 2JCHA 4N1XA 5FSRA 3DWKA 2ZM2A 3UN7A 3RXXA 2I72A 1L0EA 1XJ3A 3T1QB 4MEZA 1JVJA 3HJKA 2ZC3B 3G32A 3U4LP 4RX2A 2Y4AA 1J3WA 1KGGA 2E8JA 4GB7A 1A0KA 1S4RA 4ZTKA 1BSGA 3D9YA 4WEJA 3VSLA 3UB8A 4PHTA 4GOGA 2Y2QA 3VE3A 1Y4OA 2Q9MA 4LLOB 3UNWA 4OPQA 1WA9A 2GJ3A 3IX3A 2DMWA 5M19A 4YOFA 1MWSA 3QP1A 5G4YA 3DTIA 2JKRM 4DXBA 3MFXA 2VV8A 2ZL1B 3F1NB 2M1CA 1RCJA 1ZC2A 5FQKA 4NXFA 2J9PA 3IX8A 1G6OA 4FTXA 3T4OA 3IX4A 3P01A 3ULFA 4K0XA 3QP6A 5D3OA 4MN5A 1HLUP 3TG9A 4CLCB 4CPKA 1Q2QA 4IBRA 3DTEA 1SHVA 4L0LA 3PHYA 2GX5A 3LIEA 4IEDA 1XX2A 1H8MA 3CLOA 4R23A 2EXBA 3JPUA 2XFSA 2V1AA 3WS2A 4XUZA 2Y2GA 2P74A 3T4KA 1O07A 2PR5A 4WLAA 1FCNA 4MBHA 3ZG9B 1UGUA 4DKIA 3GSGA 4FSFA 1L0DA 3ZQ5A 3IF5A 3N8SA 4WMCD 4GDNA 4NXBA 3TE8A 3FZCA 1BLSA 3UPOA 5FQIA 5HSQA 2P04A 1BYWA 3MFDA 5CECA 3BFEA 4WL9A 3WS4A 4I3AA 1W5DA 3H82A 5CGXA 4KZ5A 1TS6A 4OOYA 4MNRA 4Y0OA 2V20A 3OOVA 3ZGAB 2A24A 2K7SA 1JNUA 1XGIA 5AQ7A 3T1SA 3MSHA 5DF7A 4I3IA 4L9FA 5FI7A 1XP4A 3BFFA 4CJNA 3MF0A 3OCLA 4QPRA 2IA2A 2H28A 2EWVA 2OOLA 2VEAA 1KOUA 2QZ6A 1KE0A 3LR3A 4ETZA 3A3FA 3CMZA 5EVEA 2O9BA 3MKFA 3HLWA 3A0RA 5CHUA 2Q9NA 5HD3A 1IFQA 3UPPA 1XGJA 1MWTA 1BLHA 3SS3A 2JKFA 3LIAA 1T18A 2XLNA 3OBFA 5DTSA 1IKGA 2V2FF 2ZOHA 4S2NA 3HLGA 1HVBA 1L2SA 4G3KA 4LRXC 5GHYA 4O0PA 1OT6A 1NYYA 3LICA 1HTZA 2WGIA 1S0WA 5FA7A 3H82B 4IVKA 2HDQA 1JTDA 4QD4A 5FQQA 4R3BA 2W1TB 4KQRA 1STZA 2NUPC 5AVEA 2ZM8A 1ZTUA 1GSVA 3KSGA 4P87A 2UV0E 3T1XA 2X02A 3S22A 2WUQA 2CC1A 2XA7S 2G2UA 1KE4A 1D7EA 4B93A 4BBVA 5EUAA 3R7WB 3P09A 2JKRI 3UY6A 1W63Q 4C3QA 4HESA 1C3BA 4GHIB 1FSYA 2J80A 3AGDA 1K25A 1MY8A 3T4SA 3M6HA 2XDMA 4KG2A 4JGQA 2ZD8A 4XT2A 3VOLA 1CK3A 1BTLA 4Q0JA 3SW1A 1GA0A 1E3UD 2WKRA 1ODVA 2FZ0A 4IHQA 3VMAA 2ZC4B 1CEFA 1K56A 4LRYC 4HJ4A 3UE0A 3G30A 2BASA 2Z2LB 5HDCA 5F6AA 2Y2OA 2G7UA 1GA9A 3LI8A 5E43A 4G3VA 2WKPA 3F1PA 2WAEA 1LL5A 2OWJA 2JBFA 2Y2IA 2PDRA 2HJEA 1XA7A 4EW7A 2D01A 2EX8A 4P0MA 4OOLA 2H10A 3A3IA 1KDWA 5F82A 2QYBA 3IQAA 2XR0A 3V3SA 4EUZA 3C30A 2VLGA 3BLSA 4EETB 5E2FA 3IH9A 3F1PB 1DP8A 1P9WA 4BJPA 4X69A 1TS8A 1I2SA 1NXYA 3IHBA 2ZC6B 3N4IA 4OVDA 2OAQ1 4M4XA 4HHDA 4IJGA 4OP5A 4I38A 1H8YA 2WZXA 3K3CA 4R4RA 4Q0HA 1U60A 2B02A 1NLZA 4GDBA 4PKYG 1H8ZA 3MKEA 3VP4A 1W63M 5FI6A 4LV0A 1NZOA 2QMIA 2P7JA 2VV6A 1FOFA 3BEBA 4GS9A 1K55A 2Y2LA 1LHYA 3Q1FA 5TBMB 4HJ6A 1DP6A 5I5LA 4LV3A 1LSWA 2KOIA 3T12B 2V1ZA 3ZG8B 3Q81A 4LPZA 1NJ4A 1W79A 1K57C 4WZ5C 4Q0IA 4BD0A 2IWCA 3G4PA 4OLGA 4LCLA 4Z9QA 4WZ4A 1BULA 4QU3A 1XJ6A 1IEMA 1TS0A 4S2JA 4R38A 4CQHA 5FL3A 2EWWA 1P0ZA 2EX6A 1IYPA 5EVIA 3W4OA 3HLBA 5GLCA 4CLCD 1LSXA 4EBPA 3A0VA 3PYPA 1DP9A 5FQMA 3PAGA 2XH9A 5CTMA 3OPRA 2X71A 4E6XA 4GLQA 2VJWA 2OV5A 3NI9A 1VQQA 4X53A 5EM0A 2Y2JA 1NRFA 3D72A 4A5RA 3S7NA 3U2AA 2LB9A 5AQAA 3SOIA 3IBRA 2H0TA 3G35A 1E4DA 3ZNTA 3PTEA 3SH8A 4GZBA 2WKHA 3Q7VB 1PYYA 3VFFA 5DF8A 1K38A 2M7VA 4X1MA 3M2JA 1GHMA 1YLWA 4R6LA 1NRJA 1TVFA 3N8RA 2ACGA 2W3DA 4WM9A 1HD8A 4BL3A 4S2LA 4ARZB 1FSWA 4JXWA 4S2KA 2EFXA 3ZNYA 2XQZA 2XGNA 3BFDA 4KQOA 4X68A 4E3MA 4U0XA 3LR0A 1IKIA 3ZG5A 1VM1A 1FCOA 3HJIA 4KZBA 1K4FA 2ZQDA 3LFVA 4FCFA 1ACFA 4JF4A 3KYZA 1Z6FA 5KSCA 5EOOA 1KVLA 5CEBA 4CLCE 5EOEA 5KMWA 1ERQA 1OTAA 4DF6A 1SCWA 5KSHA 1PWGA 3HUNA 2OSUA 4JF6A 4P6BA 5G4ZA 3H7WA 3MQOA 3OPPA 3QP4A 4F3LB 2XEPA 3CI6A 2LB5A 3LUQA 1ESUA 2Z2MB 4OPRA 4EBNA 1VEUA 2OLUA 3GVBA 1OT9A 3MQQA 2QJ7A 2J8YA 1K55C 4QJGA 2Q0OA 4X55A 3C4PA 3HUMA 4P6ZS 4E3IA 4BMWA 4NKPA 1ES5A 2VGLS 3OPLA 3L7HA 4BD1A 4P85A 1IELA 1EWZA 1IYOA 1QMEA 3C38A 2P9VB 4ZDXA 4WELA 3HLDA 4ZJ3A 1ZG4A 3UB7A 3A3DA 4PM8A 1YLPA 4FH4A 4JPMA 4Y0TA 2HZ5A 3NECA 4R70A 5F5YA 3LR5A 3F1OA 4S2MA 5BOHA 2WAFA 3EGXC 1N9NA 4EU0A 2XK1A 4DMZA 1NWZA 1EROA 1BT5A 3NY4A 3QNBA 5CTNA 3FPVA 4I39A 3QP2A 4KZ3A 2O99A 5HPIA 4MBKA 3LIFA 1LL8A 4WYYA 3Q07A 4K0WA 4EXOA 2INWA 3Q7VA 3V67A 1OTIA 2XA7M 3T1RA 2PYPA 4KUOA 3OPHA 3LEZA 1F9IA 4KZ8A 2WKQA 1K57A 5HWVA 1PWCA 1YSPA 2HGVA 1K4EA 1W7FA 4WBGA 1BLCA 3QP8A 1NLYA 1GCEA 2PBDP 3TW8A 1ZKJA 4E3OA 3ZDJA 3FV7A 3JVUA 5CHJA 5FDSA 1G68A 4GJ4A 3H9WA 3UMDA 3FYZA 3ZVTA 5FEGA 1YLYA 2ZC7A 1GSWA 1YT4A 3A0SA 3NDEA 2J9OA 2Y55A 5TBMA 2MJ6A 4NETA 3M6BA 4OPYA 4WMCA 1DJCA 3MZEA 5FASA 4NK3A 5IT5A 3S7QA 3NIAA 1KE3A 5DJTA 4RA7A 5CGWA 5HWWA 3OLOA 3GRJA 4U0TA 2WK0A 4X25A 4Y17A 1PNEA 1EI5A 3BM6A 2Y79A 4I5SA 1G28A 1RP5A 5HARA 2V8CA 3RXWA 2JKTI 2JKGA 3KSIA 5HL1A 1H0MA 1XPBA 4E04A 2J3TD 3SZTA 4K91A 2ZQ8A 2ZQCA 1CI8A 4CLCA 1DRMA 1XJ2A 1L0FA 4LV1A 3CG5A 4QY6A 1VEUB 1K6SA 1YAXA 3VE4A 3OCNA 5A92A 4ZBEA 3GMWA 3O3VA 5L09A 4DJ2A 4RX3A 1FIKA 3FKVA 3N8LA 3PBSA 3A3JA 4GCZA 4XUXA 4JKTA 3LY4A 4ESPA 2X01A 1XA1A 3KX0X 5FAQA 1OTBA 4PPRA 2HDUA 3B47A 3W4PA 3SS5A 4C6YA 3CITA 5U47A 4ZJ1A 3V50A 5AQ9A 3VP2A 3DWZA 2ZM0A 3HLCA 4Y5FA 1JWPA 2W3EA 3IXDA 3DTKA 2O9AA 3B42A 3D4FA 1ONHA 1PIOA 3BQ8A 4HP9A 2W0NA 3SS4A 3T4QA 2VZWA 4B4XA 5HAIA 1CF0A 3MBZA 3PAEA 3W2ZA 4RYEA 3A3EA 3GV9A 2XSSA 4DDYA 3KSFA 4ME4A 2KLIA 5HPFA 2D02A 1Y28A 1ES3A 3ZFZA 2VGLM 3G2YA 5FQJA 2EXAA 5FATA 3HLFA 1IOUA 3TSGA 3UB6A 2NUTC 1G6AA 3CUEC 3CWFA 5FQ9A 5KZHA 3VV4A 4WF0A 3EEAA 3KSHA 3NOUC 4UA9A 1MWRA 3BFGA 1D1JA 2PR6A 2IWDA 3AGEA 4B88A 2BTFP 5F69A 5L10A 1PW1A 1HZOA 2K2NA 4KUKA 5CRFA 1P9RA 1V9ZA 3BJNA 4EEPA 3G34A 3E4PA 1BUEA 3Q82A 3D3OA 4UEYA 1WE4A 1M40A 3VP0A 4ID4A 1TDGA 3PBNA 1F5MA 1JTGA 5F83A 2KX6A 2ZQ7A 3EQUA 3WS0A 4E3JA 5HDSA 5DKLA 4HIAA 4Z1WA 4II7A 1YKDA 4U3TA 1N9LA 1W8YA 4BL2A 3C4OA 4FH2A 3QHYA 5GLDA 3LR4A 4EQIA 4UHUA 1MKMA 3C7VA 2HJ9C 3B3XA 3K2NA 2PYRA 4GKUA 3IXGA 2H5SA 3JYIA 4LV2A 1T1BA 3TJZC 1OJ5A 1PZPA 3OZHA 4QY5A 4JXGA 1JWVA 4HQAA 2ZQ9A 5A8BA 2XD5A 3MR0A 3V5MA 1AWIA 3BFCA 1OPXA 3PBRA 3EEHA 2Y2HA 3KYQA 5GL9A 5GHXA 5IS1A 3RFBA 1E25A 3IF6B 1FR6A 5J8XA 3C8CA 1H3QA 5CX7A 5FDHA 4ZJ2A 3BW6A 2HDRA 5EVLA 3G2ZA 5HAQA 5TFQA 5GHZA 4WEKA 4S2OA 3WS1A 1L3LA 4G3WA 4EEUA 2W27A 3FPWA 2VV7A 2W3HA 3UDFA 4Q8IA 1ES2A 1ALQA 2OLVA 2J3TC 3T4JA 4EV4A 4ARZA 2B95A 1BZAA 3V3RA 4KZ6A 3LYXA 3MMHA 4NEED 2W3GA 1K54A 2WGWB 4HBUA 3MZDA 4JF5A 2WKEA 3VSKA 4BBUA 1ERMA 2EX9A 4EBLA 4N9LA 2XFTA 1I2WA 1X0OA 5JYPA 4C75A 3PBQA 1PI4A 4R1GA 3DAVA 4BWIA 5AJGA 1ESIA 4KZAA 4JLFA 4EUVA 4R4SA 4E6WA 2I9VA 2HDSA 2XRNA 3VOYA 1IYSA 4HY8A 4OKPA 1EW0A 3I7JA 1XKZA 3UDXA 1AXBA 3K3DA 5DJUA 1S66L 3WRZA 2Z6CA 3E4QA 5M1AA 4H6JA 4I3JA 1YLJA 4NG2A 4HH3A 2PRFA 2PD7A 3IXHA 2W1RA 2BG1A 4ETXA 5DFYA 4KQDA 1D06A 1LL9A 3NCKA 4WUJA 5F68A 1OTEA 2E8IA 3TOIA 5TGFA 3KYEA 3UB5P 4F3LA 4UQIS 3H7WB 3S7OA 1LT0A 1KGEA 4QHCA 1CEGA 4QB8A 2R9XA 2GZAA 3O86A 4KG6A 5AQBA 4OOMA 3EOIA 4HP4A 5TJJA 1MKIA 2L1MA 3CPTB 4GD6A 1OMEA 5M18A 1L0GA 3W8KA 4JXSA 2ZJ9A 4MCWA 5EV0A 3NOTC 4S2IA 1PWDA 5DTTA 5TR7A 5CHMA 3IT9A 4HOIA 3PBTA 1FILA 2ZMVA 2HP6A 2HF6A 2B5RA 1NYMA 3BYDA 3UE6A 4KQQA 4OLDA 1Q2PA 3MXSA 3NHQA 1GHIA 2FH5A 3BQAA 5KIZA 2V9AA 5DF9A 3WRTA 4H8RA 4R3AA 1MC0A 4O7DA 2V0WA 5EE8A 3HUOA 3BRMA 1LI9A 3FKWA 5EECA 4S2PA 2JE5A 2DRWA 4DN0A 4KZ9A 3PR6A 4N92A 3LI9A 4Y3IA 1PRQA 2VA0A 2VGKA 1TS7A 5LBRA 5K5BA 3QNCA 1P97A 1YSQA 5HAPA 1ES4A 3UMEA 3G6OA 2WYXA 2A24B 4Y2FA 5HX9A 2L0WA 4JGPA 3LCEA 1LSVA 3CAXA 3M2KA 5J4EA 5I94A 5FI2A 1SZVA 5F1FA 2V8FA 5FAOA 2WZZA 3O5YA 3LIBA 3O88A 2FFFB 4HH2A 4ZRRA 5EM1A 5EVIC 1M6KA 3LY3A 3NDGA 2PU4A 3LIDA 4L9EA 3EWKA 3MXQA 2QJ5A 2Y91A 4EQ1A 3BLMA 3NULA 4KZ7A 1FR1A 1UWNX 4DDSA 2OAP1 4N9KA 4PM7A 2EA9A 2GNXA 1WYBA 2WADA 4QWOA 5HW3A 1FCMA 4DE1A 1MPLA 4MN7A 4UQIM 4DE0A 3BY8A 4WN5A 2O0YA 3PBOA 5J3WA 3G31A 3HL9A 3LGOA 1XXMA 4JGOA 1BLPA 3GR2A 4Y13A 3Q7ZA 1VB6A 4NXEA 3EQVA 5A90A 1O7EA 4EWFA 4ZAMA 3O87A 2OWHA 1F98A 3R4KA 2ZC5B 4IUKA 2R9WA 3TRCA 4GNUA 3E0YA 3E4OA 5CGSA
chains in the Genus database with same CATH topology
4IUHA 2QHKA 3B33A 4PKYA 4GS9A 4RQ9A 3W2ZA 1XJ4A 5TBMB 4HJ6A 1DP6A 5I5LA 1LSWA 2KOIA 1T1AA 2PT7A 3IS2B 4LPZA 3IS2A 3HCYA 2M7UA 4Q0IA 5HDDA 3RH8B 2XSSA 2PD8A 3F1NA 3KSFA 4ME4A 1XFNA 2KLIA 3GECA 5HPFA 2D02A 2Y8HA 2L4RA 1Y28A 2P7JA 1XJ6A 2JKTM 2VGLM 1TS0A 3S7PA 4K08A 4O01A 4R38A 3ZYTA 1IOUA 4CQHA 5FL3A 3UB6A 2EWWA 2XROA 1P0ZA 2NUTC 2QWSA 5AVFA 3CUEC 3CWFA 4CLCD 3KO6A 1N9OA 1LSXA 3VV4A 4WF0A 3EEAA 3A0VA 3PYPA 1DP9A 5HZHA 2YKHA 3KSHA 3NOUC 1UWPX 4GLQA 2VJWA 1XJ3A 2PR6A 5F69A 2ZOIA 3D72A 2QKPA 2K2NA 4KUKA 3S7NA 3U2AA 2LB9A 1P9RA 3HJKA 1V9ZA 3IBRA 3BJNA 4EEPA 5DFXA 3E4PA 3UE3A 3D3OA 4B9OA 4UEYA 4GHIA 4L9GA 1S4RA 4WEJA 3UB8A 3PBNA 1F5MA 4PHTA 3VE3A 2M7VA 2ZBBA 4HI4A 5C5KA 4R6LA 4EESA 4LLOB 1NRJA 2KX6A 3EQUA 1WA9A 3ICYA 2GJ3A 2DMWA 2W3DA 3NJAA 3MJQA 2JN7A 5HDSA 5DKLA 4YOFA 4HIAA 4Z1WA 4II7A 1YKDA 5G4YA 4ARZB 1N9LA 2JKRM 3MFXA 2VV8A 3LR4A 3F1NB 2M1CA 4KQOA 1MKMA 2K31A 2HJ9C 3LR0A 3K2NA 2PYRA 3HJIA 1T1BA 2B18A 3TJZC 1OJ5A 3LFVA 4NXFA 3OC2A 1G6OA 3T4OA 3F1OB 4HQAA 3P01A 2W3FA 3ULFA 5A8BA 2CMNA 3KYZA 3MR0A 1OPXA 4MN5A 3PBRA 4CLCB 3EEHA 4AFIA 3KYQA 4MN6A 4CLCE 4L0LA 3PHYA 2GX5A 5IS1A 3RFBA 3LIEA 1OTAA 5HL6A 3C8CA 1H8MA 1H3QA 3MQ0A 5CX7A 5KSHA 3BW6A 5G4ZA 3CLOA 3H7WA 3MQOA 5MC7A 1GSXA 4F3LB 4WEKA 3CI6A 1VHMA 3FC7A 2LB5A 4NXGA 3LUQA 2V1AA 4G3WA 4EEUA 2W27A 3FPWA 2VV7A 2W3HA 1OT9A 3T4KA 3MQQA 2QJ7A 2PR5A 4WLAA 2KDKA 2Z6DA 2V0UA 2J3TC 3C2WA 3T4JA 4EERA 1UGUA 3CUEA 4FSFA 4P6ZS 1MZUA 4ARZA 4BMWA 4NKPA 3ZQ5A 3LYXA 3MMHA 4NEED 2W3GA 1V9YA 2VGLS 4NXBA 3TE8A 4GW9A 4BBUA 3GDIA 4HNBA 1X0OA 5HSQA 2P04A 1BYWA 3C38A 3PBQA 4BWIA 1TD5A 5AJGA 4WL9A 3P7NA 1S4SA 4P6ZM 4I3AA 3H82A 4EUVA 2R78A 4WELA 1TS6A 2ZMFA 2I9VA 3OOVA 2XRNA 2O9CA 2A24A 3UB7A 2K7SA 1JNUA 5EFWA 3E98A 3T4LA 4HY8A 1EW0A 4R70A 5F5YA 3LR5A 2P08A 3F1OA 3K3DA 4HJ3A 4I3IA 5DJUA 3EGXC 4EU0A 1N9NA 1S66L 4LRZE 4L9FA 4DMZA 1XFQA 1NWZA 3MF0A 3OCLA 2Z6CA 3E4QA 1S67L 4QPRA 5HD5A 3FPVA 2IA2A 4H6JA 4H6JB 2H28A 4I3JA 3BY9A 4I39A 4HH3A 2EWVA 2OOLA 2VEAA 1KOUA 2O99A 2PD7A 1T19A 3LR3A 4ETZA 3T4TA 2W1RA 3BWLA 5HPIA 4ETXA 5DFYA 3R7WA 4KQDA 1D06A 3LIFA 4WUJA 1LL8A 5F68A 1OTEA 2O9BA 4EXOA 4F3LA 2INWA 5L8MA 3A0RA 3V67A 4UQIS 1OTIA 5HD3A 1IFQA 2XA7M 2JHEA 3H7WB 3S7OA 1LT0A 3T50A 3LIAA 1T18A 2PYPA 4KUOA 3RTYA 3JVVA 1S1ZA 2GZAA 2W1TA 3OBFA 2A2LA 2ZOHA 4OOMA 3EOIA 1F9IA 4HP4A 5TJJA 2L1MA 2WKQA 4G3KA 2YKFA 4LRXC 5HWVA 4O0PA 1OT6A 1YSPA 1ZHHB 2HGVA 4MCWA 3LICA 3NOTC 1NLYA 4HOIA 3PBTA 3H82B 1OTDA 2ZMVA 2HF6A 3TW8A 3JVUA 2W1TB 1STZA 2NUPC 5AVEA 3UE6A 1ZTUA 1GSVA 3KSGA 4GJ4A 3H9WA 3UMDA 2VV6A 2XA7S 3NHQA 2FH5A 3BQAA 1D7EA 4B93A 5KIZA 2V9AA 4BBVA 5DF9A 3R7WB 4R3AA 2JKRI 1MC0A 1W63Q 1GSWA 2V0WA 4FOFA 3A0SA 4GHIB 2J80A 1T1CA 3T4SA 5TBMA 2MJ6A 4O8GA 4JGQA 5HWTA 4XT2A 2V1BA 3VOLA 3SW1A 4Q0JA 4DN0A 3PXPA 2WKRA 5IT5A 3S7QA 4DJ3A 3PR6A 3LI9A 4Y3IA 1ODVA 2FZ0A 5DJTA 2VA0A 4IHQA 5DKKA 5HWWA 1TS7A 5LBRA 5K5BA 1P97A 3NOPC 1YSQA 4GS9B 1TF1A 3OLOA 4LRYC 4HJ4A 4JGRA 2BASA 4PAUA 3UMEA 3G6OA 3DBAA 5HDCA 5F6AA 2Y79A 2A24B 4I5SA 4Y2FA 2L0WA 4JGPA 2G7UA 1LSVA 3LI8A 3CAXA 1G28A 5J4EA 4XT2B 2VX8A 4G3VA 3KSIA 2JKTI 2WKPA 3F1PA 2OWJA 4E04A 3O5YA 2J3TD 2PDRA 2HJEA 5IU1A 3LIBA 4HH2A 4ZRRA 3UB9A 4CLCA 4EW7A 2D01A 4YWZA 2VKSA 1DRMA 1XJ2A 4OOLA 4YNRA 4L9EA 3LIDA 2QYBA 3EWKA 3MXQA 4MDZA 1YAXA 3VE4A 2QJ5A 3OCNA 3EGDC 4EQ1A 3C30A 2VLGA 4EETB 2J3WA 3F1PB 1DP8A 1P9WA 4BJPA 4DJ2A 4BBTA 1UWNX 1TS8A 2OAP1 3PBSA 4GCZA 2EA9A 2GNXA 4MN7A 4MMNA 2OAQ1 4UQIM 3BY8A 3KX0X 4WN5A 1OTBA 2O0YA 4M4XA 3PBOA 5J3WA 4HHDA 3B47A 4IJGA 4JGOA 3CITA 4I38A 1S1YA 1VB6A 3K3CA 4NXEA 2HV1A 3EQVA 4Q0HA 4CLCC 2B02A 4Y5FA 2W3EA 1NLZA 2PHYA 3IBJA 4PKYG 1OJGA 2OWHA 2O9AA 1F98A 3R4KA 1W63M 5J7EA 4IUKA 3B42A 3TRCA 3BQ8A 4HP9A 2W0NA 3E0YA 3E4OA 3FG8A 3T4QA 2VZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B42 A;  3B47 A; 
#chains in the Genus database with same CATH topology
 4IUH A;  3B33 A;  3DW0 A;  3WWX A;  3HRE A;  3CHW P;  3IS2 B;  3IS2 A;  3HCY A;  2WGW A;  4Y15 A;  3RH8 B;  3F1N A;  1XFN A;  4JBF A;  1LI0 A;  2Y8H A;  4KZ4 A;  3NBL A;  4DXC A;  3S7P A;  4K08 A;  3ZYT A;  2XRO A;  2QWS A;  4HEF A;  4X6T A;  1N9O A;  1G5U A;  2FFY A;  3ZG0 A;  5HZH A;  2YKH A;  1IYQ A;  1PFL A;  4BQM A;  1PZO A;  1UWP X;  2XD1 A;  3C5A A;  3IF6 A;  2G2W A;  2ZOI A;  2QKP A;  4WZ5 A;  3P98 A;  3VP1 A;  5DFX A;  3UE3 A;  4LFU A;  4IVI A;  4B9O A;  4GHI A;  1NY0 A;  4L9G A;  3UO9 A;  3IWO A;  3IXB A;  5L07 A;  3ITB A;  4X56 A;  4DRT A;  4R0Q A;  2ZBB A;  2Y2K A;  2RCX A;  4HI4 A;  1SDE A;  5C5K A;  4EES A;  1K0K A;  3ICY A;  5A91 A;  1SKO A;  3NJA A;  3MJQ A;  4LEN A;  2JN7 A;  4YFM A;  4RVA A;  1PI5 A;  1WYC A;  4OQH A;  1CJF A;  3VOZ A;  2C6W B;  2HPB A;  5EPH A;  3E2K A;  2K31 A;  4OPZ A;  3VFH A;  2VGJ A;  1DJB A;  2B18 A;  2WKI A;  4PM5 A;  3OC2 A;  1NZU A;  3F1O B;  1RGZ A;  2W3F A;  2XF3 A;  3V39 A;  2CMN A;  4AFI A;  3IWQ A;  2JC7 A;  4MN6 A;  5HL6 A;  1ONG A;  4N1H A;  4OQI A;  3MQ0 A;  5MC7 A;  1GSX A;  1JWZ A;  1VHM A;  3FC7 A;  4NXG A;  5CED A;  1TDL A;  4JXV A;  1TEM A;  3QP5 A;  5DTK A;  3IWI A;  2KDK A;  2Z6D A;  2V0U A;  3C2W A;  4EER A;  1MWU A;  2ZL1 A;  3CUE A;  3ZHH A;  1V9Y A;  2EX2 A;  4GW9 A;  2DCF A;  2A49 A;  3GDI A;  4HNB A;  4E3N A;  2PBY A;  1F2K A;  2VK3 A;  3S4X A;  3GQZ A;  3N6I A;  1TD5 A;  1S4S A;  3P7N A;  4P6Z M;  4MBF A;  4M3K A;  3VP3 A;  1S6R A;  5EVI B;  1I5Q A;  2R78 A;  3AGF A;  2ZMF A;  1QMF A;  3ITA A;  2O9C A;  1SDN A;  1CI9 A;  3IHA A;  5EFW A;  3E98 A;  4GD8 A;  1RGY A;  3T4L A;  2A3U A;  4KEN B;  1K6R A;  2P08 A;  4HJ3 A;  3C7U A;  1DJA A;  4LRZ E;  4UAA A;  1XFQ A;  4LCM A;  1S67 L;  1ZG6 A;  5HD5 A;  1K56 D;  4H6J B;  4LGW A;  3BY9 A;  1SKO B;  4FD8 A;  1T19 A;  1YPR A;  4PMA A;  3T4T A;  2AVX A;  3BWL A;  3R7W A;  2J7V A;  5L8M A;  2JHE A;  3IF6 C;  3RJU A;  3T50 A;  1YLZ A;  1E3U A;  3RTY A;  3JVV A;  4S2N C;  1S1Z A;  2W1T A;  2HP5 A;  2A2L A;  2YKF A;  1ZHH B;  2RL3 A;  2PU2 A;  1LLB A;  3CZD A;  3W4Q A;  4E3K A;  4E3L A;  5F1G A;  5FEF A;  4OH0 A;  1OTD A;  2C5W B;  4MLL A;  1MXO A;  4PM6 A;  3FWL A;  2H0Y A;  3MZF A;  1YLT A;  1YMX A;  4BLM A;  2Y2M A;  4B4Z A;  2UWX A;  3HBR A;  4D60 A;  3UPN A;  1W8Q A;  3ZVW A;  4X1L A;  5A93 A;  4FOF A;  2BLS A;  1KDS A;  1KGF A;  1T1C A;  4OQG A;  4O8G A;  3HLE A;  3WS5 A;  4YIN A;  5HWT A;  5JYO A;  2V1B A;  2ZMA A;  3PXP A;  2Y2P A;  4DJ3 A;  1H5X A;  5DKK A;  1N4O A;  3NOP C;  4GS9 B;  1TF1 A;  4UA6 A;  4JGR A;  5EVI D;  4PAU A;  3DBA A;  3SH7 A;  3ZG7 B;  1YMS A;  5IHV A;  3UDI A;  3ZCZ A;  4HBT A;  5GLA A;  4XT2 B;  2VX8 A;  2EFU A;  3CJM A;  2ZLY A;  3HVF A;  2GDN A;  3ISG A;  1Y54 A;  2Y2N A;  3BEC A;  4PM9 A;  4Y7P A;  1J9M A;  5IU1 A;  3UB9 A;  4YWZ A;  4IBX A;  1GHP A;  2ZQA A;  2VKS A;  4YNR A;  1VET A;  3N7W A;  3IH8 A;  4F94 A;  2DNS A;  4MDZ A;  4BEN A;  3L9K A;  4XXR A;  3EGD C;  4OON A;  2J3W A;  1N9B A;  1MBL A;  4BBT A;  3SH9 A;  1K54 C;  4FUW A;  1DY6 A;  5G18 A;  1KVM A;  4MMN A;  1PW8 A;  5CXW A;  5HFO A;  4DE2 A;  1FQG A;  1S1Y A;  5GLB A;  2P9V A;  5L2F A;  2HV1 A;  4CLC C;  1CQA A;  2PHY A;  3LEQ A;  3IBJ A;  3DTM A;  5CER A;  1OJG A;  4Y0U A;  5J7E A;  4D2O A;  5E2E A;  2HP9 A;  3CPT A;  5DVA A;  3FG8 A;  1MZU A;  2QHK A;  4PKY A;  2PAV P;  1YQS A;  2IWB A;  4KG5 A;  5E2H A;  4RQ9 A;  1XJ4 A;  3NC8 A;  4OQ0 A;  4DE3 A;  1T1A A;  2PT7 A;  1YM1 A;  1Z09 A;  2M7U A;  3GTC A;  4GN2 A;  5HDD A;  3MS6 A;  2PD8 A;  2QPN A;  2Y59 A;  1SKF A;  3GEC A;  4UA7 A;  5FAP A;  4R3J A;  2L4R A;  3S1Y A;  5E2G A;  2JKT M;  3E2L A;  4O01 A;  3LO7 A;  4OP8 A;  3MXR A;  5AVF A;  3UE1 A;  2WGV A;  1VET B;  3KO6 A;  2JCH A;  4N1X A;  5FSR A;  3DWK A;  2ZM2 A;  3UN7 A;  3RXX A;  2I72 A;  1L0E A;  1XJ3 A;  3T1Q B;  4MEZ A;  1JVJ A;  3HJK A;  2ZC3 B;  3G32 A;  3U4L P;  4RX2 A;  2Y4A A;  1J3W A;  1KGG A;  2E8J A;  4GB7 A;  1A0K A;  1S4R A;  4ZTK A;  1BSG A;  3D9Y A;  4WEJ A;  3VSL A;  3UB8 A;  4PHT A;  4GOG A;  2Y2Q A;  3VE3 A;  1Y4O A;  2Q9M A;  4LLO B;  3UNW A;  4OPQ A;  1WA9 A;  2GJ3 A;  3IX3 A;  2DMW A;  5M19 A;  4YOF A;  1MWS A;  3QP1 A;  5G4Y A;  3DTI A;  2JKR M;  4DXB A;  3MFX A;  2VV8 A;  2ZL1 B;  3F1N B;  2M1C A;  1RCJ A;  1ZC2 A;  5FQK A;  4NXF A;  2J9P A;  3IX8 A;  1G6O A;  4FTX A;  3T4O A;  3IX4 A;  3P01 A;  3ULF A;  4K0X A;  3QP6 A;  5D3O A;  4MN5 A;  1HLU P;  3TG9 A;  4CLC B;  4CPK A;  1Q2Q A;  4IBR A;  3DTE A;  1SHV A;  4L0L A;  3PHY A;  2GX5 A;  3LIE A;  4IED A;  1XX2 A;  1H8M A;  3CLO A;  4R23 A;  2EXB A;  3JPU A;  2XFS A;  2V1A A;  3WS2 A;  4XUZ A;  2Y2G A;  2P74 A;  3T4K A;  1O07 A;  2PR5 A;  4WLA A;  1FCN A;  4MBH A;  3ZG9 B;  1UGU A;  4DKI A;  3GSG A;  4FSF A;  1L0D A;  3ZQ5 A;  3IF5 A;  3N8S A;  4WMC D;  4GDN A;  4NXB A;  3TE8 A;  3FZC A;  1BLS A;  3UPO A;  5FQI A;  5HSQ A;  2P04 A;  1BYW A;  3MFD A;  5CEC A;  3BFE A;  4WL9 A;  3WS4 A;  4I3A A;  1W5D A;  3H82 A;  5CGX A;  4KZ5 A;  1TS6 A;  4OOY A;  4MNR A;  4Y0O A;  2V20 A;  3OOV A;  3ZGA B;  2A24 A;  2K7S A;  1JNU A;  1XGI A;  5AQ7 A;  3T1S A;  3MSH A;  5DF7 A;  4I3I A;  4L9F A;  5FI7 A;  1XP4 A;  3BFF A;  4CJN A;  3MF0 A;  3OCL A;  4QPR A;  2IA2 A;  2H28 A;  2EWV A;  2OOL A;  2VEA A;  1KOU A;  2QZ6 A;  1KE0 A;  3LR3 A;  4ETZ A;  3A3F A;  3CMZ A;  5EVE A;  2O9B A;  3MKF A;  3HLW A;  3A0R A;  5CHU A;  2Q9N A;  5HD3 A;  1IFQ A;  3UPP A;  1XGJ A;  1MWT A;  1BLH A;  3SS3 A;  2JKF A;  3LIA A;  1T18 A;  2XLN A;  3OBF A;  5DTS A;  1IKG A;  2V2F F;  2ZOH A;  4S2N A;  3HLG A;  1HVB A;  1L2S A;  4G3K A;  4LRX C;  5GHY A;  4O0P A;  1OT6 A;  1NYY A;  3LIC A;  1HTZ A;  2WGI A;  1S0W A;  5FA7 A;  3H82 B;  4IVK A;  2HDQ A;  1JTD A;  4QD4 A;  5FQQ A;  4R3B A;  2W1T B;  4KQR A;  1STZ A;  2NUP C;  5AVE A;  2ZM8 A;  1ZTU A;  1GSV A;  3KSG A;  4P87 A;  2UV0 E;  3T1X A;  2X02 A;  3S22 A;  2WUQ A;  2CC1 A;  2XA7 S;  2G2U A;  1KE4 A;  1D7E A;  4B93 A;  4BBV A;  5EUA A;  3R7W B;  3P09 A;  2JKR I;  3UY6 A;  1W63 Q;  4C3Q A;  4HES A;  1C3B A;  4GHI B;  1FSY A;  2J80 A;  3AGD A;  1K25 A;  1MY8 A;  3T4S A;  3M6H A;  2XDM A;  4KG2 A;  4JGQ A;  2ZD8 A;  4XT2 A;  3VOL A;  1CK3 A;  1BTL A;  4Q0J A;  3SW1 A;  1GA0 A;  1E3U D;  2WKR A;  1ODV A;  2FZ0 A;  4IHQ A;  3VMA A;  2ZC4 B;  1CEF A;  1K56 A;  4LRY C;  4HJ4 A;  3UE0 A;  3G30 A;  2BAS A;  2Z2L B;  5HDC A;  5F6A A;  2Y2O A;  2G7U A;  1GA9 A;  3LI8 A;  5E43 A;  4G3V A;  2WKP A;  3F1P A;  2WAE A;  1LL5 A;  2OWJ A;  2JBF A;  2Y2I A;  2PDR A;  2HJE A;  1XA7 A;  4EW7 A;  2D01 A;  2EX8 A;  4P0M A;  4OOL A;  2H10 A;  3A3I A;  1KDW A;  5F82 A;  2QYB A;  3IQA A;  2XR0 A;  3V3S A;  4EUZ A;  3C30 A;  2VLG A;  3BLS A;  4EET B;  5E2F A;  3IH9 A;  3F1P B;  1DP8 A;  1P9W A;  4BJP A;  4X69 A;  1TS8 A;  1I2S A;  1NXY A;  3IHB A;  2ZC6 B;  3N4I A;  4OVD A;  2OAQ 1;  4M4X A;  4HHD A;  4IJG A;  4OP5 A;  4I38 A;  1H8Y A;  2WZX A;  3K3C A;  4R4R A;  4Q0H A;  1U60 A;  2B02 A;  1NLZ A;  4GDB A;  4PKY G;  1H8Z A;  3MKE A;  3VP4 A;  1W63 M;  5FI6 A;  4LV0 A;  1NZO A;  2QMI A;  2P7J A;  2VV6 A;  1FOF A;  3BEB A;  4GS9 A;  1K55 A;  2Y2L A;  1LHY A;  3Q1F A;  5TBM B;  4HJ6 A;  1DP6 A;  5I5L A;  4LV3 A;  1LSW A;  2KOI A;  3T12 B;  2V1Z A;  3ZG8 B;  3Q81 A;  4LPZ A;  1NJ4 A;  1W79 A;  1K57 C;  4WZ5 C;  4Q0I A;  4BD0 A;  2IWC A;  3G4P A;  4OLG A;  4LCL A;  4Z9Q A;  4WZ4 A;  1BUL A;  4QU3 A;  1XJ6 A;  1IEM A;  1TS0 A;  4S2J A;  4R38 A;  4CQH A;  5FL3 A;  2EWW A;  1P0Z A;  2EX6 A;  1IYP A;  5EVI A;  3W4O A;  3HLB A;  5GLC A;  4CLC D;  1LSX A;  4EBP A;  3A0V A;  3PYP A;  1DP9 A;  5FQM A;  3PAG A;  2XH9 A;  5CTM A;  3OPR A;  2X71 A;  4E6X A;  4GLQ A;  2VJW A;  2OV5 A;  3NI9 A;  1VQQ A;  4X53 A;  5EM0 A;  2Y2J A;  1NRF A;  3D72 A;  4A5R A;  3S7N A;  3U2A A;  2LB9 A;  5AQA A;  3SOI A;  3IBR A;  2H0T A;  3G35 A;  1E4D A;  3ZNT A;  3PTE A;  3SH8 A;  4GZB A;  2WKH A;  3Q7V B;  1PYY A;  3VFF A;  5DF8 A;  1K38 A;  2M7V A;  4X1M A;  3M2J A;  1GHM A;  1YLW A;  4R6L A;  1NRJ A;  1TVF A;  3N8R A;  2ACG A;  2W3D A;  4WM9 A;  1HD8 A;  4BL3 A;  4S2L A;  4ARZ B;  1FSW A;  4JXW A;  4S2K A;  2EFX A;  3ZNY A;  2XQZ A;  2XGN A;  3BFD A;  4KQO A;  4X68 A;  4E3M A;  4U0X A;  3LR0 A;  1IKI A;  3ZG5 A;  1VM1 A;  1FCO A;  3HJI A;  4KZB A;  1K4F A;  2ZQD A;  3LFV A;  4FCF A;  1ACF A;  4JF4 A;  3KYZ A;  1Z6F A;  5KSC A;  5EOO A;  1KVL A;  5CEB A;  4CLC E;  5EOE A;  5KMW A;  1ERQ A;  1OTA A;  4DF6 A;  1SCW A;  5KSH A;  1PWG A;  3HUN A;  2OSU A;  4JF6 A;  4P6B A;  5G4Z A;  3H7W A;  3MQO A;  3OPP A;  3QP4 A;  4F3L B;  2XEP A;  3CI6 A;  2LB5 A;  3LUQ A;  1ESU A;  2Z2M B;  4OPR A;  4EBN A;  1VEU A;  2OLU A;  3GVB A;  1OT9 A;  3MQQ A;  2QJ7 A;  2J8Y A;  1K55 C;  4QJG A;  2Q0O A;  4X55 A;  3C4P A;  3HUM A;  4P6Z S;  4E3I A;  4BMW A;  4NKP A;  1ES5 A;  2VGL S;  3OPL A;  3L7H A;  4BD1 A;  4P85 A;  1IEL A;  1EWZ A;  1IYO A;  1QME A;  3C38 A;  2P9V B;  4ZDX A;  4WEL A;  3HLD A;  4ZJ3 A;  1ZG4 A;  3UB7 A;  3A3D A;  4PM8 A;  1YLP A;  4FH4 A;  4JPM A;  4Y0T A;  2HZ5 A;  3NEC A;  4R70 A;  5F5Y A;  3LR5 A;  3F1O A;  4S2M A;  5BOH A;  2WAF A;  3EGX C;  1N9N A;  4EU0 A;  2XK1 A;  4DMZ A;  1NWZ A;  1ERO A;  1BT5 A;  3NY4 A;  3QNB A;  5CTN A;  3FPV A;  4I39 A;  3QP2 A;  4KZ3 A;  2O99 A;  5HPI A;  4MBK A;  3LIF A;  1LL8 A;  4WYY A;  3Q07 A;  4K0W A;  4EXO A;  2INW A;  3Q7V A;  3V67 A;  1OTI A;  2XA7 M;  3T1R A;  2PYP A;  4KUO A;  3OPH A;  3LEZ A;  1F9I A;  4KZ8 A;  2WKQ A;  1K57 A;  5HWV A;  1PWC A;  1YSP A;  2HGV A;  1K4E A;  1W7F A;  4WBG A;  1BLC A;  3QP8 A;  1NLY A;  1GCE A;  2PBD P;  3TW8 A;  1ZKJ A;  4E3O A;  3ZDJ A;  3FV7 A;  3JVU A;  5CHJ A;  5FDS A;  1G68 A;  4GJ4 A;  3H9W A;  3UMD A;  3FYZ A;  3ZVT A;  5FEG A;  1YLY A;  2ZC7 A;  1GSW A;  1YT4 A;  3A0S A;  3NDE A;  2J9O A;  2Y55 A;  5TBM A;  2MJ6 A;  4NET A;  3M6B A;  4OPY A;  4WMC A;  1DJC A;  3MZE A;  5FAS A;  4NK3 A;  5IT5 A;  3S7Q A;  3NIA A;  1KE3 A;  5DJT A;  4RA7 A;  5CGW A;  5HWW A;  3OLO A;  3GRJ A;  4U0T A;  2WK0 A;  4X25 A;  4Y17 A;  1PNE A;  1EI5 A;  3BM6 A;  2Y79 A;  4I5S A;  1G28 A;  1RP5 A;  5HAR A;  2V8C A;  3RXW A;  2JKT I;  2JKG A;  3KSI A;  5HL1 A;  1H0M A;  1XPB A;  4E04 A;  2J3T D;  3SZT A;  4K91 A;  2ZQ8 A;  2ZQC A;  1CI8 A;  4CLC A;  1DRM A;  1XJ2 A;  1L0F A;  4LV1 A;  3CG5 A;  4QY6 A;  1VEU B;  1K6S A;  1YAX A;  3VE4 A;  3OCN A;  5A92 A;  4ZBE A;  3GMW A;  3O3V A;  5L09 A;  4DJ2 A;  4RX3 A;  1FIK A;  3FKV A;  3N8L A;  3PBS A;  3A3J A;  4GCZ A;  4XUX A;  4JKT A;  3LY4 A;  4ESP A;  2X01 A;  1XA1 A;  3KX0 X;  5FAQ A;  1OTB A;  4PPR A;  2HDU A;  3B47 A;  3W4P A;  3SS5 A;  4C6Y A;  3CIT A;  5U47 A;  4ZJ1 A;  3V50 A;  5AQ9 A;  3VP2 A;  3DWZ A;  2ZM0 A;  3HLC A;  4Y5F A;  1JWP A;  2W3E A;  3IXD A;  3DTK A;  2O9A A;  3B42 A;  3D4F A;  1ONH A;  1PIO A;  3BQ8 A;  4HP9 A;  2W0N A;  3SS4 A;  3T4Q A;  2VZW A;  4B4X A;  5HAI A;  1CF0 A;  3MBZ A;  3PAE A;  3W2Z A;  4RYE A;  3A3E A;  3GV9 A;  2XSS A;  4DDY A;  3KSF A;  4ME4 A;  2KLI A;  5HPF A;  2D02 A;  1Y28 A;  1ES3 A;  3ZFZ A;  2VGL M;  3G2Y A;  5FQJ A;  2EXA A;  5FAT A;  3HLF A;  1IOU A;  3TSG A;  3UB6 A;  2NUT C;  1G6A A;  3CUE C;  3CWF A;  5FQ9 A;  5KZH A;  3VV4 A;  4WF0 A;  3EEA A;  3KSH A;  3NOU C;  4UA9 A;  1MWR A;  3BFG A;  1D1J A;  2PR6 A;  2IWD A;  3AGE A;  4B88 A;  2BTF P;  5F69 A;  5L10 A;  1PW1 A;  1HZO A;  2K2N A;  4KUK A;  5CRF A;  1P9R A;  1V9Z A;  3BJN A;  4EEP A;  3G34 A;  3E4P A;  1BUE A;  3Q82 A;  3D3O A;  4UEY A;  1WE4 A;  1M40 A;  3VP0 A;  4ID4 A;  1TDG A;  3PBN A;  1F5M A;  1JTG A;  5F83 A;  2KX6 A;  2ZQ7 A;  3EQU A;  3WS0 A;  4E3J A;  5HDS A;  5DKL A;  4HIA A;  4Z1W A;  4II7 A;  1YKD A;  4U3T A;  1N9L A;  1W8Y A;  4BL2 A;  3C4O A;  4FH2 A;  3QHY A;  5GLD A;  3LR4 A;  4EQI A;  4UHU A;  1MKM A;  3C7V A;  2HJ9 C;  3B3X A;  3K2N A;  2PYR A;  4GKU A;  3IXG A;  2H5S A;  3JYI A;  4LV2 A;  1T1B A;  3TJZ C;  1OJ5 A;  1PZP A;  3OZH A;  4QY5 A;  4JXG A;  1JWV A;  4HQA A;  2ZQ9 A;  5A8B A;  2XD5 A;  3MR0 A;  3V5M A;  1AWI A;  3BFC A;  1OPX A;  3PBR A;  3EEH A;  2Y2H A;  3KYQ A;  5GL9 A;  5GHX A;  5IS1 A;  3RFB A;  1E25 A;  3IF6 B;  1FR6 A;  5J8X A;  3C8C A;  1H3Q A;  5CX7 A;  5FDH A;  4ZJ2 A;  3BW6 A;  2HDR A;  5EVL A;  3G2Z A;  5HAQ A;  5TFQ A;  5GHZ A;  4WEK A;  4S2O A;  3WS1 A;  1L3L A;  4G3W A;  4EEU A;  2W27 A;  3FPW A;  2VV7 A;  2W3H A;  3UDF A;  4Q8I A;  1ES2 A;  1ALQ A;  2OLV A;  2J3T C;  3T4J A;  4EV4 A;  4ARZ A;  2B95 A;  1BZA A;  3V3R A;  4KZ6 A;  3LYX A;  3MMH A;  4NEE D;  2W3G A;  1K54 A;  2WGW B;  4HBU A;  3MZD A;  4JF5 A;  2WKE A;  3VSK A;  4BBU A;  1ERM A;  2EX9 A;  4EBL A;  4N9L A;  2XFT A;  1I2W A;  1X0O A;  5JYP A;  4C75 A;  3PBQ A;  1PI4 A;  4R1G A;  3DAV A;  4BWI A;  5AJG A;  1ESI A;  4KZA A;  4JLF A;  4EUV A;  4R4S A;  4E6W A;  2I9V A;  2HDS A;  2XRN A;  3VOY A;  1IYS A;  4HY8 A;  4OKP A;  1EW0 A;  3I7J A;  1XKZ A;  3UDX A;  1AXB A;  3K3D A;  5DJU A;  1S66 L;  3WRZ A;  2Z6C A;  3E4Q A;  5M1A A;  4H6J A;  4I3J A;  1YLJ A;  4NG2 A;  4HH3 A;  2PRF A;  2PD7 A;  3IXH A;  2W1R A;  2BG1 A;  4ETX A;  5DFY A;  4KQD A;  1D06 A;  1LL9 A;  3NCK A;  4WUJ A;  5F68 A;  1OTE A;  2E8I A;  3TOI A;  5TGF A;  3KYE A;  3UB5 P;  4F3L A;  4UQI S;  3H7W B;  3S7O A;  1LT0 A;  1KGE A;  4QHC A;  1CEG A;  4QB8 A;  2R9X A;  2GZA A;  3O86 A;  4KG6 A;  5AQB A;  4OOM A;  3EOI A;  4HP4 A;  5TJJ A;  1MKI A;  2L1M A;  3CPT B;  4GD6 A;  1OME A;  5M18 A;  1L0G A;  3W8K A;  4JXS A;  2ZJ9 A;  4MCW A;  5EV0 A;  3NOT C;  4S2I A;  1PWD A;  5DTT A;  5TR7 A;  5CHM A;  3IT9 A;  4HOI A;  3PBT A;  1FIL A;  2ZMV A;  2HP6 A;  2HF6 A;  2B5R A;  1NYM A;  3BYD A;  3UE6 A;  4KQQ A;  4OLD A;  1Q2P A;  3MXS A;  3NHQ A;  1GHI A;  2FH5 A;  3BQA A;  5KIZ A;  2V9A A;  5DF9 A;  3WRT A;  4H8R A;  4R3A A;  1MC0 A;  4O7D A;  2V0W A;  5EE8 A;  3HUO A;  3BRM A;  1LI9 A;  3FKW A;  5EEC A;  4S2P A;  2JE5 A;  2DRW A;  4DN0 A;  4KZ9 A;  3PR6 A;  4N92 A;  3LI9 A;  4Y3I A;  1PRQ A;  2VA0 A;  2VGK A;  1TS7 A;  5LBR A;  5K5B A;  3QNC A;  1P97 A;  1YSQ A;  5HAP A;  1ES4 A;  3UME A;  3G6O A;  2WYX A;  2A24 B;  4Y2F A;  5HX9 A;  2L0W A;  4JGP A;  3LCE A;  1LSV A;  3CAX A;  3M2K A;  5J4E A;  5I94 A;  5FI2 A;  1SZV A;  5F1F A;  2V8F A;  5FAO A;  2WZZ A;  3O5Y A;  3LIB A;  3O88 A;  2FFF B;  4HH2 A;  4ZRR A;  5EM1 A;  5EVI C;  1M6K A;  3LY3 A;  3NDG A;  2PU4 A;  3LID A;  4L9E A;  3EWK A;  3MXQ A;  2QJ5 A;  2Y91 A;  4EQ1 A;  3BLM A;  3NUL A;  4KZ7 A;  1FR1 A;  1UWN X;  4DDS A;  2OAP 1;  4N9K A;  4PM7 A;  2EA9 A;  2GNX A;  1WYB A;  2WAD A;  4QWO A;  5HW3 A;  1FCM A;  4DE1 A;  1MPL A;  4MN7 A;  4UQI M;  4DE0 A;  3BY8 A;  4WN5 A;  2O0Y A;  3PBO A;  5J3W A;  3G31 A;  3HL9 A;  3LGO A;  1XXM A;  4JGO A;  1BLP A;  3GR2 A;  4Y13 A;  3Q7Z A;  1VB6 A;  4NXE A;  3EQV A;  5A90 A;  1O7E A;  4EWF A;  4ZAM A;  3O87 A;  2OWH A;  1F98 A;  3R4K A;  2ZC5 B;  4IUK A;  2R9W A;  3TRC A;  4GNU A;  3E0Y A;  3E4O A;  5CGS A; 
#chains in the Genus database with same CATH homology
 4IUH A;  2QHK A;  3B33 A;  4PKY A;  4GS9 A;  4RQ9 A;  3W2Z A;  1XJ4 A;  5TBM B;  4HJ6 A;  1DP6 A;  5I5L A;  1LSW A;  2KOI A;  1T1A A;  2PT7 A;  3IS2 B;  4LPZ A;  3IS2 A;  3HCY A;  2M7U A;  4Q0I A;  5HDD A;  3RH8 B;  2XSS A;  2PD8 A;  3F1N A;  3KSF A;  4ME4 A;  1XFN A;  2KLI A;  3GEC A;  5HPF A;  2D02 A;  2Y8H A;  2L4R A;  1Y28 A;  2P7J A;  1XJ6 A;  2JKT M;  2VGL M;  1TS0 A;  3S7P A;  4K08 A;  4O01 A;  4R38 A;  3ZYT A;  1IOU A;  4CQH A;  5FL3 A;  3UB6 A;  2EWW A;  2XRO A;  1P0Z A;  2NUT C;  2QWS A;  5AVF A;  3CUE C;  3CWF A;  4CLC D;  3KO6 A;  1N9O A;  1LSX A;  3VV4 A;  4WF0 A;  3EEA A;  3A0V A;  3PYP A;  1DP9 A;  5HZH A;  2YKH A;  3KSH A;  3NOU C;  1UWP X;  4GLQ A;  2VJW A;  1XJ3 A;  2PR6 A;  5F69 A;  2ZOI A;  3D72 A;  2QKP A;  2K2N A;  4KUK A;  3S7N A;  3U2A A;  2LB9 A;  1P9R A;  3HJK A;  1V9Z A;  3IBR A;  3BJN A;  4EEP A;  5DFX A;  3E4P A;  3UE3 A;  3D3O A;  4B9O A;  4UEY A;  4GHI A;  4L9G A;  1S4R A;  4WEJ A;  3UB8 A;  3PBN A;  1F5M A;  4PHT A;  3VE3 A;  2M7V A;  2ZBB A;  4HI4 A;  5C5K A;  4R6L A;  4EES A;  4LLO B;  1NRJ A;  2KX6 A;  3EQU A;  1WA9 A;  3ICY A;  2GJ3 A;  2DMW A;  2W3D A;  3NJA A;  3MJQ A;  2JN7 A;  5HDS A;  5DKL A;  4YOF A;  4HIA A;  4Z1W A;  4II7 A;  1YKD A;  5G4Y A;  4ARZ B;  1N9L A;  2JKR M;  3MFX A;  2VV8 A;  3LR4 A;  3F1N B;  2M1C A;  4KQO A;  1MKM A;  2K31 A;  2HJ9 C;  3LR0 A;  3K2N A;  2PYR A;  3HJI A;  1T1B A;  2B18 A;  3TJZ C;  1OJ5 A;  3LFV A;  4NXF A;  3OC2 A;  1G6O A;  3T4O A;  3F1O B;  4HQA A;  3P01 A;  2W3F A;  3ULF A;  5A8B A;  2CMN A;  3KYZ A;  3MR0 A;  1OPX A;  4MN5 A;  3PBR A;  4CLC B;  3EEH A;  4AFI A;  3KYQ A;  4MN6 A;  4CLC E;  4L0L A;  3PHY A;  2GX5 A;  5IS1 A;  3RFB A;  3LIE A;  1OTA A;  5HL6 A;  3C8C A;  1H8M A;  1H3Q A;  3MQ0 A;  5CX7 A;  5KSH A;  3BW6 A;  5G4Z A;  3CLO A;  3H7W A;  3MQO A;  5MC7 A;  1GSX A;  4F3L B;  4WEK A;  3CI6 A;  1VHM A;  3FC7 A;  2LB5 A;  4NXG A;  3LUQ A;  2V1A A;  4G3W A;  4EEU A;  2W27 A;  3FPW A;  2VV7 A;  2W3H A;  1OT9 A;  3T4K A;  3MQQ A;  2QJ7 A;  2PR5 A;  4WLA A;  2KDK A;  2Z6D A;  2V0U A;  2J3T C;  3C2W A;  3T4J A;  4EER A;  1UGU A;  3CUE A;  4FSF A;  4P6Z S;  1MZU A;  4ARZ A;  4BMW A;  4NKP A;  3ZQ5 A;  3LYX A;  3MMH A;  4NEE D;  2W3G A;  1V9Y A;  2VGL S;  4NXB A;  3TE8 A;  4GW9 A;  4BBU A;  3GDI A;  4HNB A;  1X0O A;  5HSQ A;  2P04 A;  1BYW A;  3C38 A;  3PBQ A;  4BWI A;  1TD5 A;  5AJG A;  4WL9 A;  3P7N A;  1S4S A;  4P6Z M;  4I3A A;  3H82 A;  4EUV A;  2R78 A;  4WEL A;  1TS6 A;  2ZMF A;  2I9V A;  3OOV A;  2XRN A;  2O9C A;  2A24 A;  3UB7 A;  2K7S A;  1JNU A;  5EFW A;  3E98 A;  3T4L A;  4HY8 A;  1EW0 A;  4R70 A;  5F5Y A;  3LR5 A;  2P08 A;  3F1O A;  3K3D A;  4HJ3 A;  4I3I A;  5DJU A;  3EGX C;  4EU0 A;  1N9N A;  1S66 L;  4LRZ E;  4L9F A;  4DMZ A;  1XFQ A;  1NWZ A;  3MF0 A;  3OCL A;  2Z6C A;  3E4Q A;  1S67 L;  4QPR A;  5HD5 A;  3FPV A;  2IA2 A;  4H6J A;  4H6J B;  2H28 A;  4I3J A;  3BY9 A;  4I39 A;  4HH3 A;  2EWV A;  2OOL A;  2VEA A;  1KOU A;  2O99 A;  2PD7 A;  1T19 A;  3LR3 A;  4ETZ A;  3T4T A;  2W1R A;  3BWL A;  5HPI A;  4ETX A;  5DFY A;  3R7W A;  4KQD A;  1D06 A;  3LIF A;  4WUJ A;  1LL8 A;  5F68 A;  1OTE A;  2O9B A;  4EXO A;  4F3L A;  2INW A;  5L8M A;  3A0R A;  3V67 A;  4UQI S;  1OTI A;  5HD3 A;  1IFQ A;  2XA7 M;  2JHE A;  3H7W B;  3S7O A;  1LT0 A;  3T50 A;  3LIA A;  1T18 A;  2PYP A;  4KUO A;  3RTY A;  3JVV A;  1S1Z A;  2GZA A;  2W1T A;  3OBF A;  2A2L A;  2ZOH A;  4OOM A;  3EOI A;  1F9I A;  4HP4 A;  5TJJ A;  2L1M A;  2WKQ A;  4G3K A;  2YKF A;  4LRX C;  5HWV A;  4O0P A;  1OT6 A;  1YSP A;  1ZHH B;  2HGV A;  4MCW A;  3LIC A;  3NOT C;  1NLY A;  4HOI A;  3PBT A;  3H82 B;  1OTD A;  2ZMV A;  2HF6 A;  3TW8 A;  3JVU A;  2W1T B;  1STZ A;  2NUP C;  5AVE A;  3UE6 A;  1ZTU A;  1GSV A;  3KSG A;  4GJ4 A;  3H9W A;  3UMD A;  2VV6 A;  2XA7 S;  3NHQ A;  2FH5 A;  3BQA A;  1D7E A;  4B93 A;  5KIZ A;  2V9A A;  4BBV A;  5DF9 A;  3R7W B;  4R3A A;  2JKR I;  1MC0 A;  1W63 Q;  1GSW A;  2V0W A;  4FOF A;  3A0S A;  4GHI B;  2J80 A;  1T1C A;  3T4S A;  5TBM A;  2MJ6 A;  4O8G A;  4JGQ A;  5HWT A;  4XT2 A;  2V1B A;  3VOL A;  3SW1 A;  4Q0J A;  4DN0 A;  3PXP A;  2WKR A;  5IT5 A;  3S7Q A;  4DJ3 A;  3PR6 A;  3LI9 A;  4Y3I A;  1ODV A;  2FZ0 A;  5DJT A;  2VA0 A;  4IHQ A;  5DKK A;  5HWW A;  1TS7 A;  5LBR A;  5K5B A;  1P97 A;  3NOP C;  1YSQ A;  4GS9 B;  1TF1 A;  3OLO A;  4LRY C;  4HJ4 A;  4JGR A;  2BAS A;  4PAU A;  3UME A;  3G6O A;  3DBA A;  5HDC A;  5F6A A;  2Y79 A;  2A24 B;  4I5S A;  4Y2F A;  2L0W A;  4JGP A;  2G7U A;  1LSV A;  3LI8 A;  3CAX A;  1G28 A;  5J4E A;  4XT2 B;  2VX8 A;  4G3V A;  3KSI A;  2JKT I;  2WKP A;  3F1P A;  2OWJ A;  4E04 A;  3O5Y A;  2J3T D;  2PDR A;  2HJE A;  5IU1 A;  3LIB A;  4HH2 A;  4ZRR A;  3UB9 A;  4CLC A;  4EW7 A;  2D01 A;  4YWZ A;  2VKS A;  1DRM A;  1XJ2 A;  4OOL A;  4YNR A;  4L9E A;  3LID A;  2QYB A;  3EWK A;  3MXQ A;  4MDZ A;  1YAX A;  3VE4 A;  2QJ5 A;  3OCN A;  3EGD C;  4EQ1 A;  3C30 A;  2VLG A;  4EET B;  2J3W A;  3F1P B;  1DP8 A;  1P9W A;  4BJP A;  4DJ2 A;  4BBT A;  1UWN X;  1TS8 A;  2OAP 1;  3PBS A;  4GCZ A;  2EA9 A;  2GNX A;  4MN7 A;  4MMN A;  2OAQ 1;  4UQI M;  3BY8 A;  3KX0 X;  4WN5 A;  1OTB A;  2O0Y A;  4M4X A;  3PBO A;  5J3W A;  4HHD A;  3B47 A;  4IJG A;  4JGO A;  3CIT A;  4I38 A;  1S1Y A;  1VB6 A;  3K3C A;  4NXE A;  2HV1 A;  3EQV A;  4Q0H A;  4CLC C;  2B02 A;  4Y5F A;  2W3E A;  1NLZ A;  2PHY A;  3IBJ A;  4PKY G;  1OJG A;  2OWH A;  2O9A A;  1F98 A;  3R4K A;  1W63 M;  5J7E A;  4IUK A;  3B42 A;  3TRC A;  3BQ8 A;  4HP9 A;  2W0N A;  3E0Y A;  3E4O A;  3FG8 A;  3T4Q A;  2VZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...