3B42A

Periplasmic sensor domain of chemotaxis protein gsu0935
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
126
Chain Sequence
SSLDLQLKNARNLAGLIIHDIDGYMMKGDSSEVDRFISAVKSKNFIMDLRVFDEQAKEVSPTPSQTPNAKIQQAIAAGRTLEFKETLDGKRTLSLVLPFPNEQRCQSCHDAGAAYLGGLLVTTSIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyl-accepting chemotaxis protein, putative
publication title Structures and solution properties of two novel periplasmic sensor domains with c-type heme from chemotaxis proteins of Geobacter sulfurreducens: implications for signal transduction.
pubmed doi rcsb
source organism Geobacter sulfurreducens
molecule tags Signaling protein
total genus 33
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.290 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3b42A00
3B47A 3B42A
chains in the Genus database with same CATH superfamily
4OP8A 5J4EA 1K55C 1LHYA 3VFHA 3EEAA 1K54A 3SS5A 3PBTA 5CXWA 4GZBA 1YLWA 4PM8A 4DXCA 3ZQ5A 3U2AA 2ZM0A 4PKYA 1W79A 3SH9A 4DDYA 4F94A 1YLPA 1H0MA 3SS3A 1CEGA 5HFOA 4KZ5A 5EM1A 2FH5A 3T4JA 2PU4A 4IHQA 4DMZA 4EV4A 3HUOA 4JGQA 5GHYA 2OLVA 1XJ2A 1QMFA 3BM6A 2B02A 4QWOA 4NETA 3IXGA 5GHZA 5KSHA 4EETB 5F1FA 4DE3A 4BBVA 4DXBA 2M7UA 2VGJA 2O99A 5AQAA 3V67A 3G31A 2KX6A 4S2IA 4YFMA 3LUQA 1PFLA 5L10A 3MF0A 3CZDA 4ZDXA 5IU1A 4HQAA 3SH8A 4E6XA 1HVBA 5DKKA 4BBUA 2ZC5B 4L9GA 1YT4A 2HV1A 3GSGA 3T4OA 4CLCE 3BFEA 1ZTUA 3P7NA 5E2FA 3DWZA 4KZBA 2DNSA 1OJ5A 4Q0JA 4R1GA 1XA7A 4H6JB 4PM7A 4WF0A 5HSQA 4Y13A 4ZBEA 3QHYA 4QB8A 4G3KA 4Z1WA 3WS0A 2WKIA 1TDLA 3BFFA 5HWTA 2JE5A 2JN7A 3TJZC 5FL3A 1OTEA 3F1PA 3V50A 2WZZA 5DKLA 3UMDA 1UWPX 2ZQAA 1SCWA 1CEFA 2ZMAA 4DF6A 5DF7A 1XKZA 3KYQA 2XLNA 3PBRA 3VFFA 5EECA 4EQ1A 1EW0A 4BL3A 2JBFA 5G4YA 3EQVA 2VA0A 2HP5A 2J8YA 1E3UA 3G2YA 1ES4A 4WZ5A 2OWJA 5KSCA 5HPIA 4OP5A 4XXRA 1YSQA 3FYZA 4XT2A 1Y4OA 4R4RA 3PHYA 3IXDA 1JWVA 4K0WA 4X68A 3VP4A 3OPRA 4GD6A 4ME4A 5L07A 4UQIM 4CLCB 3M2JA 3G6OA 2HPBA 4DE2A 3MJQA 3MXQA 4P6BA 4BD1A 1HZOA 4EESA 2AVXA 2GNXA 4S2LA 4HESA 2V9AA 3MZEA 1ES2A 1OT9A 3QNCA 1VQQA 4Y15A 2E8JA 4BBTA 1YMXA 2W27A 2ZLYA 3G34A 4X1LA 1AWIA 3FG8A 3VE3A 2Y2GA 3NHQA 1H3QA 3NDGA 2VLGA 4NXEA 4JLFA 1OTDA 4GLQA 3R7WA 2FZ0A 5FATA 2WKQA 4HEFA 1T19A 1ONHA 1DP6A 2HDUA 4P87A 5CGXA 3LIEA 5HX9A 4CLCD 3S22A 2QHKA 1NWZA 1NLZA 2D01A 2PAVP 3IX4A 5BOHA 3WS1A 2W3EA 4P0MA 1P9RA 2W3FA 4JXWA 5FASA 5CHJA 2Y4AA 4RX2A 4B4ZA 1O07A 1RGYA 5J3WA 4KUKA 1BLCA 3B42A 3LI8A 4E3MA 2B95A 2RCXA 4WEKA 3E4OA 3BY8A 2ZQDA 2PD7A 4R4SA 1NRJA 1MZUA 1G28A 4ETZA 1K25A 4WYYA 3GV9A 3VOLA 1JNUA 2L1MA 5HL1A 3F1PB 3C38A 3DWKA 1LL8A 3HVFA 5IT5A 2V8CA 4ZJ3A 2WKHA 2B5RA 1W7FA 3IX8A 1CJFA 3E4PA 3HJIA 4WM9A 4U3TA 3PAGA 3RJUA 3CHWP 4XT2B 3WWXA 4KQRA 3LY4A 3FKWA 4QY6A 4EERA 1NZOA 5DF8A 2XF3A 4M4XA 3EOIA 3QP4A 2Y2HA 2W1RA 2WUQA 3Q81A 5AQ7A 2VV6A 3BRMA 1LI9A 4HOIA 3VSKA 3VP3A 4DE1A 1DJCA 3MSHA 3LY3A 4I3AA 2ZMFA 1OTAA 3I7JA 2EX9A 4LV3A 4JGRA 4JGOA 2Q9NA 1YKDA 1ERMA 2XA7M 4EUVA 1YLJA 4P85A 3B3XA 1Z09A 1KE0A 5A92A 4N9KA 3GR2A 1SDNA 5FAQA 4N9LA 1E3UD 3H7WA 3W2ZA 2WGVA 4YOFA 1D1JA 5F69A 4LPZA 4KZ4A 1ZG4A 2XFTA 3NOPC 1FQGA 5CECA 1EROA 2K7SA 4WEJA 3R7WB 2INWA 1K57A 4CPKA 3KYZA 3QP8A 3RXXA 3SH7A 2WADA 5AQ9A 1F5MA 3CG5A 1L0GA 1NRFA 4WELA 4OPQA 1TF1A 1GSWA 1WYCA 1ONGA 1PI5A 4S2NA 3OOVA 3C4PA 4BQMA 1IEMA 2XK1A 2W0NA 1FOFA 4CQHA 1IYSA 3A3EA 2X71A 4RA7A 5EV0A 4JGPA 1K55A 2Z6CA 4PMAA 2O0YA 2VGLM 2EA9A 4EBLA 3T4QA 3BW6A 4XUZA 2BLSA 1W8YA 3A0RA 2XR0A 3NJAA 3JVUA 2WGWB 3OPPA 4D60A 1W5DA 1OJGA 3M6BA 1XGIA 2EWWA 5HDSA 1KE3A 2BTFP 2V1AA 3PBSA 5FQKA 1YM1A 2XQZA 4FTXA 4KZ8A 2QYBA 1DP8A 4LV0A 2RL3A 2ZM2A 1SZVA 2PBDP 3NDEA 2JKGA 2ZJ9A 5HWWA 5EFWA 2P74A 4N1XA 3LGOA 2M7VA 1SKFA 3E4QA 2K2NA 3D4FA 3LICA 3G35A 1A0KA 3UE0A 3NULA 4Y2FA 3BY9A 3KYEA 5GLBA 2J3TD 2KLIA 4WLAA 3ZVWA 4I5SA 3OCNA 1MWTA 4G3WA 4ID4A 1PW1A 3MKFA 1K6SA 1X0OA 3MZFA 3ZDJA 4YINA 2PBYA 4MBFA 1H8MA 1UGUA 5EM0A 2VGKA 3C5AA 3QP5A 4HBTA 1BULA 5EPHA 4UA9A 1NXYA 3S7OA 3VP0A 2P7JA 4BD0A 4P6ZM 4ETXA 2HJEA 1K38A 2P9VA 3LR0A 4Y0OA 3T50A 1ESUA 3VV4A 3ZCZA 3H7WB 3TW8A 3WRZA 3AGFA 4OPYA 5DTTA 1STZA 2EX8A 1JTDA 2EXBA 4HY8A 1FCNA 4CLCA 3IH8A 2HP9A 3W4OA 3ZHHA 3N4IA 5IHVA 4X56A 3C8CA 2NUTC 4K08A 4E3OA 4KQOA 5E2EA 4IEDA 1K0KA 5EVEA 3CWFA 4HJ4A 4Q0IA 1ALQA 4KG2A 4B93A 2XRNA 4I38A 4GDNA 1KDSA 3A3FA 5EUAA 1KVLA 4R3AA 4Y0TA 4EXOA 1PNEA 5I5LA 4MMNA 1GSVA 3ISGA 2B18A 2NUPC 1ZG6A 2FFYA 3KSHA 4X25A 1PYYA 5CGSA 5F68A 3C7VA 4FH4A 3KX0X 4G3VA 2H10A 2ZM8A 4GS9A 5CTNA 5HL6A 4OLGA 4RYEA 4HHDA 4EU0A 1O7EA 1KGFA 2OWHA 4UEYA 1SDEA 4LFUA 1L2SA 2ZC7A 5LBRA 2HJ9C 4HIAA 2WAFA 3VOZA 1LL5A 1Y28A 4JXSA 1ES5A 1XGJA 3HREA 3K2NA 4KUOA 3L9KA 3PTEA 5EVLA 4OOYA 3FPVA 4IVKA 5CERA 1VETA 2H0TA 3CUEC 3UDXA 1FIKA 3IXHA 1BLSA 2GJ3A 4GNUA 4EBNA 4E6WA 4R6LA 2W3DA 2XEPA 3HLEA 1MKIA 2QJ5A 1OTIA 2Y79A 4R3JA 3HLCA 4NXGA 1YPRA 5TFQA 4K0XA 4EW7A 1N9BA 3S7PA 1D7EA 1V9ZA 5A93A 5G4ZA 4PHTA 2ZOIA 4O7DA 1YQSA 3LCEA 2I9VA 5EOOA 2JKRM 4Y0UA 5FA7A 5DVAA 1RGZA 3CPTA 3ITBA 1ES3A 2IWDA 4GDBA 2GX5A 3GTCA 2P04A 2Y2NA 3M6HA 3WS4A 4LV2A 3ZG7B 1S4RA 2OAQ1 2QZ6A 1PRQA 1I5QA 2PHYA 4LENA 1VB6A 5CRFA 4KG6A 3PXPA 1S0WA 2R9XA 3HLFA 3HLBA 3FZCA 4E3LA 3GDIA 2P9VB 3FWLA 1MPLA 1FILA 4MDZA 1K54C 2H5SA 3BFGA 3N8LA 1MXOA 4KZ9A 1NYMA 1SHVA 5CHUA 3KSFA 1ACFA 3MZDA 3IWQA 4UAAA 2HF6A 2M1CA 4H8RA 3FPWA 1XJ4A 4OOLA 2FFFB 4X53A 3UDFA 1ERQA 2VJWA 2EX2A 3T1RA 3F1NA 1HTZA 1IYQA 2O9CA 3HLDA 2QJ7A 3C7UA 2P08A 3N8SA 1W63M 3IX3A 5HD5A 1BLHA 4PM9A 3BQ8A 2Y2LA 3VMAA 3UB6A 3EGDC 1L0DA 4D2OA 4EUZA 3ZFZA 1D06A 1ESIA 4M3KA 1S4SA 4GCZA 3R4KA 2R9WA 3UE3A 2PYRA 2IA2A 2I72A 2Z2MB 1IYPA 4GS9B 3ZG9B 3Q07A 4PM5A 5TR7A 2A49A 4X69A 4GJ4A 1GA0A 1IFQA 3GRJA 2JC7A 4MEZA 3G2ZA 5FI6A 2C6WB 4OQGA 3NCKA 4OLDA 1FR1A 1PWGA 1CI8A 5HZHA 1VETB 4OH0A 1MWUA 4MBKA 2X01A 3RTYA 3UB8A 3P98A 3NC8A 1T18A 2GZAA 5TJJA 3F1OA 2OLUA 3LIFA 2R78A 5HDDA 2JHEA 4B4XA 3B47A 2EFUA 4KZ6A 5FDSA 1MY8A 1S6RA 2A2LA 2HGVA 2WGWA 2J9PA 3O3VA 3IWIA 4Y7PA 3NOTC 5F5YA 2YKHA 5E2HA 1ZKJA 2VZWA 3QNBA 5FQJA 3GVBA 3LI9A 5DF9A 2PD8A 4F3LB 3IXBA 1Z6FA 3CPTB 1KVMA 3S7NA 5HARA 4DJ2A 1YSPA 3ZNYA 3N6IA 3EQUA 4QPRA 3ULFA 3KO6A 4NKPA 5FAOA 2PDRA 3HLGA 1YMSA 5EVIC 4Q8IA 2E8IA 5DTSA 4II7A 4DN0A 3FKVA 4NG2A 4HH2A 4BENA 4U0XA 1ODVA 2OSUA 3HL9A 4ARZA 3PYPA 5AVFA 3SOIA 4GD8A 3F1NB 1JWPA 2ZMVA 4YNRA 2ZQ7A 4OOMA 2V8FA 1MKMA 3BFCA 3MQ0A 3C2WA 4S2JA 1F98A 4LRXC 4QHCA 3N7WA 2OOLA 1T1BA 3DAVA 2WYXA 3A3JA 3HJKA 3ZGAB 3MQQA 1DY6A 1NY0A 4FCFA 4JXVA 4MLLA 2Y2JA 3LEQA 1BTLA 1XPBA 3A3IA 4I39A 5FQ9A 2J7VA 1JTGA 1PI4A 1G6OA 2XDMA 4MN5A 3KSGA 1J9MA 3WS5A 2ZD8A 1H8YA 3LR4A 1PZPA 4GW9A 3ZVTA 4HNBA 4IUKA 2Y2IA 5FQMA 1S67L 2IWCA 5DJTA 5AVEA 1P0ZA 4LRYC 1TVFA 4Y17A 4FUWA 1MWSA 1YLTA 1K6RA 4IJGA 3ZG5A 4OPZA 4EEPA 3F1OB 1XX2A 3UE1A 1OMEA 1MWRA 1F2KA 3G32A 1VHMA 3E2KA 2HZ5A 5F82A 3W4PA 4JBFA 5MC7A 1N9OA 2V1BA 1XA1A 2ZC4B 3DBAA 3UB7A 3LR5A 4LCLA 4NEED 3V3RA 4KENB 1YLYA 4R23A 3LIAA 4ESPA 3C4OA 1NJ4A 3T12B 2ZQ9A 1XJ3A 2V2FF 5CGWA 3MKEA 1OPXA 3IF6C 4X1MA 1NLYA 3TOIA 2O9BA 2V1ZA 3LO7A 2H28A 1HD8A 1PWCA 1DRMA 3HCYA 4KZ7A 3BLSA 5FI7A 2ZQ8A 2Z6DA 4FOFA 4EEUA 2VX8A 3SS4A 1CI9A 3CUEA 3P09A 2V0UA 5DTKA 5FEFA 2XD5A 1ZHHB 1GSXA 2A3UA 3LFVA 4ARZB 1U60A 1C3BA 2J9OA 4Y5FA 1IKGA 2JKRI 2OV5A 3PBNA 1TEMA 3OLOA 5FDHA 1GHIA 1LLBA 4ZTKA 1WYBA 3NI9A 3Q7VA 2YKFA 2WAEA 1M40A 3QP1A 4JF5A 3UPNA 1Q2QA 3IBJA 4YWZA 2ZOHA 3FV7A 4R38A 4IUHA 5U47A 4DJ3A 4E3KA 3AGDA 1L0EA 4OQHA 3G30A 4L9EA 2JKTM 2XGNA 1IOUA 1FSWA 4WZ4A 5FQIA 2XSSA 3NY4A 4MN6A 5HDCA 2Y55A 1GA9A 1IYOA 4R3BA 4RQ9A 3UPPA 3VP2A 1Q2PA 3UB5P 1LT0A 1K56A 3IQAA 2Y8HA 1LSWA 4K91A 1BLPA 2CMNA 1IELA 3T4TA 1BSGA 4KQQA 4QJGA 4RVAA 5JYPA 1M6KA 1EWZA 3B33A 3OPHA 5L8MA 3TE8A 5KMWA 2V0WA 2QPNA 3PBQA 5GHXA 1XJ6A 1W63Q 1XFNA 2BASA 1PW8A 1L0FA 3PR6A 3N8RA 4FH2A 4FD8A 4JF4A 1N9NA 4LGWA 4OQIA 3CMZA 5J7EA 1TD5A 3ICYA 5AJGA 3IWOA 3LIDA 3EWKA 3SZTA 4C75A 3O86A 4BL2A 3CJMA 5GL9A 3A0VA 2A24A 1UWNX 4E04A 4WBGA 1HLUP 4R70A 2Y2KA 2C5WB 5HW3A 4O0PA 1V9YA 4BWIA 3BJNA 2MJ6A 3V5MA 3NOUC 1NZUA 3E98A 3ZNTA 1LSXA 1IKIA 2JKFA 4QU3A 3NIAA 3BLMA 3ZG8B 3TG9A 3G4PA 1FCMA 3OPLA 4BLMA 5A90A 3IT9A 3GECA 3T4SA 3QP2A 5EE8A 4LCMA 1XP4A 3HBRA 1FCOA 1LL9A 2L0WA 4B88A 1N4OA 5E43A 4F3LA 1NYYA 1BYWA 4O01A 3JPUA 1P9WA 5FI2A 3UPOA 1KDWA 2WZXA 1BZAA 2WKEA 4WN5A 3O88A 1YAXA 4U0TA 2W1TA 3IF5A 2K31A 3DTEA 4KZAA 3UY6A 5GLCA 2PT7A 1JVJA 2G2UA 3Q7VB 1Y54A 4CLCC 3MFXA 4L0LA 4UQIS 4CJNA 4JPMA 2ZBBA 1XFQA 1QMEA 2JCHA 5EOEA 4MBHA 5F83A 1J3WA 4E3NA 2PYPA 1OTBA 3CLOA 4KG5A 4NXFA 5HD3A 4PM6A 1GHPA 4OPRA 1ZC2A 3LEZA 2UWXA 5HAQA 4S2OA 1EI5A 2LB9A 5KZHA 1CQAA 1S1YA 3TRCA 3PBOA 4UA7A 2Y59A 4S2MA 5J8XA 2UV0E 2VKSA 3C30A 2CC1A 5FEGA 5EVIA 1I2WA 5M19A 2ZL1A 3ZYTA 4UA6A 2XD1A 2Q9MA 4E3IA 4KZ3A 3UNWA 3MR0A 4DRTA 5CEDA 4I3IA 2ZQCA 4HJ3A 5CTMA 4N1HA 1KGEA 5F1GA 4BJPA 2WKPA 2PU2A 3WS2A 4DE0A 4GN2A 5TGFA 3DTMA 4WMCA 5CHMA 1K4EA 5E2GA 3VE4A 2G2WA 4KQDA 4RX3A 2QWSA 4HP9A 1FSYA 3LYXA 5M18A 4ZJ2A 1LI0A 4EWFA 3W4QA 3V39A 2A24B 4A5RA 2LB5A 1PWDA 4JKTA 3IHAA 2WGIA 1CF0A 1H5XA 3BYDA 3V3SA 3SW1A 1G68A 4DDSA 5IS1A 3OCLA 3OBFA 2J3WA 3S1YA 4IVIA 1FR6A 4OQ0A 4OVDA 1K56D 3QP6A 3VSLA 3BWLA 1I2SA 5A8BA 3JYIA 3IS2A 3O87A 4IBXA 5CEBA 4ZJ1A 3MXSA 3IBRA 1AXBA 2DCFA 4ZRRA 5HPFA 1KOUA 4HBUA 1T1CA 3VP1A 2V20A 3E2LA 5CX7A 3GMWA 3T1QB 1KGGA 4GKUA 4B9OA 1TS7A 4HP4A 4WZ5C 5L2FA 1GCEA 2WK0A 4Q0HA 3CITA 4O8GA 4LLOB 1XXMA 4NK3A 3JVVA 1OT6A 2HP6A 2VV8A 3CI6A 2G7UA 3RH8B 2X02A 4GOGA 2W1TB 4MNRA 4WUJA 2EFXA 3HLWA 2D02A 5AQBA 2HDQA 1N9LA 5GLAA 3H82A 1SKOA 3MXRA 5TBMA 2PRFA 3P01A 2HDRA 4N92A 4XUXA 3M2KA 3IH9A 2XFSA 3U4LP 5F6AA 3DW0A 4IBRA 2KDKA 3Q82A 2Q0OA 2XA7S 3GQZA 4JF6A 4X55A 1VEUA 4R0QA 4BMWA 3IF6A 3D9YA 1P97A 3UO9A 1F9IA 5FSRA 2PR6A 5FAPA 4GHIA 3FC7A 2VV7A 2EX6A 5EVIB 2HDSA 3T4KA 2ZL1B 5DFYA 5HWVA 1PZOA 4QY5A 1DP9A 1L3LA 1LSVA 5L09A 4EQIA 3UMEA 4I3JA 2ZC6B 3MMHA 2Y2OA 2XH9A 3BFDA 3MBZA 3H9WA 3S4XA 4JXGA 4QD4A 1S1ZA 1WE4A 2GDNA 2VEAA 3RFBA 2VK3A 3ITAA 2ZC3B 4WL9A 1GHMA 3MQOA 4C6YA 4ZAMA 5HAIA 2L4RA 2JKTI 4LV1A 2WKRA 3LIBA 2BG1A 2ACGA 2J3TC 1E25A 4C3QA 5M1AA 3UDIA 3MS6A 5G18A 1BT5A 3Q7ZA 2XROA 4OONA 2VGLS 3S7QA 4PAUA 5DJUA 3W8KA 1G5UA 3UB9A 1PIOA 5EVID 1DJBA 3RXWA 4AFIA 3D72A 3EGXC 1TS0A 3IS2B 4LRZE 2Y2MA 3EEHA 4Z9QA 4HJ6A 2KOIA 2H0YA 3WRTA 3K3CA 4NXBA 5FQQA 1DJAA 5K5BA 3O5YA 2W3GA 4WMCD 2IWBA 4MN7A 5DFXA 1RCJA 3DTIA 3MFDA 1KE4A 3PAEA 1WA9A 1W8QA 4Y3IA 5JYOA 3BEBA 2DMWA 4MCWA 2Y2PA 1BUEA 3K3DA 3L7HA 2EXAA 4PKYG 5I94A 3A3DA 3H82B 1SKOB 3KSIA 4X6TA 4HH3A 4EBPA 3IHBA 3UE6A 1G6AA 5TBMB 3NBLA 3T4LA 3VOYA 4FSFA 4S2PA 4H6JA 5GLDA 3TSGA 1YLZA 4HI4A 1E4DA 5C5KA 1CK3A 2DRWA 3NECA 1T1AA 1MBLA 2QMIA 2Y2QA 3UN7A 4P6ZS 1VEUB 1H8ZA 3IF6B 3ZG0A 3T1XA 3HUNA 4DKIA 2QKPA 3DTKA 4UHUA 2O9AA 1MC0A 4GHIB 3AGEA 5HAPA 3CAXA 3OC2A 1TS8A 3LR3A 3OZHA 3T1SA 1TS6A 5D3OA 2J80A 1VM1A 1K57C 1RP5A 2W3HA 3A0SA 5KIZA 4PPRA 3BQAA 3D3OA 3Q1FA 4E3JA 4L9FA 2PR5A 4S2KA 1TDGA 3HUMA 3BECA 2EWVA 4S2NC 2Y91A 1S66L 4GB7A 1JWZA 5A91A 1K4FA 2Z2LB 3E0YA 4OKPA 2OAP1
chains in the Genus database with same CATH topology
5J4EA 2ZBBA 3LI9A 1XFQA 4JGPA 3EEAA 5DF9A 2PD8A 4F3LB 3PBTA 2Z6CA 2PYPA 1OTBA 2O0YA 3ZQ5A 3S7NA 3U2AA 2VGLM 3CLOA 4DJ2A 4NXFA 4PKYA 5HD3A 2EA9A 3T4QA 3BW6A 1YSPA 3A0RA 2FH5A 3T4JA 3NJAA 3EQUA 3JVUA 4QPRA 1OJGA 2LB9A 3ULFA 1S1YA 3KO6A 4IHQA 4NKPA 3TRCA 2EWWA 3PBOA 4DMZA 5HDSA 2PDRA 2V1AA 2VKSA 3C30A 3PBSA 4JGQA 1XJ2A 2QYBA 4II7A 1DP8A 2B02A 4DN0A 3ZYTA 5KSHA 4HH2A 4EETB 4BBVA 3MR0A 2M7UA 2O99A 1ODVA 3V67A 5EFWA 5HWWA 4I3IA 2KX6A 4HJ3A 4ARZA 3LUQA 2M7VA 3MF0A 3PYPA 5AVFA 3E4QA 2K2NA 5IU1A 3LICA 4BJPA 3F1NB 4HQAA 2WKPA 2ZMVA 4YNRA 5DKKA 4Y2FA 3BY9A 4BBUA 2J3TD 4OOMA 2KLIA 4L9GA 4WLAA 4I5SA 1MKMA 3OCNA 3VE4A 4G3WA 3MQ0A 3C2WA 2HV1A 4KQDA 1F98A 4LRXC 3T4OA 2QWSA 4HP9A 1X0OA 4CLCE 3LYXA 1ZTUA 2OOLA 1T1BA 3P7NA 2A24B 1H8MA 3HJKA 1UGUA 1OJ5A 4Q0JA 3MQQA 4H6JB 2LB5A 4WF0A 5HSQA 4G3KA 3SW1A 5IS1A 4Z1WA 3OCLA 3OBFA 2J3WA 4I39A 3S7OA 2P7JA 4P6ZM 5HWTA 4ETXA 1G6OA 2JN7A 3BWLA 2HJEA 3TJZC 5A8BA 4MN5A 5FL3A 3IS2A 3KSGA 3LR0A 3LR4A 1OTEA 3F1PA 3T50A 4GW9A 4HNBA 3IBRA 5DKLA 3UMDA 4IUKA 3VV4A 1UWPX 3H7WB 4ZRRA 5HPFA 1KOUA 3TW8A 1S67L 5DJTA 1T1CA 3KYQA 3PBRA 1STZA 5AVEA 1P0ZA 4EQ1A 4LRYC 4HY8A 1EW0A 4CLCA 5G4YA 3EQVA 5CX7A 2VA0A 4B9OA 1TS7A 4HP4A 4IJGA 3C8CA 2NUTC 4Q0HA 4K08A 3CITA 3F1OB 4EEPA 4O8GA 4KQOA 4LLOB 2OWJA 3JVVA 5HPIA 1YSQA 1OT6A 4XT2A 3CI6A 2VV8A 3CWFA 2G7UA 3RH8B 3PHYA 1VHMA 4HJ4A 2W1TB 4WUJA 4Q0IA 4B93A 2XRNA 5MC7A 4I38A 4CQHA 2D02A 4ME4A 1N9OA 1N9LA 2V1BA 4R3AA 4UQIM 4CLCB 4EXOA 3H82A 3G6OA 3MJQA 5I5LA 3DBAA 1GSVA 3MXQA 2B18A 4MMNA 2NUPC 3LR5A 3UB7A 4NEED 5TBMA 3KSHA 4EESA 5F68A 3P01A 3LIAA 2GNXA 1XJ3A 3KX0X 4G3VA 2V9AA 5F6AA 4GS9A 5HL6A 1OT9A 2KDKA 4HHDA 4EU0A 2XA7S 2OWHA 4UEYA 1OPXA 4BBTA 1NLYA 2W27A 5LBRA 2HJ9C 4HIAA 4BMWA 2O9BA 1P97A 1F9IA 2H28A 1Y28A 2PR6A 3FG8A 1DRMA 3K2NA 3HCYA 4GHIA 4KUOA 3VE3A 3FC7A 2VV7A 3FPVA 2Z6DA 4FOFA 4EEUA 2VX8A 3NHQA 1H3QA 3CUEC 3T4KA 5DFYA 2VLGA 2GJ3A 4NXEA 3CUEA 4R6LA 2V0UA 2W3DA 5HWVA 1OTDA 4GLQA 1ZHHB 1GSXA 1DP9A 1LSVA 2QJ5A 1OTIA 3LFVA 2FZ0A 3R7WA 3UMEA 4I3JA 4ARZB 2WKQA 2Y79A 3MMHA 1T19A 4NXGA 4Y5FA 1DP6A 3H9WA 3LIEA 2JKRI 4CLCD 4EW7A 1S1ZA 3S7PA 1D7EA 3PBNA 2QHKA 2VEAA 3RFBA 1V9ZA 1NWZA 1NLZA 2D01A 3OLOA 2W3EA 5G4ZA 4PHTA 2ZOIA 4WL9A 1P9RA 2YKFA 3MQOA 2W3FA 2L4RA 2JKTI 2WKRA 3LIBA 2I9VA 2JKRM 2J3TC 3IBJA 4YWZA 5J3WA 2ZOHA 4R38A 4IUHA 4KUKA 4DJ3A 2GX5A 2P04A 3B42A 3LI8A 2XROA 2VGLS 4L9EA 3S7QA 2JKTM 1IOUA 1S4RA 4PAUA 5DJUA 2OAQ1 4WEKA 2PHYA 3E4OA 3BY8A 3UB9A 2XSSA 2PD7A 1VB6A 4MN6A 3PXPA 1NRJA 1MZUA 5HDCA 4AFIA 1G28A 4ETZA 3D72A 3EGXC 1TS0A 3GDIA 3IS2B 3VOLA 1JNUA 2L1MA 4LRZE 3F1PB 4RQ9A 4MDZA 3EEHA 1LT0A 3C38A 2Y8HA 1LSWA 1LL8A 4HJ6A 2KOIA 5IT5A 3KSFA 2CMNA 3T4TA 3K3CA 4NXBA 2HF6A 2M1CA 5K5BA 3B33A 3FPWA 3O5YA 1XJ4A 4OOLA 2W3GA 4MN7A 5DFXA 5L8MA 3TE8A 3E4PA 3HJIA 2V0WA 2VJWA 3PBQA 3F1NA 1XJ6A 1W63Q 1XFNA 2BASA 1WA9A 4XT2B 2O9CA 3PR6A 4Y3IA 1N9NA 4EERA 5J7EA 2DMWA 2QJ7A 4M4XA 2P08A 1TD5A 1W63M 3EOIA 3ICYA 4MCWA 5AJGA 5HD5A 3LIDA 3EWKA 3K3DA 2W1RA 3BQ8A 3UB6A 3EGDC 4PKYG 2VV6A 1D06A 3H82B 3KSIA 4HH3A 4HOIA 3UE6A 1S4SA 5TBMB 3A0VA 2A24A 1UWNX 3T4LA 4GCZA 4E04A 4FSFA 4I3AA 4H6JA 3R4KA 3UE3A 4R70A 2ZMFA 1OTAA 2PYRA 2IA2A 4HI4A 4O0PA 1V9YA 4JGRA 5C5KA 4BWIA 3BJNA 4JGOA 2MJ6A 4GS9B 1T1AA 1YKDA 2XA7M 3NOUC 4EUVA 4GJ4A 3E98A 1IFQA 1LSXA 4P6ZS 2QKPA 2O9AA 1MC0A 4GHIB 3CAXA 3H7WA 3W2ZA 3GECA 3OC2A 4YOFA 5HZHA 3T4SA 1TS8A 3LR3A 1TS6A 4LPZA 5F69A 3NOPC 2J80A 2L0WA 3RTYA 3UB8A 2K7SA 1T18A 2W3HA 4F3LA 2GZAA 4WEJA 5TJJA 3R7WB 2INWA 3A0SA 1BYWA 4O01A 5KIZA 3KYZA 3F1OA 1P9WA 3BQAA 3D3OA 3LIFA 2R78A 5HDDA 2JHEA 3B47A 4L9FA 2PR5A 4WN5A 1F5MA 1YAXA 2W1TA 2EWVA 2HGVA 2A2LA 4WELA 2K31A 1TF1A 1GSWA 1S66L 3OOVA 2PT7A 2W0NA 4CLCC 3NOTC 3MFXA 5F5YA 4L0LA 3E0YA 2YKHA 4UQIS 2VZWA 2OAP1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B47 A;  3B42 A; 
#chains in the Genus database with same CATH topology
 4OP8 A;  5J4E A;  1K55 C;  1LHY A;  3VFH A;  3EEA A;  1K54 A;  3SS5 A;  3PBT A;  5CXW A;  4GZB A;  1YLW A;  4PM8 A;  4DXC A;  3ZQ5 A;  3U2A A;  2ZM0 A;  4PKY A;  1W79 A;  3SH9 A;  4DDY A;  4F94 A;  1YLP A;  1H0M A;  3SS3 A;  1CEG A;  5HFO A;  4KZ5 A;  5EM1 A;  2FH5 A;  3T4J A;  2PU4 A;  4IHQ A;  4DMZ A;  4EV4 A;  3HUO A;  4JGQ A;  5GHY A;  2OLV A;  1XJ2 A;  1QMF A;  3BM6 A;  2B02 A;  4QWO A;  4NET A;  3IXG A;  5GHZ A;  5KSH A;  4EET B;  5F1F A;  4DE3 A;  4BBV A;  4DXB A;  2M7U A;  2VGJ A;  2O99 A;  5AQA A;  3V67 A;  3G31 A;  2KX6 A;  4S2I A;  4YFM A;  3LUQ A;  1PFL A;  5L10 A;  3MF0 A;  3CZD A;  4ZDX A;  5IU1 A;  4HQA A;  3SH8 A;  4E6X A;  1HVB A;  5DKK A;  4BBU A;  2ZC5 B;  4L9G A;  1YT4 A;  2HV1 A;  3GSG A;  3T4O A;  4CLC E;  3BFE A;  1ZTU A;  3P7N A;  5E2F A;  3DWZ A;  4KZB A;  2DNS A;  1OJ5 A;  4Q0J A;  4R1G A;  1XA7 A;  4H6J B;  4PM7 A;  4WF0 A;  5HSQ A;  4Y13 A;  4ZBE A;  3QHY A;  4QB8 A;  4G3K A;  4Z1W A;  3WS0 A;  2WKI A;  1TDL A;  3BFF A;  5HWT A;  2JE5 A;  2JN7 A;  3TJZ C;  5FL3 A;  1OTE A;  3F1P A;  3V50 A;  2WZZ A;  5DKL A;  3UMD A;  1UWP X;  2ZQA A;  1SCW A;  1CEF A;  2ZMA A;  4DF6 A;  5DF7 A;  1XKZ A;  3KYQ A;  2XLN A;  3PBR A;  3VFF A;  5EEC A;  4EQ1 A;  1EW0 A;  4BL3 A;  2JBF A;  5G4Y A;  3EQV A;  2VA0 A;  2HP5 A;  2J8Y A;  1E3U A;  3G2Y A;  1ES4 A;  4WZ5 A;  2OWJ A;  5KSC A;  5HPI A;  4OP5 A;  4XXR A;  1YSQ A;  3FYZ A;  4XT2 A;  1Y4O A;  4R4R A;  3PHY A;  3IXD A;  1JWV A;  4K0W A;  4X68 A;  3VP4 A;  3OPR A;  4GD6 A;  4ME4 A;  5L07 A;  4UQI M;  4CLC B;  3M2J A;  3G6O A;  2HPB A;  4DE2 A;  3MJQ A;  3MXQ A;  4P6B A;  4BD1 A;  1HZO A;  4EES A;  2AVX A;  2GNX A;  4S2L A;  4HES A;  2V9A A;  3MZE A;  1ES2 A;  1OT9 A;  3QNC A;  1VQQ A;  4Y15 A;  2E8J A;  4BBT A;  1YMX A;  2W27 A;  2ZLY A;  3G34 A;  4X1L A;  1AWI A;  3FG8 A;  3VE3 A;  2Y2G A;  3NHQ A;  1H3Q A;  3NDG A;  2VLG A;  4NXE A;  4JLF A;  1OTD A;  4GLQ A;  3R7W A;  2FZ0 A;  5FAT A;  2WKQ A;  4HEF A;  1T19 A;  1ONH A;  1DP6 A;  2HDU A;  4P87 A;  5CGX A;  3LIE A;  5HX9 A;  4CLC D;  3S22 A;  2QHK A;  1NWZ A;  1NLZ A;  2D01 A;  2PAV P;  3IX4 A;  5BOH A;  3WS1 A;  2W3E A;  4P0M A;  1P9R A;  2W3F A;  4JXW A;  5FAS A;  5CHJ A;  2Y4A A;  4RX2 A;  4B4Z A;  1O07 A;  1RGY A;  5J3W A;  4KUK A;  1BLC A;  3B42 A;  3LI8 A;  4E3M A;  2B95 A;  2RCX A;  4WEK A;  3E4O A;  3BY8 A;  2ZQD A;  2PD7 A;  4R4S A;  1NRJ A;  1MZU A;  1G28 A;  4ETZ A;  1K25 A;  4WYY A;  3GV9 A;  3VOL A;  1JNU A;  2L1M A;  5HL1 A;  3F1P B;  3C38 A;  3DWK A;  1LL8 A;  3HVF A;  5IT5 A;  2V8C A;  4ZJ3 A;  2WKH A;  2B5R A;  1W7F A;  3IX8 A;  1CJF A;  3E4P A;  3HJI A;  4WM9 A;  4U3T A;  3PAG A;  3RJU A;  3CHW P;  4XT2 B;  3WWX A;  4KQR A;  3LY4 A;  3FKW A;  4QY6 A;  4EER A;  1NZO A;  5DF8 A;  2XF3 A;  4M4X A;  3EOI A;  3QP4 A;  2Y2H A;  2W1R A;  2WUQ A;  3Q81 A;  5AQ7 A;  2VV6 A;  3BRM A;  1LI9 A;  4HOI A;  3VSK A;  3VP3 A;  4DE1 A;  1DJC A;  3MSH A;  3LY3 A;  4I3A A;  2ZMF A;  1OTA A;  3I7J A;  2EX9 A;  4LV3 A;  4JGR A;  4JGO A;  2Q9N A;  1YKD A;  1ERM A;  2XA7 M;  4EUV A;  1YLJ A;  4P85 A;  3B3X A;  1Z09 A;  1KE0 A;  5A92 A;  4N9K A;  3GR2 A;  1SDN A;  5FAQ A;  4N9L A;  1E3U D;  3H7W A;  3W2Z A;  2WGV A;  4YOF A;  1D1J A;  5F69 A;  4LPZ A;  4KZ4 A;  1ZG4 A;  2XFT A;  3NOP C;  1FQG A;  5CEC A;  1ERO A;  2K7S A;  4WEJ A;  3R7W B;  2INW A;  1K57 A;  4CPK A;  3KYZ A;  3QP8 A;  3RXX A;  3SH7 A;  2WAD A;  5AQ9 A;  1F5M A;  3CG5 A;  1L0G A;  1NRF A;  4WEL A;  4OPQ A;  1TF1 A;  1GSW A;  1WYC A;  1ONG A;  1PI5 A;  4S2N A;  3OOV A;  3C4P A;  4BQM A;  1IEM A;  2XK1 A;  2W0N A;  1FOF A;  4CQH A;  1IYS A;  3A3E A;  2X71 A;  4RA7 A;  5EV0 A;  4JGP A;  1K55 A;  2Z6C A;  4PMA A;  2O0Y A;  2VGL M;  2EA9 A;  4EBL A;  3T4Q A;  3BW6 A;  4XUZ A;  2BLS A;  1W8Y A;  3A0R A;  2XR0 A;  3NJA A;  3JVU A;  2WGW B;  3OPP A;  4D60 A;  1W5D A;  1OJG A;  3M6B A;  1XGI A;  2EWW A;  5HDS A;  1KE3 A;  2BTF P;  2V1A A;  3PBS A;  5FQK A;  1YM1 A;  2XQZ A;  4FTX A;  4KZ8 A;  2QYB A;  1DP8 A;  4LV0 A;  2RL3 A;  2ZM2 A;  1SZV A;  2PBD P;  3NDE A;  2JKG A;  2ZJ9 A;  5HWW A;  5EFW A;  2P74 A;  4N1X A;  3LGO A;  2M7V A;  1SKF A;  3E4Q A;  2K2N A;  3D4F A;  3LIC A;  3G35 A;  1A0K A;  3UE0 A;  3NUL A;  4Y2F A;  3BY9 A;  3KYE A;  5GLB A;  2J3T D;  2KLI A;  4WLA A;  3ZVW A;  4I5S A;  3OCN A;  1MWT A;  4G3W A;  4ID4 A;  1PW1 A;  3MKF A;  1K6S A;  1X0O A;  3MZF A;  3ZDJ A;  4YIN A;  2PBY A;  4MBF A;  1H8M A;  1UGU A;  5EM0 A;  2VGK A;  3C5A A;  3QP5 A;  4HBT A;  1BUL A;  5EPH A;  4UA9 A;  1NXY A;  3S7O A;  3VP0 A;  2P7J A;  4BD0 A;  4P6Z M;  4ETX A;  2HJE A;  1K38 A;  2P9V A;  3LR0 A;  4Y0O A;  3T50 A;  1ESU A;  3VV4 A;  3ZCZ A;  3H7W B;  3TW8 A;  3WRZ A;  3AGF A;  4OPY A;  5DTT A;  1STZ A;  2EX8 A;  1JTD A;  2EXB A;  4HY8 A;  1FCN A;  4CLC A;  3IH8 A;  2HP9 A;  3W4O A;  3ZHH A;  3N4I A;  5IHV A;  4X56 A;  3C8C A;  2NUT C;  4K08 A;  4E3O A;  4KQO A;  5E2E A;  4IED A;  1K0K A;  5EVE A;  3CWF A;  4HJ4 A;  4Q0I A;  1ALQ A;  4KG2 A;  4B93 A;  2XRN A;  4I38 A;  4GDN A;  1KDS A;  3A3F A;  5EUA A;  1KVL A;  4R3A A;  4Y0T A;  4EXO A;  1PNE A;  5I5L A;  4MMN A;  1GSV A;  3ISG A;  2B18 A;  2NUP C;  1ZG6 A;  2FFY A;  3KSH A;  4X25 A;  1PYY A;  5CGS A;  5F68 A;  3C7V A;  4FH4 A;  3KX0 X;  4G3V A;  2H10 A;  2ZM8 A;  4GS9 A;  5CTN A;  5HL6 A;  4OLG A;  4RYE A;  4HHD A;  4EU0 A;  1O7E A;  1KGF A;  2OWH A;  4UEY A;  1SDE A;  4LFU A;  1L2S A;  2ZC7 A;  5LBR A;  2HJ9 C;  4HIA A;  2WAF A;  3VOZ A;  1LL5 A;  1Y28 A;  4JXS A;  1ES5 A;  1XGJ A;  3HRE A;  3K2N A;  4KUO A;  3L9K A;  3PTE A;  5EVL A;  4OOY A;  3FPV A;  4IVK A;  5CER A;  1VET A;  2H0T A;  3CUE C;  3UDX A;  1FIK A;  3IXH A;  1BLS A;  2GJ3 A;  4GNU A;  4EBN A;  4E6W A;  4R6L A;  2W3D A;  2XEP A;  3HLE A;  1MKI A;  2QJ5 A;  1OTI A;  2Y79 A;  4R3J A;  3HLC A;  4NXG A;  1YPR A;  5TFQ A;  4K0X A;  4EW7 A;  1N9B A;  3S7P A;  1D7E A;  1V9Z A;  5A93 A;  5G4Z A;  4PHT A;  2ZOI A;  4O7D A;  1YQS A;  3LCE A;  2I9V A;  5EOO A;  2JKR M;  4Y0U A;  5FA7 A;  5DVA A;  1RGZ A;  3CPT A;  3ITB A;  1ES3 A;  2IWD A;  4GDB A;  2GX5 A;  3GTC A;  2P04 A;  2Y2N A;  3M6H A;  3WS4 A;  4LV2 A;  3ZG7 B;  1S4R A;  2OAQ 1;  2QZ6 A;  1PRQ A;  1I5Q A;  2PHY A;  4LEN A;  1VB6 A;  5CRF A;  4KG6 A;  3PXP A;  1S0W A;  2R9X A;  3HLF A;  3HLB A;  3FZC A;  4E3L A;  3GDI A;  2P9V B;  3FWL A;  1MPL A;  1FIL A;  4MDZ A;  1K54 C;  2H5S A;  3BFG A;  3N8L A;  1MXO A;  4KZ9 A;  1NYM A;  1SHV A;  5CHU A;  3KSF A;  1ACF A;  3MZD A;  3IWQ A;  4UAA A;  2HF6 A;  2M1C A;  4H8R A;  3FPW A;  1XJ4 A;  4OOL A;  2FFF B;  4X53 A;  3UDF A;  1ERQ A;  2VJW A;  2EX2 A;  3T1R A;  3F1N A;  1HTZ A;  1IYQ A;  2O9C A;  3HLD A;  2QJ7 A;  3C7U A;  2P08 A;  3N8S A;  1W63 M;  3IX3 A;  5HD5 A;  1BLH A;  4PM9 A;  3BQ8 A;  2Y2L A;  3VMA A;  3UB6 A;  3EGD C;  1L0D A;  4D2O A;  4EUZ A;  3ZFZ A;  1D06 A;  1ESI A;  4M3K A;  1S4S A;  4GCZ A;  3R4K A;  2R9W A;  3UE3 A;  2PYR A;  2IA2 A;  2I72 A;  2Z2M B;  1IYP A;  4GS9 B;  3ZG9 B;  3Q07 A;  4PM5 A;  5TR7 A;  2A49 A;  4X69 A;  4GJ4 A;  1GA0 A;  1IFQ A;  3GRJ A;  2JC7 A;  4MEZ A;  3G2Z A;  5FI6 A;  2C6W B;  4OQG A;  3NCK A;  4OLD A;  1FR1 A;  1PWG A;  1CI8 A;  5HZH A;  1VET B;  4OH0 A;  1MWU A;  4MBK A;  2X01 A;  3RTY A;  3UB8 A;  3P98 A;  3NC8 A;  1T18 A;  2GZA A;  5TJJ A;  3F1O A;  2OLU A;  3LIF A;  2R78 A;  5HDD A;  2JHE A;  4B4X A;  3B47 A;  2EFU A;  4KZ6 A;  5FDS A;  1MY8 A;  1S6R A;  2A2L A;  2HGV A;  2WGW A;  2J9P A;  3O3V A;  3IWI A;  4Y7P A;  3NOT C;  5F5Y A;  2YKH A;  5E2H A;  1ZKJ A;  2VZW A;  3QNB A;  5FQJ A;  3GVB A;  3LI9 A;  5DF9 A;  2PD8 A;  4F3L B;  3IXB A;  1Z6F A;  3CPT B;  1KVM A;  3S7N A;  5HAR A;  4DJ2 A;  1YSP A;  3ZNY A;  3N6I A;  3EQU A;  4QPR A;  3ULF A;  3KO6 A;  4NKP A;  5FAO A;  2PDR A;  3HLG A;  1YMS A;  5EVI C;  4Q8I A;  2E8I A;  5DTS A;  4II7 A;  4DN0 A;  3FKV A;  4NG2 A;  4HH2 A;  4BEN A;  4U0X A;  1ODV A;  2OSU A;  3HL9 A;  4ARZ A;  3PYP A;  5AVF A;  3SOI A;  4GD8 A;  3F1N B;  1JWP A;  2ZMV A;  4YNR A;  2ZQ7 A;  4OOM A;  2V8F A;  1MKM A;  3BFC A;  3MQ0 A;  3C2W A;  4S2J A;  1F98 A;  4LRX C;  4QHC A;  3N7W A;  2OOL A;  1T1B A;  3DAV A;  2WYX A;  3A3J A;  3HJK A;  3ZGA B;  3MQQ A;  1DY6 A;  1NY0 A;  4FCF A;  4JXV A;  4MLL A;  2Y2J A;  3LEQ A;  1BTL A;  1XPB A;  3A3I A;  4I39 A;  5FQ9 A;  2J7V A;  1JTG A;  1PI4 A;  1G6O A;  2XDM A;  4MN5 A;  3KSG A;  1J9M A;  3WS5 A;  2ZD8 A;  1H8Y A;  3LR4 A;  1PZP A;  4GW9 A;  3ZVT A;  4HNB A;  4IUK A;  2Y2I A;  5FQM A;  1S67 L;  2IWC A;  5DJT A;  5AVE A;  1P0Z A;  4LRY C;  1TVF A;  4Y17 A;  4FUW A;  1MWS A;  1YLT A;  1K6R A;  4IJG A;  3ZG5 A;  4OPZ A;  4EEP A;  3F1O B;  1XX2 A;  3UE1 A;  1OME A;  1MWR A;  1F2K A;  3G32 A;  1VHM A;  3E2K A;  2HZ5 A;  5F82 A;  3W4P A;  4JBF A;  5MC7 A;  1N9O A;  2V1B A;  1XA1 A;  2ZC4 B;  3DBA A;  3UB7 A;  3LR5 A;  4LCL A;  4NEE D;  3V3R A;  4KEN B;  1YLY A;  4R23 A;  3LIA A;  4ESP A;  3C4O A;  1NJ4 A;  3T12 B;  2ZQ9 A;  1XJ3 A;  2V2F F;  5CGW A;  3MKE A;  1OPX A;  3IF6 C;  4X1M A;  1NLY A;  3TOI A;  2O9B A;  2V1Z A;  3LO7 A;  2H28 A;  1HD8 A;  1PWC A;  1DRM A;  3HCY A;  4KZ7 A;  3BLS A;  5FI7 A;  2ZQ8 A;  2Z6D A;  4FOF A;  4EEU A;  2VX8 A;  3SS4 A;  1CI9 A;  3CUE A;  3P09 A;  2V0U A;  5DTK A;  5FEF A;  2XD5 A;  1ZHH B;  1GSX A;  2A3U A;  3LFV A;  4ARZ B;  1U60 A;  1C3B A;  2J9O A;  4Y5F A;  1IKG A;  2JKR I;  2OV5 A;  3PBN A;  1TEM A;  3OLO A;  5FDH A;  1GHI A;  1LLB A;  4ZTK A;  1WYB A;  3NI9 A;  3Q7V A;  2YKF A;  2WAE A;  1M40 A;  3QP1 A;  4JF5 A;  3UPN A;  1Q2Q A;  3IBJ A;  4YWZ A;  2ZOH A;  3FV7 A;  4R38 A;  4IUH A;  5U47 A;  4DJ3 A;  4E3K A;  3AGD A;  1L0E A;  4OQH A;  3G30 A;  4L9E A;  2JKT M;  2XGN A;  1IOU A;  1FSW A;  4WZ4 A;  5FQI A;  2XSS A;  3NY4 A;  4MN6 A;  5HDC A;  2Y55 A;  1GA9 A;  1IYO A;  4R3B A;  4RQ9 A;  3UPP A;  3VP2 A;  1Q2P A;  3UB5 P;  1LT0 A;  1K56 A;  3IQA A;  2Y8H A;  1LSW A;  4K91 A;  1BLP A;  2CMN A;  1IEL A;  3T4T A;  1BSG A;  4KQQ A;  4QJG A;  4RVA A;  5JYP A;  1M6K A;  1EWZ A;  3B33 A;  3OPH A;  5L8M A;  3TE8 A;  5KMW A;  2V0W A;  2QPN A;  3PBQ A;  5GHX A;  1XJ6 A;  1W63 Q;  1XFN A;  2BAS A;  1PW8 A;  1L0F A;  3PR6 A;  3N8R A;  4FH2 A;  4FD8 A;  4JF4 A;  1N9N A;  4LGW A;  4OQI A;  3CMZ A;  5J7E A;  1TD5 A;  3ICY A;  5AJG A;  3IWO A;  3LID A;  3EWK A;  3SZT A;  4C75 A;  3O86 A;  4BL2 A;  3CJM A;  5GL9 A;  3A0V A;  2A24 A;  1UWN X;  4E04 A;  4WBG A;  1HLU P;  4R70 A;  2Y2K A;  2C5W B;  5HW3 A;  4O0P A;  1V9Y A;  4BWI A;  3BJN A;  2MJ6 A;  3V5M A;  3NOU C;  1NZU A;  3E98 A;  3ZNT A;  1LSX A;  1IKI A;  2JKF A;  4QU3 A;  3NIA A;  3BLM A;  3ZG8 B;  3TG9 A;  3G4P A;  1FCM A;  3OPL A;  4BLM A;  5A90 A;  3IT9 A;  3GEC A;  3T4S A;  3QP2 A;  5EE8 A;  4LCM A;  1XP4 A;  3HBR A;  1FCO A;  1LL9 A;  2L0W A;  4B88 A;  1N4O A;  5E43 A;  4F3L A;  1NYY A;  1BYW A;  4O01 A;  3JPU A;  1P9W A;  5FI2 A;  3UPO A;  1KDW A;  2WZX A;  1BZA A;  2WKE A;  4WN5 A;  3O88 A;  1YAX A;  4U0T A;  2W1T A;  3IF5 A;  2K31 A;  3DTE A;  4KZA A;  3UY6 A;  5GLC A;  2PT7 A;  1JVJ A;  2G2U A;  3Q7V B;  1Y54 A;  4CLC C;  3MFX A;  4L0L A;  4UQI S;  4CJN A;  4JPM A;  2ZBB A;  1XFQ A;  1QME A;  2JCH A;  5EOE A;  4MBH A;  5F83 A;  1J3W A;  4E3N A;  2PYP A;  1OTB A;  3CLO A;  4KG5 A;  4NXF A;  5HD3 A;  4PM6 A;  1GHP A;  4OPR A;  1ZC2 A;  3LEZ A;  2UWX A;  5HAQ A;  4S2O A;  1EI5 A;  2LB9 A;  5KZH A;  1CQA A;  1S1Y A;  3TRC A;  3PBO A;  4UA7 A;  2Y59 A;  4S2M A;  5J8X A;  2UV0 E;  2VKS A;  3C30 A;  2CC1 A;  5FEG A;  5EVI A;  1I2W A;  5M19 A;  2ZL1 A;  3ZYT A;  4UA6 A;  2XD1 A;  2Q9M A;  4E3I A;  4KZ3 A;  3UNW A;  3MR0 A;  4DRT A;  5CED A;  4I3I A;  2ZQC A;  4HJ3 A;  5CTM A;  4N1H A;  1KGE A;  5F1G A;  4BJP A;  2WKP A;  2PU2 A;  3WS2 A;  4DE0 A;  4GN2 A;  5TGF A;  3DTM A;  4WMC A;  5CHM A;  1K4E A;  5E2G A;  3VE4 A;  2G2W A;  4KQD A;  4RX3 A;  2QWS A;  4HP9 A;  1FSY A;  3LYX A;  5M18 A;  4ZJ2 A;  1LI0 A;  4EWF A;  3W4Q A;  3V39 A;  2A24 B;  4A5R A;  2LB5 A;  1PWD A;  4JKT A;  3IHA A;  2WGI A;  1CF0 A;  1H5X A;  3BYD A;  3V3S A;  3SW1 A;  1G68 A;  4DDS A;  5IS1 A;  3OCL A;  3OBF A;  2J3W A;  3S1Y A;  4IVI A;  1FR6 A;  4OQ0 A;  4OVD A;  1K56 D;  3QP6 A;  3VSL A;  3BWL A;  1I2S A;  5A8B A;  3JYI A;  3IS2 A;  3O87 A;  4IBX A;  5CEB A;  4ZJ1 A;  3MXS A;  3IBR A;  1AXB A;  2DCF A;  4ZRR A;  5HPF A;  1KOU A;  4HBU A;  1T1C A;  3VP1 A;  2V20 A;  3E2L A;  5CX7 A;  3GMW A;  3T1Q B;  1KGG A;  4GKU A;  4B9O A;  1TS7 A;  4HP4 A;  4WZ5 C;  5L2F A;  1GCE A;  2WK0 A;  4Q0H A;  3CIT A;  4O8G A;  4LLO B;  1XXM A;  4NK3 A;  3JVV A;  1OT6 A;  2HP6 A;  2VV8 A;  3CI6 A;  2G7U A;  3RH8 B;  2X02 A;  4GOG A;  2W1T B;  4MNR A;  4WUJ A;  2EFX A;  3HLW A;  2D02 A;  5AQB A;  2HDQ A;  1N9L A;  5GLA A;  3H82 A;  1SKO A;  3MXR A;  5TBM A;  2PRF A;  3P01 A;  2HDR A;  4N92 A;  4XUX A;  3M2K A;  3IH9 A;  2XFS A;  3U4L P;  5F6A A;  3DW0 A;  4IBR A;  2KDK A;  3Q82 A;  2Q0O A;  2XA7 S;  3GQZ A;  4JF6 A;  4X55 A;  1VEU A;  4R0Q A;  4BMW A;  3IF6 A;  3D9Y A;  1P97 A;  3UO9 A;  1F9I A;  5FSR A;  2PR6 A;  5FAP A;  4GHI A;  3FC7 A;  2VV7 A;  2EX6 A;  5EVI B;  2HDS A;  3T4K A;  2ZL1 B;  5DFY A;  5HWV A;  1PZO A;  4QY5 A;  1DP9 A;  1L3L A;  1LSV A;  5L09 A;  4EQI A;  3UME A;  4I3J A;  2ZC6 B;  3MMH A;  2Y2O A;  2XH9 A;  3BFD A;  3MBZ A;  3H9W A;  3S4X A;  4JXG A;  4QD4 A;  1S1Z A;  1WE4 A;  2GDN A;  2VEA A;  3RFB A;  2VK3 A;  3ITA A;  2ZC3 B;  4WL9 A;  1GHM A;  3MQO A;  4C6Y A;  4ZAM A;  5HAI A;  2L4R A;  2JKT I;  4LV1 A;  2WKR A;  3LIB A;  2BG1 A;  2ACG A;  2J3T C;  1E25 A;  4C3Q A;  5M1A A;  3UDI A;  3MS6 A;  5G18 A;  1BT5 A;  3Q7Z A;  2XRO A;  4OON A;  2VGL S;  3S7Q A;  4PAU A;  5DJU A;  3W8K A;  1G5U A;  3UB9 A;  1PIO A;  5EVI D;  1DJB A;  3RXW A;  4AFI A;  3D72 A;  3EGX C;  1TS0 A;  3IS2 B;  4LRZ E;  2Y2M A;  3EEH A;  4Z9Q A;  4HJ6 A;  2KOI A;  2H0Y A;  3WRT A;  3K3C A;  4NXB A;  5FQQ A;  1DJA A;  5K5B A;  3O5Y A;  2W3G A;  4WMC D;  2IWB A;  4MN7 A;  5DFX A;  1RCJ A;  3DTI A;  3MFD A;  1KE4 A;  3PAE A;  1WA9 A;  1W8Q A;  4Y3I A;  5JYO A;  3BEB A;  2DMW A;  4MCW A;  2Y2P A;  1BUE A;  3K3D A;  3L7H A;  2EXA A;  4PKY G;  5I94 A;  3A3D A;  3H82 B;  1SKO B;  3KSI A;  4X6T A;  4HH3 A;  4EBP A;  3IHB A;  3UE6 A;  1G6A A;  5TBM B;  3NBL A;  3T4L A;  3VOY A;  4FSF A;  4S2P A;  4H6J A;  5GLD A;  3TSG A;  1YLZ A;  4HI4 A;  1E4D A;  5C5K A;  1CK3 A;  2DRW A;  3NEC A;  1T1A A;  1MBL A;  2QMI A;  2Y2Q A;  3UN7 A;  4P6Z S;  1VEU B;  1H8Z A;  3IF6 B;  3ZG0 A;  3T1X A;  3HUN A;  4DKI A;  2QKP A;  3DTK A;  4UHU A;  2O9A A;  1MC0 A;  4GHI B;  3AGE A;  5HAP A;  3CAX A;  3OC2 A;  1TS8 A;  3LR3 A;  3OZH A;  3T1S A;  1TS6 A;  5D3O A;  2J80 A;  1VM1 A;  1K57 C;  1RP5 A;  2W3H A;  3A0S A;  5KIZ A;  4PPR A;  3BQA A;  3D3O A;  3Q1F A;  4E3J A;  4L9F A;  2PR5 A;  4S2K A;  1TDG A;  3HUM A;  3BEC A;  2EWV A;  4S2N C;  2Y91 A;  1S66 L;  4GB7 A;  1JWZ A;  5A91 A;  1K4F A;  2Z2L B;  3E0Y A;  4OKP A;  2OAP 1; 
#chains in the Genus database with same CATH homology
 5J4E A;  2ZBB A;  3LI9 A;  1XFQ A;  4JGP A;  3EEA A;  5DF9 A;  2PD8 A;  4F3L B;  3PBT A;  2Z6C A;  2PYP A;  1OTB A;  2O0Y A;  3ZQ5 A;  3S7N A;  3U2A A;  2VGL M;  3CLO A;  4DJ2 A;  4NXF A;  4PKY A;  5HD3 A;  2EA9 A;  3T4Q A;  3BW6 A;  1YSP A;  3A0R A;  2FH5 A;  3T4J A;  3NJA A;  3EQU A;  3JVU A;  4QPR A;  1OJG A;  2LB9 A;  3ULF A;  1S1Y A;  3KO6 A;  4IHQ A;  4NKP A;  3TRC A;  2EWW A;  3PBO A;  4DMZ A;  5HDS A;  2PDR A;  2V1A A;  2VKS A;  3C30 A;  3PBS A;  4JGQ A;  1XJ2 A;  2QYB A;  4II7 A;  1DP8 A;  2B02 A;  4DN0 A;  3ZYT A;  5KSH A;  4HH2 A;  4EET B;  4BBV A;  3MR0 A;  2M7U A;  2O99 A;  1ODV A;  3V67 A;  5EFW A;  5HWW A;  4I3I A;  2KX6 A;  4HJ3 A;  4ARZ A;  3LUQ A;  2M7V A;  3MF0 A;  3PYP A;  5AVF A;  3E4Q A;  2K2N A;  5IU1 A;  3LIC A;  4BJP A;  3F1N B;  4HQA A;  2WKP A;  2ZMV A;  4YNR A;  5DKK A;  4Y2F A;  3BY9 A;  4BBU A;  2J3T D;  4OOM A;  2KLI A;  4L9G A;  4WLA A;  4I5S A;  1MKM A;  3OCN A;  3VE4 A;  4G3W A;  3MQ0 A;  3C2W A;  2HV1 A;  4KQD A;  1F98 A;  4LRX C;  3T4O A;  2QWS A;  4HP9 A;  1X0O A;  4CLC E;  3LYX A;  1ZTU A;  2OOL A;  1T1B A;  3P7N A;  2A24 B;  1H8M A;  3HJK A;  1UGU A;  1OJ5 A;  4Q0J A;  3MQQ A;  4H6J B;  2LB5 A;  4WF0 A;  5HSQ A;  4G3K A;  3SW1 A;  5IS1 A;  4Z1W A;  3OCL A;  3OBF A;  2J3W A;  4I39 A;  3S7O A;  2P7J A;  4P6Z M;  5HWT A;  4ETX A;  1G6O A;  2JN7 A;  3BWL A;  2HJE A;  3TJZ C;  5A8B A;  4MN5 A;  5FL3 A;  3IS2 A;  3KSG A;  3LR0 A;  3LR4 A;  1OTE A;  3F1P A;  3T50 A;  4GW9 A;  4HNB A;  3IBR A;  5DKL A;  3UMD A;  4IUK A;  3VV4 A;  1UWP X;  3H7W B;  4ZRR A;  5HPF A;  1KOU A;  3TW8 A;  1S67 L;  5DJT A;  1T1C A;  3KYQ A;  3PBR A;  1STZ A;  5AVE A;  1P0Z A;  4EQ1 A;  4LRY C;  4HY8 A;  1EW0 A;  4CLC A;  5G4Y A;  3EQV A;  5CX7 A;  2VA0 A;  4B9O A;  1TS7 A;  4HP4 A;  4IJG A;  3C8C A;  2NUT C;  4Q0H A;  4K08 A;  3CIT A;  3F1O B;  4EEP A;  4O8G A;  4KQO A;  4LLO B;  2OWJ A;  3JVV A;  5HPI A;  1YSQ A;  1OT6 A;  4XT2 A;  3CI6 A;  2VV8 A;  3CWF A;  2G7U A;  3RH8 B;  3PHY A;  1VHM A;  4HJ4 A;  2W1T B;  4WUJ A;  4Q0I A;  4B93 A;  2XRN A;  5MC7 A;  4I38 A;  4CQH A;  2D02 A;  4ME4 A;  1N9O A;  1N9L A;  2V1B A;  4R3A A;  4UQI M;  4CLC B;  4EXO A;  3H82 A;  3G6O A;  3MJQ A;  5I5L A;  3DBA A;  1GSV A;  3MXQ A;  2B18 A;  4MMN A;  2NUP C;  3LR5 A;  3UB7 A;  4NEE D;  5TBM A;  3KSH A;  4EES A;  5F68 A;  3P01 A;  3LIA A;  2GNX A;  1XJ3 A;  3KX0 X;  4G3V A;  2V9A A;  5F6A A;  4GS9 A;  5HL6 A;  1OT9 A;  2KDK A;  4HHD A;  4EU0 A;  2XA7 S;  2OWH A;  4UEY A;  1OPX A;  4BBT A;  1NLY A;  2W27 A;  5LBR A;  2HJ9 C;  4HIA A;  4BMW A;  2O9B A;  1P97 A;  1F9I A;  2H28 A;  1Y28 A;  2PR6 A;  3FG8 A;  1DRM A;  3K2N A;  3HCY A;  4GHI A;  4KUO A;  3VE3 A;  3FC7 A;  2VV7 A;  3FPV A;  2Z6D A;  4FOF A;  4EEU A;  2VX8 A;  3NHQ A;  1H3Q A;  3CUE C;  3T4K A;  5DFY A;  2VLG A;  2GJ3 A;  4NXE A;  3CUE A;  4R6L A;  2V0U A;  2W3D A;  5HWV A;  1OTD A;  4GLQ A;  1ZHH B;  1GSX A;  1DP9 A;  1LSV A;  2QJ5 A;  1OTI A;  3LFV A;  2FZ0 A;  3R7W A;  3UME A;  4I3J A;  4ARZ B;  2WKQ A;  2Y79 A;  3MMH A;  1T19 A;  4NXG A;  4Y5F A;  1DP6 A;  3H9W A;  3LIE A;  2JKR I;  4CLC D;  4EW7 A;  1S1Z A;  3S7P A;  1D7E A;  3PBN A;  2QHK A;  2VEA A;  3RFB A;  1V9Z A;  1NWZ A;  1NLZ A;  2D01 A;  3OLO A;  2W3E A;  5G4Z A;  4PHT A;  2ZOI A;  4WL9 A;  1P9R A;  2YKF A;  3MQO A;  2W3F A;  2L4R A;  2JKT I;  2WKR A;  3LIB A;  2I9V A;  2JKR M;  2J3T C;  3IBJ A;  4YWZ A;  5J3W A;  2ZOH A;  4R38 A;  4IUH A;  4KUK A;  4DJ3 A;  2GX5 A;  2P04 A;  3B42 A;  3LI8 A;  2XRO A;  2VGL S;  4L9E A;  3S7Q A;  2JKT M;  1IOU A;  1S4R A;  4PAU A;  5DJU A;  2OAQ 1;  4WEK A;  2PHY A;  3E4O A;  3BY8 A;  3UB9 A;  2XSS A;  2PD7 A;  1VB6 A;  4MN6 A;  3PXP A;  1NRJ A;  1MZU A;  5HDC A;  4AFI A;  1G28 A;  4ETZ A;  3D72 A;  3EGX C;  1TS0 A;  3GDI A;  3IS2 B;  3VOL A;  1JNU A;  2L1M A;  4LRZ E;  3F1P B;  4RQ9 A;  4MDZ A;  3EEH A;  1LT0 A;  3C38 A;  2Y8H A;  1LSW A;  1LL8 A;  4HJ6 A;  2KOI A;  5IT5 A;  3KSF A;  2CMN A;  3T4T A;  3K3C A;  4NXB A;  2HF6 A;  2M1C A;  5K5B A;  3B33 A;  3FPW A;  3O5Y A;  1XJ4 A;  4OOL A;  2W3G A;  4MN7 A;  5DFX A;  5L8M A;  3TE8 A;  3E4P A;  3HJI A;  2V0W A;  2VJW A;  3PBQ A;  3F1N A;  1XJ6 A;  1W63 Q;  1XFN A;  2BAS A;  1WA9 A;  4XT2 B;  2O9C A;  3PR6 A;  4Y3I A;  1N9N A;  4EER A;  5J7E A;  2DMW A;  2QJ7 A;  4M4X A;  2P08 A;  1TD5 A;  1W63 M;  3EOI A;  3ICY A;  4MCW A;  5AJG A;  5HD5 A;  3LID A;  3EWK A;  3K3D A;  2W1R A;  3BQ8 A;  3UB6 A;  3EGD C;  4PKY G;  2VV6 A;  1D06 A;  3H82 B;  3KSI A;  4HH3 A;  4HOI A;  3UE6 A;  1S4S A;  5TBM B;  3A0V A;  2A24 A;  1UWN X;  3T4L A;  4GCZ A;  4E04 A;  4FSF A;  4I3A A;  4H6J A;  3R4K A;  3UE3 A;  4R70 A;  2ZMF A;  1OTA A;  2PYR A;  2IA2 A;  4HI4 A;  4O0P A;  1V9Y A;  4JGR A;  5C5K A;  4BWI A;  3BJN A;  4JGO A;  2MJ6 A;  4GS9 B;  1T1A A;  1YKD A;  2XA7 M;  3NOU C;  4EUV A;  4GJ4 A;  3E98 A;  1IFQ A;  1LSX A;  4P6Z S;  2QKP A;  2O9A A;  1MC0 A;  4GHI B;  3CAX A;  3H7W A;  3W2Z A;  3GEC A;  3OC2 A;  4YOF A;  5HZH A;  3T4S A;  1TS8 A;  3LR3 A;  1TS6 A;  4LPZ A;  5F69 A;  3NOP C;  2J80 A;  2L0W A;  3RTY A;  3UB8 A;  2K7S A;  1T18 A;  2W3H A;  4F3L A;  2GZA A;  4WEJ A;  5TJJ A;  3R7W B;  2INW A;  3A0S A;  1BYW A;  4O01 A;  5KIZ A;  3KYZ A;  3F1O A;  1P9W A;  3BQA A;  3D3O A;  3LIF A;  2R78 A;  5HDD A;  2JHE A;  3B47 A;  4L9F A;  2PR5 A;  4WN5 A;  1F5M A;  1YAX A;  2W1T A;  2EWV A;  2HGV A;  2A2L A;  4WEL A;  2K31 A;  1TF1 A;  1GSW A;  1S66 L;  3OOV A;  2PT7 A;  2W0N A;  4CLC C;  3NOT C;  3MFX A;  5F5Y A;  4L0L A;  3E0Y A;  2YKH A;  4UQI S;  2VZW A;  2OAP 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...