3B4SA

Crystal structure of a luxt domain from vibrio parahaemolyticus rimd 2210633
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
ADGRIFKMFIEHLEFEKGLDAFSQSWIKALEDSEFLAILRLLFHHIVTSESAHEFAANGIDRLYKMVESQFGSGGDKELEWLIGRSLIQMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a LuxT domain from Vibrio parahaemolyticus RIMD 2210633.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Structural genomics, unknown function
molecule keywords Protein LuxT
total genus 30
structure length 92
sequence length 92
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18285 LuxT_C Tetracycline repressor LuxT C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.790 Mainly Alpha Orthogonal Bundle Helix Hairpins luxt domain from vibrio parahaemolyticus 3b4sA01
1.20.5.830 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces luxt domain from vibrio parahaemolyticus 3b4sA02
3B4SA
chains in the Genus database with same CATH superfamily
2P7TC 4LH6A 4ZNCA 1Y76B 3VMYA 4IT5A 5A9GA 2YXRB 1NTZH 2XNXA 5L3DA 2V4HA 2C9LY 2ODMA 1KYOD 2WT7A 4HH2A 4O4IB 1ROPA 4H13D 1O9HA 3CSXA 1IX9A 3IAYA 1T5EA 3O6QA 5DJTB 1VQPP 2GM4A 4LF8B 3JASB 1R3IC 1K92A 3L36A 3U10A 4DXWA 2NPSC 1N32O 4JBZA 3HKEB 5BMVA 2HFEC 2A06H 2HHHO 4J80A 4JPRA 1A32A 4F6RB 4DV3O 1NAFA 2CPSA 4IL6E 4NVPA 4U3JA 2YIBD 2ZINA 1LTJC 1OZ0A 2Q5UA 4UB6H 3A5TA 4MTOA 1PL5A 1IVSA 5KA6A 2XTAA 4CH6A 1LTGC 2HR3A 2DYSB 3SYPA 4NXNB 1NKZB 4TWKA 3EQ2A 1N0NA 3DGEA 2Q7HA 1H0TA 1ZMEC 2HLOA 3UT5B 3H1LE 4EB6B 1L0NJ 4I7ZB 3L71G 2AXTZ 1VQ8P 1IFDA 5APVA 1R3LC 5EBLC 4W4KA 2Q9IA 3SJCC 5GTIH 1XHXA 3MUDC 3HKDA 4FMTA 5JVDA 2QWQB 2QWNB 1IFMA 1IURA 1LR1A 2G38A 3OJAB 2OYIB 2HFED 1FXKA 1VF5B 5JH7A 2NPSD 3EHBB 4RO2A 4GOFA 1VQNP 3H01A 5CCHA 3RYIA 3RL0C 2YO3A 3LSUA 3KG2A 3JSVC 1FFXB 4BAYA 2IJHA 1K3EA 1KFMA 5AW1B 1DX7A 1L0LH 4ZOLB 1QR9A 2IYOA 5B66H 1KP3A 1D2DA 2JO1A 3OW2U 4O4HA 1JCHA 1NTMD 1AI5A 3AK2A 4NPDA 3E1IA 2N1TC 1XL6A 1F51A 4GX5A 1G1IA 3MTUE 2OYHB 3BCCD 5AW3B 1VQKP 1DF5A 1F4NA 5DEDA 3AE3C 4Z1VA 4ZI7A 3HTKA 1PL0A 1FOSE 3ZJZA 2QA4P 1W0JG 3CMEV 5CB4B 5EBMC 1J2JB 1AQTA 1OVVA 3VQWA 5IWAO 3EXAA 1GH6A 4X89A 1M90Q 4YIOA 2HP8A 5IDJA 4I0XA 2B1GA 2Z5UA 1S9KE 2O57A 2Q7GA 4B3SB 4GKJO 3L75E 3Q2YA 1N8RQ 2ZYDA 2QKCA 5ITZB 3RYCA 1Q81Q 2DYRB 3OR7C 2YS8A 3H1LH 1LP1A 1Y67A 1WRGA 3H1JD 1VQ7P 1PP9H 4DR6B 4FFKA 3K03A 3CCEV 3PH0A 3TSIA 3R2PA 4JI8B 3LIEA 1FZFA 4UV8A 4ZI7B 3HTKB 2CE4A 2V7QJ 5AVZB 4WFFA 5JVDB 2ZM6O 3D8CA 5KX5B 2H7HA 1URQC 3AE5C 3W7TA 1JM0A 3SR2C 5DJUB 4C46A 3AG2C 1BL8A 3LSSA 1AJQA 4P2ZA 1QL1A 1FC2C 2P6JA 4H0LB 4ZOLA 1L1FA 4EFBA 3PRJA 1Q82Q 3JD4A 2R44A 3HE5B 2UUCO 2HVKC 1OWAA 5CBNA 2HEPA 5C8YB 1N33B 3H32A 4LNUB 3JSLA 4OXSA 4TUYA 3OFNG 2JGDB 4ASWA 1K33A 3N2KB 3FB8C 1YIJV 3OAKA 3V4QA 4A5UB 3AEBC 3U1AA 2EBOA 1EZVD 1VPCA 4PI0A 4DK1A 3ZHTA 3TETA 1NTKE 1JY3O 1KD1Q 3MHHC 4B3MO 1NS1A 2ITCC 1M56B 1MZEA 3EFGA 4NXMB 1BE3E 3N27A 1RQUA 2JS5A 1IBMB 2M5AB 4DZOA 4MVZA 2W6BA 2IFNA 2QJKB 1N4CA 4IIJA 1CPYA 1JO5A 1XDCA 2PYJA 4DR4O 3A0HE 3GG2A 4L75A 3BASA 2ZIOA 4LF6B 4DCKA 3K04A 4FFBB 4DOJA 3OGCC 4N21A 1MFZA 1EZJA 2XNDH 1HWTC 3L72J 3VTPC 1SQXJ 1VQMV 2IM9A 3HE4A 2E76B 2QEXP 1S77D 4TSFG 2P1JA 1YF2A 3N4XA 2OT5A 3L72D 1A02F 2QA4V 1VDFA 2AW9A 3A7OA 1OZHA 2HPCB 1E1RG 1ZL8A 1Z56A 1QVGU 4YPCA 2ZDIC 4GODA 1ZLZA 1HNWO 2Q69A 3P3PA 1M4UA 1TUEB 2OARA 3TNUB 1QVGO 2PF4E 1QL2A 1SS3A 2Q6AA 2DQ0A 3HE5A 1LGHB 3RK3B 1W2EA 3D3IA 3U59A 4IIJB 3V5BA 3RYFB 1TGOA 4DYLA 2QJKC 1N7SD 4R7CA 4U7JA 3GF3A 3LDDA 1PD3A 2IBZH 2K9PA 1YBKA 5AW0B 2E5TA 3AEFC 2YKPA 1LT1A 1YI2P 1YYCA 3R66A 3H1JG 4DV7B 3FXEA 4M3LA 1QQCA 3OTFA 1S5HC 3H25A 3QWOC 1R6NA 1KQFB 4JQ0D 2E76D 2GBOA 2QTSA 3AK1A 5IE9A 5JCOC 4KFMA 3WB0A 4X1KB 5KLIB 3P8MC 5KLVE 1P49A 1M1JC 2GUVA 2MKVA 2YXYA 2C0WA 2EJ7A 3DXRB 2K88A 2ZXXA 4O2BA 5LMUO 4OGQB 2EILC 3CXCU 4DV1O 4LFBO 5EZYB 3T1HB 1KV4A 3U11A 3CCRV 4LLHA 4BW9A 1B04A 2HKOA 1BSMA 5C93A 1ZAUA 1OCZC 4AQRD 5DECA 4LF9B 2E74D 4TLFA 2EX3A 3TK1A 3W7SA 2KOGA 1LWUA 2Z5HA 2ZXWB 4CPGA 1V55B 3S9OA 5LYJA 4JAAA 2ZVNB 3ETQA 1EZVI 3K59A 2R9IA 1KB9H 2FYNB 1N0JA 1AILA 1Q43A 2W0FC 5IY5B 1RE4C 1FKAO 1U57A 3D3QA 4AQYB 2N9YB 5CMUA 1UFIA 3TCUA 4H0LD 4WFEA 1LT9A 1RF1C 1OCOB 3ZHUA 4KHPB 4LFAB 1KQGB 4J9YB 2IZ0A 2M8RA 4F6EA 3FYEB 4PDMA 2Y0EA 2IJKA 1VQ6P 3B2EE 2WSSG 4MN4C 3ABKB 3B8NA 3RBZA 4JF7A 2KB1A 5LHIA 1X79B 1S5LZ 4X62O 1NU1G 1PM9A 4FJCC 3L72G 3CCMV 4BIZA 1HJ0A 4N6JA 5L3FA 1QVFO 2R3CA 1S0VA 3CB2A 1LTJB 3USSA 4PDRA 2FKWB 5C39A 4I6MC 3VP9A 4EKWA 1X8YA 3FXDA 1WA8A 1BQZA 1WB7A 3N7NA 3LDEA 5AVSB 2F93B 1GDTA 4BWNA 4JI6O 1CSBA 2Y9ZA 1FYJA 4ZKUA 1WAZA 1OHHG 5GTIE 2YEVA 1ZR4A 1VQLP 4WBNB 4JPZB 1SQQJ 3STLC 2FFDA 2UXNA 3THOA 4CC5A 4U3FD 4YJ2B 3ZRXA 3LIDA 2O01J 5CBOA 3CXHI 3BCCE 3BVOA 5JWPA 4LGDE 3FB5C 5BR8B 3AEEC 3CC7V 1SQBD 4FZ1A 5AW9B 1VQ7V 4AQYO 1RF0A 1SA0A 1KZUB 3I55P 3S3WA 3T1CA 2ZFCA 1SQPG 3ASNC 2KQXA 4GKKB 3G67A 2OYQA 3FGAD 1SESA 1L4AC 1URQB 1HGZA 2QG4A 1QR8A 1URFA 2VWKA 2B89A 1SERA 3CLQA 5K1XA 5ITZA 3RYCB 2WSFH 3MGNA 2W90A 4YXWG 4K0KO 1QEXA 5FPOA 3JATB 4O4LB 4LR3A 2MW2B 1GMGA 1Q5OA 4JI5O 2AXTE 2HG5C 3W7UA 1CW5A 1X9VA 1MV8A 1KQSO 3RL0D 2M0BA 1NT2B 4HNAA 3G4SV 1NTZD 1COWG 5GONB 1HNZO 5H6RA 3CXHE 1V9PA 1K04A 3FFQA 2XU6A 5KAFE 4KUMA 2YUAA 1F4MA 1JX9A 3A0BH 3GLMA 5CCGC 3JD1A 5IYBO 2WSCH 4PHZA 2BEQD 4PA6A 2AEMA 1R3KC 1G4YB 1W5CE 1AI4A 4CS3A 2IDBA 3H1KE 2H43A 1SQVG 4DV6O 3ASOC 4UXNA 1XTCC 3ZMVA 1YJNP 1RM1B 4KP4A 4PV1D 3O6QB 1L0LK 1FZCC 4TT3G 4FLUA 2B9BA 4BR6A 2WSEH 1SFCC 4IL6Z 5IJ9B 3T2MA 1RE3C 1AVYA 2BSKA 3B8MA 3CWBH 3G6EV 1XNRO 3L74G 4Z1MG 1HNZB 1M1KQ 3GF7A 2ZNIA 3TGUE 2NLJC 1UIXA 1BT8A 3AEGC 2M3EA 3DC6A 5HFLA 2OIGA 2CPBA 4JZGA 2E75D 1R73A 1I94O 1D5NA 2O1KA 5EC1C 4YHHB 3CC4P 3CCSV 1VQOV 4BIOA 2Q68A 3J81N 1CZQA 1PPJG 1PPJE 3WU2Z 5L3EA 4E2LA 3O9OA 5IYCO 1NQTA 3FAVB 3K0GA 2A06E 1T2KC 1OIPA 3H32B 1MSWD 4IHJB 4TQFA 1OCCC 1SZXA 2JP3A 2K37A 3ZS8C 5CJ4A 3ABVC 3JC22 4R6ZA 1SVFA 2NZ2A 3PN1A 3U1CA 1GD2E 5LP6C 2WLLA 4ABMA 5B1BC 4XBFA 1PGQA 5KLVD 3FWNA 2BOBC 2I8DA 1EN6A 3UCSC 4U3FG 3P8CE 3SFDC 2R72A 4UCTA 2ZIMA 1SQVE 5KHKA 2X6CA 4N78E 1YHQP 1BQ0A 1BCCJ 3L72H 5JJJB 1VQPV 1IO4A 2YMYA 4RO0A 1X22A 4CH3A 3L70H 5APSA 1AROP 3VMXA 1VQ4P 1S3JA 5KKZC 4ZKIA 2ZCEA 3HRNA 3DXRA 1Y4MA 1VL2A 2C9NY 1AVMA 1GL2A 1SKVA 1SQPJ 3RWRD 1H38A 1P7GA 3E22A 3MD0A 1EZVE 5EC2C 4DJGA 3IGAC 3CCLV 1RFYA 3JCUZ 3RYHA 1RF1B 4YJ3A 2WZ7A 4IFMA 1ZL8B 3L73H 2ILMA 4W4LA 3X2QB 4DUZB 4Q20A 3TXQA 2FYUJ 3VQVA 4B3RO 1JMMA 4MT8A 2J5UA 3H6PA 2F66C 2E75C 1ORQC 2EIKB 2XKMA 5LA6A 1H2KA 3C3TA 2BASA 3B77A 3ETEA 3L71J 1KYOF 2V1DA 3RK2D 1JA8A 4LFCB 3CX5H 1IJDB 2KLVA 3ITKA 1VMGA 5AVTB 2IU3A 4YHHO 2VQEO 1MSDA 4ZHQA 1GTOA 2Y69C 3MP7B 3II6A 4MVOA 3NXSA 2IBZE 3BRCA 3L74H 1LNQA 2CTPA 3CX5I 2UXCO 1GU4A 5AVUB 1L2PA 3E8BA 1OCZB 2QDOA 2PGDA 4ASUG 3ETDA 3NTNA 3L74D 4DR4B 3L73D 4PA9A 2UUAB 2KUBA 2ZT9D 4WVZA 2W6IG 4WFGA 1L4AB 2YICA 3S3XA 3CWBJ 1J5EB 1SQPK 3MIWA 1KC8W 4X1IB 3C3SA 1SQXG 2P22C 2FYNC 2V4DA 4X1YA 4H37A 4O4HB 3L72E 4P9OA 3ABTA 1F23A 4B3MB 2FKXA 4JYYA 3CWBD 1Q90D 1LUWA 5H2FZ 5LMNB 1AI6A 2XDJA 1PKXA 4R8CA 4MS2A 3QO5A 3JSNA 2EIJC 5CBHA 4Y99C 5AG2A 1NH4A 4UCVA 1J1EC 2N9BA 3E89A 5IT9N 4XA4A 1U97A 5LMNO 2ZQMA 5CA3A 2RDCA 3EFFK 2L35A 4K0KB 4DV6B 1VQ9V 3HUSC 1L0LJ 2ZD9A 2A45H 2IBZI 1NVPB 3K08A 3LDCA 5J2UB 4C7NA 3C8VA 1JCDA 4RKUJ 3IF4A 3L37A 5AVWB 2ZJSE 1TVKB 1VQ4V 1SQGA 3P3NA 4QGPA 3ZRVA 2V7QH 1KILD 2YEVB 2R5BA 1W0KG 1SFCB 5LXTB 1ZN5A 2DWEC 3KQGA 4FFBA 1T2KD 3T1YB 1GL2B 2ITAA 3AE1C 2OTJV 3P30A 5LOVB 3CEIA 3CE2A 1FXVA 3BPZA 1FFTB 2KSDA 2K9JA 3JAWB 3A2AA 3RK2C 3UQ8A 1G8MA 1GN6A 4RAIA 2OTJP 2QSIA 3L75D 3X2QC 2YKQA 3F5TA 3J7AU 4QE9A 4JYAO 2OYHC 3CP1A 1N2DC 3RT3C 4EDFA 1QHTA 2VRSA 3V2NA 1QGKB 1HUCA 4OGQD 1M7LA 3KYQA 5FNVA 2AGAA 5APTA 1O9GA 1IBMO 4HBNA 4J41A 4LBEC 4LF4B 2JWDA 3CI9A 4H0LC 2FYUG 2OIEA 3RFRA 1H0TB 4MVUA 4D6TJ 4UB6Z 5KHJA 1GKFA 5LXTA 2EINB 2O01N 4G27B 1FXKC 1DIPA 5IYZB 2NPSB 1MFTA 4GKGA 4PELA 3VP8A 1KU9A 1HP8A 1Q7YW 1LUVA 1ZRTD 4D6TD 1H2MA 2GUZA 4UCOA 1K5QA 3SPHA 1SA0B 4HB1A 3BABA 4GKJB 1LTSC 1Q2NA 4FIPC 4NKGB 1YVWA 3AE2C 3CX5D 5B66Z 2E75B 2NR5A 1XILA 1H2GA 4FLZA 3UM7A 2BEZF 1KILE 3D6ZA 2P67A 5GTIZ 4TQDA 2LQTA 1YJ9P 3E83A 1PV3A 2HG5D 3UIAA 4HKZH 3JCUH 2XHBA 1SFCA 1T3JA 1S5LE 1NR7A 1RPOA 4L76A 4JYAB 4EI2A 1FZCA 2GTSA 1L0NK 2B9ZA 1Q3EA 1XUQA 3CWBG 1P84F 1PIXA 4NB5A 1WLEA 4X64O 2KIKA 5AVXB 4PV1B 3HB3B 4DR5B 1YTFD 1NH2B 1HH0A 4UVCA 3QO8A 1AR5A 5B1AC 2IZ1A 3CCJV 3T1YO 1FE6A 2FXOA 3V6IA 5LMUB 1M90W 3HR0A 2IU0A 2UUBB 2CH7A 4CH5A 2DOSA 1GK6A 2B87A 2F4VB 3G6BA 1SP4A 3APOA 2ZE8A 3LW5H 3TDKA 1IFPA 1PGPA 1Q6UA 4I55B 1FD9A 2Y69B 1E5WA 2WAMA 4QE7A 3WU2H 3H1JJ 4LP8A 4DR3O 1HR0B 3RL0B 1H88A 3B09A 2ZKOA 4TV8B 3R4YA 3H1IJ 2CGNA 1VQ6V 5B3SC 1D7MA 3T4DA 4FPPA 5AW6B 2O3JA 3D70A 1IBKO 2Q9LA 2UXBO 2CUGA 2J59M 2ITDC 3K3WA 2VQEB 2JJ1G 2CTRA 1AR4A 4DK0A 1VARA 5EIBD 2Z5IA 4IHJA 4L8JA 1XMOO 2QRXA 2ARHA 4WCEV 1A02J 3D71A 4PJ0H 1MABG 3IC9A 1EBOA 1XREA 1AQ5A 2KK7A 4QMAA 4D7TA 3HKCB 4TOIA 1GM8A 4BIUA 5EIBC 3IC7A 2QJPC 3KCYA 1MKMA 4JI3O 5AW5B 1BS3A 2YIBA 2N05A 5TISE 4FLWA 5LA6B 2KXPB 1THZA 2XAQA 1PGOA 4BRYA 1FDMA 1H8HG 1QLNA 2JJLA 3FX7A 3D6YA 1OW6A 5JQGB 5FL7G 1JNMA 1YDXA 3K57A 1M1KW 4PJ0Z 4ZHQB 1OCCB 2AHZA 4J7JA 4HZ3A 5EBWC 4DR2B 2KI7B 1RE4A 1RPRA 4DUZO 5KAIH 2XAGA 2BCCJ 4I2LC 4PD4E 2KS1A 4EIJA 3ICXA 4IGGA 1SF9A 3KXDA 4I9QA 2JEEA 5F2VO 3P8CD 1IK7A 2YKOA 3WB1A 1EQ7A 5BVZA 1J95A 2R70A 3ABKC 5E1AC 3G71V 4JZ2A 1EN4A 4JTDB 1OMIA 5FLXN 5APQA 2CH7B 4JI6B 1K97A 2A9HA 2JEXA 3WUUA 1PPJH 2E74B 1FDIA 5AW8B 2EIMC 3STZC 2QKSA 3WG7B 3JASA 2ATKC 5LP6A 1Y47A 5TISH 5M1BA 3LUTB 2P58A 5LGTA 3ZMZA 1IFJA 1JTHA 4YJ2A 1HNXB 2OCCB 5IJ9A 4U3FJ 2POHA 3CXHH 5AVRB 2BSKB 1GW3A 3BVHA 2R9RB 1PP9D 1VQNV 2Y4UA 2QEXV 1Y76A 3O65A 1BCCG 3H1LG 3AEDC 2HPCA 2JWAA 3ABLC 1BCCE 1FXKB 1EC5A 1BSNA 3RGUA 2E3CA 4JI1B 2G3AA 2WLJA 4OX9O 5DM6V 2EZPA 1NTZE 3AK3A 4MW8A 1N73A 1FJGB 3CD6P 4DR3B 4X65B 4GIFA 3ZHQA 2C0XA 2JS3A 4N78D 1SQBH 1IFNA 3AE6C 3ASNB 3K5NA 4R50A 3PHLA 4DV5O 3JYCA 2PFXA 5B1NA 1L8DA 1JPXA 4YXWH 4ZMDA 3AG3C 4UFZA 4LH7A 4PDLA 1JTHB 5CA0A 2XUMA 2KS1B 3A0HZ 2ZAEB 2W27A 3DC5A 3T1HO 2FYZA 3TGUH 2QJPB 3VYIA 1Q6HA 3H1HG 4UB8H 4Z1MH 4FLTA 1EN5A 1GK9A 3AEIA 1S72P 4IFDK 1HF9A 1WMKA 1Y74B 5B66E 3H1KD 2ZR3A 2K1AA 5AW4B 3CC2P 3WFVA 4DR1O 3WUTA 4DV5B 1WN7A 4ZIBA 2F4VO 3CX5E 2LW1A 1KORA 2IX7C 5FPRA 1M56C 2Q7CA 1N7SC 1EDIA 3AG1C 3BEHA 3MHVA 4BW5A 1LP1B 5GTHE 5KUKA 1G2CB 3ZMUA 3JD0A 3M99B 2YNYA 3HD7A 1FZCB 1ZRTE 1U96A 3TYYA 3CCSP 1VQOP 1WPBA 3A0RA 4WFAV 2PAJA 4JI7O 5H9CA 4IYHA 4IL6X 1URQD 4WY4A 1EDLA 1LWUB 4OGQC 4I50B 1U7MA 1BDCA 1B3QA 1FU1A 2QR4A 2X6BA 1NTME 1KKCA 1GN3A 4DR2O 3JCZA 2BCCG 3ZX6A 1TU3F 4MSWC 1L0ND 3GWKC 1HVVA 1M8OB 4HAMA 4JGSA 2LP7A 1SQBE 1XMQO 2N1TD 1NKDA 2UXXA 4O2AA 2UWJE 3L9DA 1YTZT 2OTKE 3M0DA 5AVYB 3CCUP 2FFDC 2FFDB 2PYLA 3F89A 1BSHA 1KILB 2EJRA 1KC8Q 3SWKA 3HD7C 1MUUA 1IC2A 4XDLA 1SQBJ 3KDPB 4LF5B 3JALA 5B1AB 2X6AA 3SSUA 2ZE7A 3Q4HA 1VF5D 1N7SA 2WPVB 3H1LD 2WWWA 1FZEA 2W6JG 3I56P 2QM8A 4MVMA 2WLIB 3ZN0A 1I0HA 3M91A 2DJVA 3CCJP 5KUMA 3HKEA 1FAFA 1EXIA 5C8YA 4B08A 1SQQE 1QCEA 1FJPA 3L70G 2Z3YA 2RN0A 1FZGA 5CA0B 4JI3B 1H2SB 4OX9B 3ZEDA 4LF9O 1QLEB 2Z4EA 2Q73A 2VRZA 4DO2A 4CZZA 1IXMA 1AP5A 3OTOO 2CK3H 1OJHA 2RCVA 1V54B 3OUFA 2UUCB 1PL4A 4PD4F 2NRGA 4GCZA 1P7BA 1FS0G 3BRVB 3V2RA 4WFBV 4B3SO 1WP7A 4CC6A 2HLDG 4O4JA 3B8EB 4NPFX 4JV5B 3JATA 4O4LA 2B1IA 1US6A 4JASA 1KD1W 4JI2B 1KB9F 2K9YA 3P7KA 4TV8A 1S1CX 2Q1KA 1M1JA 1IBKB 2RH0A 1JY2O 2QWRB 3AECC 4FLVA 1K9MW 3A8TA 1VQMP 4PV1C 4FM1A 1NTMK 1XNRB 2G8YA 2WA3A 1QLEC 5K1PA 2M5AA 2A3QA 5APWA 4L73A 5BZBA 3RYIB 1AA0A 1WT6A 2AXTH 3MUDA 1PNMA 5BMVB 3KHUA 2K1EA 1XTGB 5KJ7D 4FLYA 5KLVH 1FJKA 3RYFA 3UT5A 4O2BB 3JCUE 4K35A 2Q7EA 3ZCCA 2UUAO 1PNKA 1RE3A 3C90A 1D5AA 3B5NC 1JMKC 3ETGA 1EDKA 2JK5C 3RK3D 4JI1O 5B3SB 5IYDO 3B4SA 1B6QA 1ZUQA 1M1JB 4R4MA 5KLVJ 2YC0A 1DTOA 4GX2A 1GL2D 2P10A 1KKDA 1OVRA 1PP9E 1DD4A 2WMMA 3EVKA 1KYOI 1AFOA 2A45I 2A0LA 2BCCH 1EFRG 2F43G 5KX5A 3SYAA 2PI4A 4XDKA 1JY3P 4KXRA 2QIWA 2ZT9C 5EFWB 2AZ2A 2ZR2A 1B06A 3VQYA 3JAMN 2ZDIA 5CCGA 3SJQC 4LWSA 2I1KA 2VQFO 4H33A 5CMZA 5KMGB 1SZTA 4DR7B 1BHAA 3SWFA 1N7LA 4GKKO 3OGIB 2MJZA 5LOVA 2KP8A 5IY5C 2JKVA 1TAEA 4MVSA 2QVAA 2L5GB 2Q3EA 1Q8IA 4DT0A 1PV0A 2OGUA 4OPAA 3RN4A 1Q81W 2V7QG 3ZHRA 3F5WC 3PTZA 3N2GA 2WSCJ 4PD4I 3L70D 4B3TB 1Q86Q 4N23A 3GW6A 2EILB 1M56D 2KLUA 2JGUA 1IXBA 3VMAA 2XAHA 4LF6O 4FZ0A 3L70J 5FNVB 4NXNO 1RF0C 1CI6A 4CH4A 3E86A 3ZRWA 4YXDC 2D2CB 4LF4O 3ZIAG 2CTQA 2WLNA 1SETA 3E2EA 1S5LH 3G3ZA 4MTFA 1SQXE 4LFCO 1VQ5P 2P5OA 2Q4PA 1SQBK 2W6AA 1FAVA 2CTWA 1G2CA 4J42A 1I5YA 3HKBB 3HD7B 1JUNA 2IH1C 4DV2B 1VQ5V 1EZVH 4JI0O 3CCUV 2QE7G 1P84H 2GSMB 1PNLA 2R9AA 5B5EE 5KA5A 4AILC 5L3BA 1P84E 2W8ZA 3RK2B 1FZAA 1URQA 4WY4D 1Q7YQ 1YJ9V 1OXZA 3CCVV 3CRMA 1XMOB 4GLXA 5KMGA 5L3GA 2AEFA 1BGYJ 1VF5C 1GM7A 1RQVA 4LNUA 4I5SA 3GB7C 4UCUA 1NU1K 1I08A 1YQ3C 1USDA 3HD7D 2W0XA 3APQA 4EB6A 1Y9BA 1JR9A 4ASVA 1RF1A 3H1IE 4J7ZA 5B1OA 3E35A 4XE5B 3HKCA 1VQ8V 4I1LA 1NO4A 1BGYH 4JI8O 1GZLA 2WTYA 3A3YB 2P4KA 1YITV 4B86A 2PRRA 5CHXA 2ADQB 1T3UA 1EZVG 2D2CD 2DQ3A 2B87B 1S9KD 2QM7A 3H1JH 3KKYA 3I5DA 4CBCA 3WB2A 4C7NB 2QGNA 3HUSB 1E1QG 1VP7A 1DK1A 4X20A 3E8GA 3A0BZ 2MK3A 2Y0PA 2YI9A 2R5DA 2YI8A 1OVUA 2QJYC 2Q0OC 4XFJA 5GW7A 2M7WA 4J11A 1JJOA 3N2GB 1JVMA 4B3RB 1M57D 5CCHC 2CDYA 1RY3A 3LNMB 1OX3A 2Q5ZA 2UXBB 4X64B 4UV9A 3IFMA 1J1DC 2NNUA 4GZRB 3LSQA 4JI5B 3QO7A 2IW5A 1ZTEA 1BGYE 1JB0J 2QE7H 3CCEP 1CI6B 3ZN1A 2IPPA 2KB7P 4AYCA 3OE7G 3HE4B 1F7YA 4MVQA 3WU2E 3CD6V 2OYHA 4E4EA 4TV9B 2W6JH 3ASOB 4KHXA 1YI2V 3E1RA 4YY3B 3BCCH 1KILA 1LT9B 3CPWO 3SPJA 4X62B 4D6TE 1NTMH 2YSUB 3K0DA 1H2NA 4JAVA 2UUBO 1FS0E 2E5YA 3CRRA 2P2UA 2QJYB 5AW2B 5JH7B 1K8AQ 2PUSA 1TUBB 3TGUG 1MNGA 3TNUA 1YJNV 4BRYB 3MZWB 3AEAC 5D5PA 1R6TA 1EM1A 4CS4A 2WVRA 2DMXA 1NVPD 1BCCH 2H88C 2E74C 1HR0O 2Z0AA 2HVJC 2YDEA 3ZHVA 1YXBA 1IBLB 1GMJA 3K5MA 3L70E 2VS0A 2LJ2A 4QPJA 3CRAA 1KYOE 3Q5SA 2JVDA 4GX1A 1OW7A 1MG1A 1EDJA 1H2LA 4WBNA 1NU1D 3CC7P 1X0TA 1W2BO 2XAJA 1X4TA 5APYA 3Q5PA 5APXA 3QF7A 4RWUA 1I94B 1I5XA 4ICGA 4RESB 1GM9A 2Q67A 1GTWA 4FM0A 2UU9B 1NU1J 2RNBA 5KHGA 1H8EG 2QSAA 3L73E 2E76C 4DR6O 4DV4O 1GK4A 1M93A 3FD9A 3B71A 4U7NA 4DV2O 5LL6Y 3CHXA 3UO2A 1L0LE 3RW0A 1R5SA 3ZRSA 1Y74A 2EIKC 3RVYA 3PLNA 1XNQO 3Q1MA 1XL4A 2O1JA 1USEA 1UIIA 1SQQG 4EEQA 1R5LA 2JGDA 5H6QA 5KAIE 2D2CC 1SQBG 2X0LA 1CP9A 4F6RA 2WLLB 2Y48A 1LTIC 1PP9J 1YSCA 2DW4A 1S4XA 1SQXK 4RQFA 3AG4C 1YEWA 1KUQA 1AVOA 4UB8E 2P90A 1L0NH 3I5CA 3S1KA 3T97B 2Q0AA 4PA4A 1WNSA 2DWDC 5LBQA 4N3YB 3FYIB 3M9HA 1ZR2A 3ML0A 3KZIE 1T8ZA 5KAFH 1OV9A 2WITA 4P9PA 3SYCA 2OCHA 5EYPB 2WPRA 1GN2A 3SPCA 5KTBA 3M7MX 4JYCA 1HDJA 1E79H 1JCCA 3E22B 1XMQB 3JARB 3JAKA 4I4TA 2WLKA 2JDIG 3DTUB 4UB6E 3H1HJ 3L35A 1NU1E 1WB8A 1RHZB 2BCCE 2FYUH 1ZV8A 1NTKH 4X66O 1NVOA 2C2AA 1SQVK 2HJFC 5H5NA 3ABMB 2N1TB 2LW7A 1KBHA 2XV5A 1RSOB 2N04A 1YZBA 3RL0g 2OYIA 3F7YC 3IFXA 5LHGA 3H1HE 1XHZA 2PZSA 2EINC 2DN9A 4L87A 2FL4A 1SRYA 5E79E 4U3FH 3TGUD 5BU8B 5KAFZ 3EWKA 1K34A 1KECA 4X66B 1SQPD 3K9AA 3ZMTA 3U0ZA 4JTCB 1NYHA 2P06A 3ZBHA 1S72V 2XT9A 3TGUJ 3C1LA 1XQ8A 1S76D 5APUA 2QTOA 1N8RW 3CCRP 3VBBA 3HKBA 3A2FA 4FVMA 3JAWA 1ZP0C 5CA1A 2FMLA 1QX8A 4LC1A 1PGJA 1M57C 2L91A 3B5NB 1PPJD 2XZRA 1HBWA 4JI4B 2ZYAA 1VEWA 1NTZG 1K4CC 3CXHF 4IL6H 1VF6A 3LNNA 4U7OA 2W83C 4HYTB 4DR5O 3ZRWB 1ZX3A 2YO2A 4I0XB 3OEHG 3M9QA 4LF8O 1TVKA 1SQFA 4OH8B 1KFNA 2RMKB 4JI4O 2P7JA 5D5QA 1GN4A 2SPZA 1R8EA 4LCUC 2ZE6A 4MVRA 1SQVD 5KLVG 4RQEA 2EULA 1KQLA 3QH9A 4UVBA 5CBGA 1J5EO 3L74J 2ZE5A 3VN0A 1SQQD 2RQ6A 2KZIA 3OW2O 2OTLV 1Z2GA 1YJWV 1SQVH 2RMZA 5CA1B 3H1JE 1GRJA 2AHYA 1KILC 3B5NA 2XAFA 4QPKA 5J2UA 3H1HH 3E7KA 5LYJB 1WPXA 2UU9O 3Q3DA 5EK0A 1N73B 4BXLA 3CXHD 1LTJA 3KZIH 3HUSA 1DEBA 1JEKA 3CRCA 2Q3IA 4PA7A 1NTMJ 2YMKA 5TJHA 4PA3A 3MAQA 2ZXWC 1SLQA 4W7ZA 3G71P 2GUSA 3PP5A 4MTGA 5LGNA 3BCCJ 4H44B 3SJBC 1AI7A 4D6TH 5IYZA 2NPSA 2H3OA 4JAUA 4NXMO 3ZHSA 3IR9A 3G80A 3AE9C 1KQSU 4DW0A 2BTQA 1RSOA 1JJ2U 1OCOC 5J9PC 5BR8O 1FOSF 1QNMA 4WFHA 2ZYGA 1AJPA 2KKWA 2Y0IA 3H1KJ 3GVMA 2WA4A 3OMAB 4ZKPA 3T4ZA 1L4AA 2BTOA 4LWSB 2ADPA 1Y66A 4DUYO 2KYVA 1NJIW 1KMIZ 1KP2A 3LW5J 2LR2A 1HJBA 3BA9A 4B7EA 1WJZA 2YIDA 4J10A 3QVNA 2LGQA 2XASA 3ZDMA 1BE3G 3AG4B 1IZ3A 1HNWB 1YIJP 4LF7O 1RH5B 3CL3D 4YJ3B 2VQFB 5LGUA 1XOUA 3OAAG 5L3CA 2EIJB 1NTKG 2H89C 4GYCB 4RUEA 1XNQB 5AVVB 2FB5A 3VOPA 3NFQA 5E79H 5LHHA 2KZJA 3W67A 4FLXA 1N36B 3TXSA 4B3TO 1IDSA 1JY2N 5CCGD 3JD2A 5K5GB 4Y28J 4KT0J 3RYHB 2Y0CA 3A0HH 4JTAB 5GONA 4K8XA 3H1IH 1S2EA 1GL2C 1NHLA 1Z5WA 2YIAA 2ETNA 3KZIZ 4DRXA 2VWJA 1P84D 1H89A 1IBLO 2M3BA 1NI8A 1XEQA 4A7PA 3CJHB 4TT3H 2DW3A 3T97A 1T6AA 3A0BE 3M0DC 1VQKV 3AG3B 3RGBA 1UJWB 1L0LG 3CCVP 1VF7A 1FFXA 5CN0A 1AB3A 3L73G 3C9IA 5KJ7C 3FB7C 2LGWA 3K5OA 4PI2A 4DW1A 3IAOA 2NN4A 1K05A 2LXCB 2IFMA 2GHYA 2PGGA 2FXPA 2HODA 3L75G 1NWQA 1LTTC 1SQXD 1YJWP 4FM2A 1W2BU 1SS1A 3AG1B 3KPEA 1AJYA 3W7WA 3DSQA 2PP6A 3SYQA 1LTBC 3OA7A 1GAXA 2Y0DA 3RK3E 3GHGC 4KJMA 1K73W 4Q6GA 3K58A 2ZNJA 2FY8A 3SWYA 2KG7B 1JQ0A 1BMFG 4X8AA 4DRXB 3D36A 1M9NA 3K9SA 2FXMA 4K8ZA 1PFIA 1M57B 3MDSA 3CMAV 4X1KA 2FYUD 4EOTA 3OTOB 4IYIA 3W68A 3G9RA 1R1BA 4KHPO 1JY2P 5B5EH 1BZKA 2AXCA 1GU5A 5JCOA 1IK9A 5EYPA 3CWBE 1J1DB 4AUWA 1DLBA 1QU7A 1G1XB 4NTWA 3AE7C 1YTZI 2EIMB 1YTFB 4D6TG 2K3RA 1SQXH 3HKDB 5AVQB 3E8HA 1SQPH 2N74A 2E5LO 3AG2B 1ZXGA 2FTKA 2R32A 2H8PC 2QKAA 1AR1B 1N7SB 1P84I 2OTLP 4H13C 4YTPC 1BE3D 4G2KA 3F7VC 1Y6XA 3OEEG 1NZ6A 4JYBA 3F5HA 2A7WA 2GTAA 2Q6QA 1BGYG 3GMAA 1FBMA 4NR1A 1NTKD 1K5SA 4LF5O 1GO3F 2YXHA 1BE3J 3L71E 3OM3B 3IJ4A 2XNDG 3FAVA 3L75H 2AEJA 1N32B 1MOFA 3OD4A 3W7XA 3QNEA 1NTKJ 1FDOA 2JJ2G 2HODB 2LO1A 1N73C 1I7FA 3JAKB 4I4TB 4RJTA 2FYUE 5B1BB 4TUYB 1E79G 3CS5A 2E5LB 3FWLA 4UCRA 3SJAC 1BDDA 5IWAB 1VF6C 2ZVOB 4EYYQ 5KKZB 4MW3A 4PDVA 2KG7A 3R65A 3G6EP 1NOHA 2RKLA 3GHGA 3GWOA 1Q86W 1CEZA 4H13B 1WA8B 2WPSA 3MHSC 2GV9A 2QM4A 4G28B 4NYKA 4HJGH 1L0LD 3ABLB 5KHHA 4EFEA 1JMBA 4UB8Z 4X20B 4X1YB 3FX0A 4GOEA 4AHCA 2B88A 3ZMSA 1QVFU 1Y8AA 1KB9D 5KJ7A 3H1IG 2WLMA 3VOUA 1NJIQ 2A45G 2BOCC 3TF5A 4DV0B 4HNAB 4JV5O 2WSEJ 1K4DC 2OYIC 1SFCD 1JOCA 3L75J 1Z5VA 4GDOA 3FKSG 5GTHZ 2BTQB 1FJGO 1NTKK 2ZXEB 4NPEA 5JJEB 2F95B 2A79B 2IH3C 1LTAC 1ZLLA 3BFRA 1ZWIC 2UXDB 1N34O 2F1MA 4J9ZB 1UPGA 1N86A 3SPGA 2WT7B 2LKMA 4RUFA 2KSJA 2WQYC 4LFBB 1K9MQ 2A06D 3FB6C 3KCXA 1HGVA 1P4RA 1X59A 1G6UA 4JI7B 2IBZG 5L8RJ 5JQGA 3N2KA 4P30A 4L74A 1MMMA 4H44C 1OFCX 3UKMA 2QJ1A 2E43A 1SC5B 4R4LA 5KAIZ 1NH2D 1W59A 3CMEP 2L6LA 4X9QA 1LT9C 1YCIA 3M8AA 3M06A 5IJ0A 3GHGB 1N36O 3V2PA 1S5LX 1VQLV 2CAZC 4X1IA 2HHHB 2DYRC 1U7JA 4I55A 2FYUK 1L4AD 2DE0X 2UXCB 2QWOB 1AP6A 2ZT9B 3Q5RA 3L71H 5JJNB 1BGYD 3E8FA 1MZ9A 4QJFB 1LWUC 1K73Q 4C7UA 4UCSA 3JD3A 3SFEC 5EZYA 1BHBA 3M0AA 3M9BA 4PJ0E 2H94A 3BHPA 4WY4C 3VMZA 3CCLP 1KN7A 3BATA 3BAAA 3S4RA 1MA1A 3PJSK 1L0NE 2IYPA 1ZSPA 2X7RB 1PZQA 5DN6G 1FXHA 1SQQK 4I50A 4JI2O 1DD3A 1NBMG 2IJJA 5A2QN 3JALB 3CX5F 2LFSA 3O8ZA 3V2QA 3Q4HB 2N1TA 1NKNA 4W7YA 2DYSC 1DF4A 5CBFA 1M5IA 4CS2A 2WLHA 4X65O 4W80A 3B40A 3QG5A 4FK5C 1JFFB 4IOIH 3HPLC 4I9WA 2AZ0A 1KB9I 2WSSH 2HJDA 4O2AB 4OVNF 1PP9G 4OPHA 1HW7A 1YHQV 1N33O 4AI8A 4H44D 1S5JA 1V54C 1ZOYC 4UVAA 2I1JA 2JR8A 1Q82W 4B7KA 2F23A 1AJNA 5H2FE 1HNXO 2CGOA 2GUZB 3UO3A 4GT1A 1NU1H 1FZBA 3H1ID 4JF3A 4HYOA 5H2FH 2BE3A 1CXZB 2XOKG 4GUNA 3K5LA 4DR1B 1DH3A 3CCQP 4KL1A 5IJ0B 2R3SA 5BXZA 1G1JA 2ZM6B 1IZNB 4U3FE 1EXJA 2FBWC 3SPIA 3RBXA 1ZW0A 5J2TA 4ZBMA 4MTXA 3CPWU 4DV3B 3CC2V 1IFIA 3CCQV 4DV4B 3TJTA 4JI0B 4O9BA 1YITP 4LFAO 5BY1A 4O4JB 3CC4V 4DV1B 1NGMB 2WSFJ 2OWOA 2GA1A 1XBLA 2JEUA 2E42A 5CB4A 4F4LA 5KHIA 2A06G 4YIPA 3V4WA 3H1HD 3WMM0 1GW4A 1XI1A 2IBZD 1RM1C 3H1LJ 5GTHH 4GX0A 4YY3O 3H1KG 1KB9E 4WF9V 2M6YA 2J58A 3J80N 3CJHA 5KLIC 1NR1A 3OUSA 3OR6C 4Z2WA 1NAYA 3ABUA 3D36C 3WG7C 2WPDG 3CYOA 3ABMC 1BCCD 2KNCA 1OW8A 2YXQB 4OWFA 4QIWF 3RK3C 1JFFA 4DV7O 3OT7A 2YIUB 2D3OW 4O4IA 2YIUC 3B5ND 5CJ0A 2Y4TA 3CMAP 3SGIA 3CRQA 1VQ9P 2LFRA 3OMIB 3L74E 3H9VA 1N34B 2PI5A 2UXDO 2Q8VA 2Y9YA 5BU5A 4WWIA 4TV9A 5E79Z 1R3JC 2P4VA 2YXLA 1NTZJ 2QWPB 4IFFA 3WUVA 3K79A 1AV1A 2JDIH 1H8AA 3G4SP 2OYOA 4BWAA 1QLED 5KLVK 2BCCD 3VQXA 1L0NG 4K3AA 4DR7O 1SQPE 3SDLA 5TISZ 5CCHD 1ENVA 1OCRB 1OCRC 2EZOA 2OQQA 1R6KA 2B5UA 3L71D 4DUYB 2H8PD 3BY6A 3L4FA 4XDJA 4J7KA 2LXBA 3QTCA 4Y99B 2WLIA 5HFMA 2RN9A 1K7DA 1JY3N 3I55V 2WPQA 1VIBA 1SQVJ 3AE4C 4I7ZC 1DEEG 3AG7A 3NR7A 3BA8A 3NMDA 1HTLC 3RVZA 4D7SA 2O01H 1K8AW 2K9JB 4LF7B 1KYOH 4NTYA 2RJZA 1TUBA 1SQQH 2PY5A 3OMNB 4WY4B 3SYOA 4WB4A 3L73J 1MZFA 1V55C 3H1KH 1Q6IA 2OCCC 1QBZA 4X88A 4QNHB 1TA8A 1HWYA 4DV0O 2KNCB 1NTMG 1BE3H 3P32A 1YQ4C 1JOYA 2JRIA 5J2TB 3BRTB 3BCCG 2IJIA 1NTZK 4WBAA 3I56V 3AE8C 1RP3B 2CK3G 3IN6A 4PD4D 1WP8A 2GDSA 3K06A 1DGSA 4UUJC 2KSEA 2JIZG 4U3JB 1FPOA 5LP6B 1J1EB 3CCMP 2HYNA 3JARA 3K5BA 1KTMA 4PD4H 4NTXA 5B5EZ 2PTMA 4C7RA 5AW7B 1LJ2A
chains in the Genus database with same CATH topology
3B4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4S A; 
#chains in the Genus database with same CATH topology
 2P7T C;  4LH6 A;  4ZNC A;  1Y76 B;  3VMY A;  4IT5 A;  5A9G A;  2YXR B;  1NTZ H;  2XNX A;  5L3D A;  2V4H A;  2C9L Y;  2ODM A;  1KYO D;  2WT7 A;  4HH2 A;  4O4I B;  1ROP A;  4H13 D;  1O9H A;  3CSX A;  1IX9 A;  3IAY A;  1T5E A;  3O6Q A;  5DJT B;  1VQP P;  2GM4 A;  4LF8 B;  3JAS B;  1R3I C;  1K92 A;  3L36 A;  3U10 A;  4DXW A;  2NPS C;  1N32 O;  4JBZ A;  3HKE B;  5BMV A;  2HFE C;  2A06 H;  2HHH O;  4J80 A;  4JPR A;  1A32 A;  4F6R B;  4DV3 O;  1NAF A;  2CPS A;  4IL6 E;  4NVP A;  4U3J A;  2YIB D;  2ZIN A;  1LTJ C;  1OZ0 A;  2Q5U A;  4UB6 H;  3A5T A;  4MTO A;  1PL5 A;  1IVS A;  5KA6 A;  2XTA A;  4CH6 A;  1LTG C;  2HR3 A;  2DYS B;  3SYP A;  4NXN B;  1NKZ B;  4TWK A;  3EQ2 A;  1N0N A;  3DGE A;  2Q7H A;  1H0T A;  1ZME C;  2HLO A;  3UT5 B;  3H1L E;  4EB6 B;  1L0N J;  4I7Z B;  3L71 G;  2AXT Z;  1VQ8 P;  1IFD A;  5APV A;  1R3L C;  5EBL C;  4W4K A;  2Q9I A;  3SJC C;  5GTI H;  1XHX A;  3MUD C;  3HKD A;  4FMT A;  5JVD A;  2QWQ B;  2QWN B;  1IFM A;  1IUR A;  1LR1 A;  2G38 A;  3OJA B;  2OYI B;  2HFE D;  1FXK A;  1VF5 B;  5JH7 A;  2NPS D;  3EHB B;  4RO2 A;  4GOF A;  1VQN P;  3H01 A;  5CCH A;  3RYI A;  3RL0 C;  2YO3 A;  3LSU A;  3KG2 A;  3JSV C;  1FFX B;  4BAY A;  2IJH A;  1K3E A;  1KFM A;  5AW1 B;  1DX7 A;  1L0L H;  4ZOL B;  1QR9 A;  2IYO A;  5B66 H;  1KP3 A;  1D2D A;  2JO1 A;  3OW2 U;  4O4H A;  1JCH A;  1NTM D;  1AI5 A;  3AK2 A;  4NPD A;  3E1I A;  2N1T C;  1XL6 A;  1F51 A;  4GX5 A;  1G1I A;  3MTU E;  2OYH B;  3BCC D;  5AW3 B;  1VQK P;  1DF5 A;  1F4N A;  5DED A;  3AE3 C;  4Z1V A;  4ZI7 A;  3HTK A;  1PL0 A;  1FOS E;  3ZJZ A;  2QA4 P;  1W0J G;  3CME V;  5CB4 B;  5EBM C;  1J2J B;  1AQT A;  1OVV A;  3VQW A;  5IWA O;  3EXA A;  1GH6 A;  4X89 A;  1M90 Q;  4YIO A;  2HP8 A;  5IDJ A;  4I0X A;  2B1G A;  2Z5U A;  1S9K E;  2O57 A;  2Q7G A;  4B3S B;  4GKJ O;  3L75 E;  3Q2Y A;  1N8R Q;  2ZYD A;  2QKC A;  5ITZ B;  3RYC A;  1Q81 Q;  2DYR B;  3OR7 C;  2YS8 A;  3H1L H;  1LP1 A;  1Y67 A;  1WRG A;  3H1J D;  1VQ7 P;  1PP9 H;  4DR6 B;  4FFK A;  3K03 A;  3CCE V;  3PH0 A;  3TSI A;  3R2P A;  4JI8 B;  3LIE A;  1FZF A;  4UV8 A;  4ZI7 B;  3HTK B;  2CE4 A;  2V7Q J;  5AVZ B;  4WFF A;  5JVD B;  2ZM6 O;  3D8C A;  5KX5 B;  2H7H A;  1URQ C;  3AE5 C;  3W7T A;  1JM0 A;  3SR2 C;  5DJU B;  4C46 A;  3AG2 C;  1BL8 A;  3LSS A;  1AJQ A;  4P2Z A;  1QL1 A;  1FC2 C;  2P6J A;  4H0L B;  4ZOL A;  1L1F A;  4EFB A;  3PRJ A;  1Q82 Q;  3JD4 A;  2R44 A;  3HE5 B;  2UUC O;  2HVK C;  1OWA A;  5CBN A;  2HEP A;  5C8Y B;  1N33 B;  3H32 A;  4LNU B;  3JSL A;  4OXS A;  4TUY A;  3OFN G;  2JGD B;  4ASW A;  1K33 A;  3N2K B;  3FB8 C;  1YIJ V;  3OAK A;  3V4Q A;  4A5U B;  3AEB C;  3U1A A;  2EBO A;  1EZV D;  1VPC A;  4PI0 A;  4DK1 A;  3ZHT A;  3TET A;  1NTK E;  1JY3 O;  1KD1 Q;  3MHH C;  4B3M O;  1NS1 A;  2ITC C;  1M56 B;  1MZE A;  3EFG A;  4NXM B;  1BE3 E;  3N27 A;  1RQU A;  2JS5 A;  1IBM B;  2M5A B;  4DZO A;  4MVZ A;  2W6B A;  2IFN A;  2QJK B;  1N4C A;  4IIJ A;  1CPY A;  1JO5 A;  1XDC A;  2PYJ A;  4DR4 O;  3A0H E;  3GG2 A;  4L75 A;  3BAS A;  2ZIO A;  4LF6 B;  4DCK A;  3K04 A;  4FFB B;  4DOJ A;  3OGC C;  4N21 A;  1MFZ A;  1EZJ A;  2XND H;  1HWT C;  3L72 J;  3VTP C;  1SQX J;  1VQM V;  2IM9 A;  3HE4 A;  2E76 B;  2QEX P;  1S77 D;  4TSF G;  2P1J A;  1YF2 A;  3N4X A;  2OT5 A;  3L72 D;  1A02 F;  2QA4 V;  1VDF A;  2AW9 A;  3A7O A;  1OZH A;  2HPC B;  1E1R G;  1ZL8 A;  1Z56 A;  1QVG U;  4YPC A;  2ZDI C;  4GOD A;  1ZLZ A;  1HNW O;  2Q69 A;  3P3P A;  1M4U A;  1TUE B;  2OAR A;  3TNU B;  1QVG O;  2PF4 E;  1QL2 A;  1SS3 A;  2Q6A A;  2DQ0 A;  3HE5 A;  1LGH B;  3RK3 B;  1W2E A;  3D3I A;  3U59 A;  4IIJ B;  3V5B A;  3RYF B;  1TGO A;  4DYL A;  2QJK C;  1N7S D;  4R7C A;  4U7J A;  3GF3 A;  3LDD A;  1PD3 A;  2IBZ H;  2K9P A;  1YBK A;  5AW0 B;  2E5T A;  3AEF C;  2YKP A;  1LT1 A;  1YI2 P;  1YYC A;  3R66 A;  3H1J G;  4DV7 B;  3FXE A;  4M3L A;  1QQC A;  3OTF A;  1S5H C;  3H25 A;  3QWO C;  1R6N A;  1KQF B;  4JQ0 D;  2E76 D;  2GBO A;  2QTS A;  3AK1 A;  5IE9 A;  5JCO C;  4KFM A;  3WB0 A;  4X1K B;  5KLI B;  3P8M C;  5KLV E;  1P49 A;  1M1J C;  2GUV A;  2MKV A;  2YXY A;  2C0W A;  2EJ7 A;  3DXR B;  2K88 A;  2ZXX A;  4O2B A;  5LMU O;  4OGQ B;  2EIL C;  3CXC U;  4DV1 O;  4LFB O;  5EZY B;  3T1H B;  1KV4 A;  3U11 A;  3CCR V;  4LLH A;  4BW9 A;  1B04 A;  2HKO A;  1BSM A;  5C93 A;  1ZAU A;  1OCZ C;  4AQR D;  5DEC A;  4LF9 B;  2E74 D;  4TLF A;  2EX3 A;  3TK1 A;  3W7S A;  2KOG A;  1LWU A;  2Z5H A;  2ZXW B;  4CPG A;  1V55 B;  3S9O A;  5LYJ A;  4JAA A;  2ZVN B;  3ETQ A;  1EZV I;  3K59 A;  2R9I A;  1KB9 H;  2FYN B;  1N0J A;  1AIL A;  1Q43 A;  2W0F C;  5IY5 B;  1RE4 C;  1FKA O;  1U57 A;  3D3Q A;  4AQY B;  2N9Y B;  5CMU A;  1UFI A;  3TCU A;  4H0L D;  4WFE A;  1LT9 A;  1RF1 C;  1OCO B;  3ZHU A;  4KHP B;  4LFA B;  1KQG B;  4J9Y B;  2IZ0 A;  2M8R A;  4F6E A;  3FYE B;  4PDM A;  2Y0E A;  2IJK A;  1VQ6 P;  3B2E E;  2WSS G;  4MN4 C;  3ABK B;  3B8N A;  3RBZ A;  4JF7 A;  2KB1 A;  5LHI A;  1X79 B;  1S5L Z;  4X62 O;  1NU1 G;  1PM9 A;  4FJC C;  3L72 G;  3CCM V;  4BIZ A;  1HJ0 A;  4N6J A;  5L3F A;  1QVF O;  2R3C A;  1S0V A;  3CB2 A;  1LTJ B;  3USS A;  4PDR A;  2FKW B;  5C39 A;  4I6M C;  3VP9 A;  4EKW A;  1X8Y A;  3FXD A;  1WA8 A;  1BQZ A;  1WB7 A;  3N7N A;  3LDE A;  5AVS B;  2F93 B;  1GDT A;  4BWN A;  4JI6 O;  1CSB A;  2Y9Z A;  1FYJ A;  4ZKU A;  1WAZ A;  1OHH G;  5GTI E;  2YEV A;  1ZR4 A;  1VQL P;  4WBN B;  4JPZ B;  1SQQ J;  3STL C;  2FFD A;  2UXN A;  3THO A;  4CC5 A;  4U3F D;  4YJ2 B;  3ZRX A;  3LID A;  2O01 J;  5CBO A;  3CXH I;  3BCC E;  3BVO A;  5JWP A;  4LGD E;  3FB5 C;  5BR8 B;  3AEE C;  3CC7 V;  1SQB D;  4FZ1 A;  5AW9 B;  1VQ7 V;  4AQY O;  1RF0 A;  1SA0 A;  1KZU B;  3I55 P;  3S3W A;  3T1C A;  2ZFC A;  1SQP G;  3ASN C;  2KQX A;  4GKK B;  3G67 A;  2OYQ A;  3FGA D;  1SES A;  1L4A C;  1URQ B;  1HGZ A;  2QG4 A;  1QR8 A;  1URF A;  2VWK A;  2B89 A;  1SER A;  3CLQ A;  5K1X A;  5ITZ A;  3RYC B;  2WSF H;  3MGN A;  2W90 A;  4YXW G;  4K0K O;  1QEX A;  5FPO A;  3JAT B;  4O4L B;  4LR3 A;  2MW2 B;  1GMG A;  1Q5O A;  4JI5 O;  2AXT E;  2HG5 C;  3W7U A;  1CW5 A;  1X9V A;  1MV8 A;  1KQS O;  3RL0 D;  2M0B A;  1NT2 B;  4HNA A;  3G4S V;  1NTZ D;  1COW G;  5GON B;  1HNZ O;  5H6R A;  3CXH E;  1V9P A;  1K04 A;  3FFQ A;  2XU6 A;  5KAF E;  4KUM A;  2YUA A;  1F4M A;  1JX9 A;  3A0B H;  3GLM A;  5CCG C;  3JD1 A;  5IYB O;  2WSC H;  4PHZ A;  2BEQ D;  4PA6 A;  2AEM A;  1R3K C;  1G4Y B;  1W5C E;  1AI4 A;  4CS3 A;  2IDB A;  3H1K E;  2H43 A;  1SQV G;  4DV6 O;  3ASO C;  4UXN A;  1XTC C;  3ZMV A;  1YJN P;  1RM1 B;  4KP4 A;  4PV1 D;  3O6Q B;  1L0L K;  1FZC C;  4TT3 G;  4FLU A;  2B9B A;  4BR6 A;  2WSE H;  1SFC C;  4IL6 Z;  5IJ9 B;  3T2M A;  1RE3 C;  1AVY A;  2BSK A;  3B8M A;  3CWB H;  3G6E V;  1XNR O;  3L74 G;  4Z1M G;  1HNZ B;  1M1K Q;  3GF7 A;  2ZNI A;  3TGU E;  2NLJ C;  1UIX A;  1BT8 A;  3AEG C;  2M3E A;  3DC6 A;  5HFL A;  2OIG A;  2CPB A;  4JZG A;  2E75 D;  1R73 A;  1I94 O;  1D5N A;  2O1K A;  5EC1 C;  4YHH B;  3CC4 P;  3CCS V;  1VQO V;  4BIO A;  2Q68 A;  3J81 N;  1CZQ A;  1PPJ G;  1PPJ E;  3WU2 Z;  5L3E A;  4E2L A;  3O9O A;  5IYC O;  1NQT A;  3FAV B;  3K0G A;  2A06 E;  1T2K C;  1OIP A;  3H32 B;  1MSW D;  4IHJ B;  4TQF A;  1OCC C;  1SZX A;  2JP3 A;  2K37 A;  3ZS8 C;  5CJ4 A;  3ABV C;  3JC2 2;  4R6Z A;  1SVF A;  2NZ2 A;  3PN1 A;  3U1C A;  1GD2 E;  5LP6 C;  2WLL A;  4ABM A;  5B1B C;  4XBF A;  1PGQ A;  5KLV D;  3FWN A;  2BOB C;  2I8D A;  1EN6 A;  3UCS C;  4U3F G;  3P8C E;  3SFD C;  2R72 A;  4UCT A;  2ZIM A;  1SQV E;  5KHK A;  2X6C A;  4N78 E;  1YHQ P;  1BQ0 A;  1BCC J;  3L72 H;  5JJJ B;  1VQP V;  1IO4 A;  2YMY A;  4RO0 A;  1X22 A;  4CH3 A;  3L70 H;  5APS A;  1ARO P;  3VMX A;  1VQ4 P;  1S3J A;  5KKZ C;  4ZKI A;  2ZCE A;  3HRN A;  3DXR A;  1Y4M A;  1VL2 A;  2C9N Y;  1AVM A;  1GL2 A;  1SKV A;  1SQP J;  3RWR D;  1H38 A;  1P7G A;  3E22 A;  3MD0 A;  1EZV E;  5EC2 C;  4DJG A;  3IGA C;  3CCL V;  1RFY A;  3JCU Z;  3RYH A;  1RF1 B;  4YJ3 A;  2WZ7 A;  4IFM A;  1ZL8 B;  3L73 H;  2ILM A;  4W4L A;  3X2Q B;  4DUZ B;  4Q20 A;  3TXQ A;  2FYU J;  3VQV A;  4B3R O;  1JMM A;  4MT8 A;  2J5U A;  3H6P A;  2F66 C;  2E75 C;  1ORQ C;  2EIK B;  2XKM A;  5LA6 A;  1H2K A;  3C3T A;  2BAS A;  3B77 A;  3ETE A;  3L71 J;  1KYO F;  2V1D A;  3RK2 D;  1JA8 A;  4LFC B;  3CX5 H;  1IJD B;  2KLV A;  3ITK A;  1VMG A;  5AVT B;  2IU3 A;  4YHH O;  2VQE O;  1MSD A;  4ZHQ A;  1GTO A;  2Y69 C;  3MP7 B;  3II6 A;  4MVO A;  3NXS A;  2IBZ E;  3BRC A;  3L74 H;  1LNQ A;  2CTP A;  3CX5 I;  2UXC O;  1GU4 A;  5AVU B;  1L2P A;  3E8B A;  1OCZ B;  2QDO A;  2PGD A;  4ASU G;  3ETD A;  3NTN A;  3L74 D;  4DR4 B;  3L73 D;  4PA9 A;  2UUA B;  2KUB A;  2ZT9 D;  4WVZ A;  2W6I G;  4WFG A;  1L4A B;  2YIC A;  3S3X A;  3CWB J;  1J5E B;  1SQP K;  3MIW A;  1KC8 W;  4X1I B;  3C3S A;  1SQX G;  2P22 C;  2FYN C;  2V4D A;  4X1Y A;  4H37 A;  4O4H B;  3L72 E;  4P9O A;  3ABT A;  1F23 A;  4B3M B;  2FKX A;  4JYY A;  3CWB D;  1Q90 D;  1LUW A;  5H2F Z;  5LMN B;  1AI6 A;  2XDJ A;  1PKX A;  4R8C A;  4MS2 A;  3QO5 A;  3JSN A;  2EIJ C;  5CBH A;  4Y99 C;  5AG2 A;  1NH4 A;  4UCV A;  1J1E C;  2N9B A;  3E89 A;  5IT9 N;  4XA4 A;  1U97 A;  5LMN O;  2ZQM A;  5CA3 A;  2RDC A;  3EFF K;  2L35 A;  4K0K B;  4DV6 B;  1VQ9 V;  3HUS C;  1L0L J;  2ZD9 A;  2A45 H;  2IBZ I;  1NVP B;  3K08 A;  3LDC A;  5J2U B;  4C7N A;  3C8V A;  1JCD A;  4RKU J;  3IF4 A;  3L37 A;  5AVW B;  2ZJS E;  1TVK B;  1VQ4 V;  1SQG A;  3P3N A;  4QGP A;  3ZRV A;  2V7Q H;  1KIL D;  2YEV B;  2R5B A;  1W0K G;  1SFC B;  5LXT B;  1ZN5 A;  2DWE C;  3KQG A;  4FFB A;  1T2K D;  3T1Y B;  1GL2 B;  2ITA A;  3AE1 C;  2OTJ V;  3P30 A;  5LOV B;  3CEI A;  3CE2 A;  1FXV A;  3BPZ A;  1FFT B;  2KSD A;  2K9J A;  3JAW B;  3A2A A;  3RK2 C;  3UQ8 A;  1G8M A;  1GN6 A;  4RAI A;  2OTJ P;  2QSI A;  3L75 D;  3X2Q C;  2YKQ A;  3F5T A;  3J7A U;  4QE9 A;  4JYA O;  2OYH C;  3CP1 A;  1N2D C;  3RT3 C;  4EDF A;  1QHT A;  2VRS A;  3V2N A;  1QGK B;  1HUC A;  4OGQ D;  1M7L A;  3KYQ A;  5FNV A;  2AGA A;  5APT A;  1O9G A;  1IBM O;  4HBN A;  4J41 A;  4LBE C;  4LF4 B;  2JWD A;  3CI9 A;  4H0L C;  2FYU G;  2OIE A;  3RFR A;  1H0T B;  4MVU A;  4D6T J;  4UB6 Z;  5KHJ A;  1GKF A;  5LXT A;  2EIN B;  2O01 N;  4G27 B;  1FXK C;  1DIP A;  5IYZ B;  2NPS B;  1MFT A;  4GKG A;  4PEL A;  3VP8 A;  1KU9 A;  1HP8 A;  1Q7Y W;  1LUV A;  1ZRT D;  4D6T D;  1H2M A;  2GUZ A;  4UCO A;  1K5Q A;  3SPH A;  1SA0 B;  4HB1 A;  3BAB A;  4GKJ B;  1LTS C;  1Q2N A;  4FIP C;  4NKG B;  1YVW A;  3AE2 C;  3CX5 D;  5B66 Z;  2E75 B;  2NR5 A;  1XIL A;  1H2G A;  4FLZ A;  3UM7 A;  2BEZ F;  1KIL E;  3D6Z A;  2P67 A;  5GTI Z;  4TQD A;  2LQT A;  1YJ9 P;  3E83 A;  1PV3 A;  2HG5 D;  3UIA A;  4HKZ H;  3JCU H;  2XHB A;  1SFC A;  1T3J A;  1S5L E;  1NR7 A;  1RPO A;  4L76 A;  4JYA B;  4EI2 A;  1FZC A;  2GTS A;  1L0N K;  2B9Z A;  1Q3E A;  1XUQ A;  3CWB G;  1P84 F;  1PIX A;  4NB5 A;  1WLE A;  4X64 O;  2KIK A;  5AVX B;  4PV1 B;  3HB3 B;  4DR5 B;  1YTF D;  1NH2 B;  1HH0 A;  4UVC A;  3QO8 A;  1AR5 A;  5B1A C;  2IZ1 A;  3CCJ V;  3T1Y O;  1FE6 A;  2FXO A;  3V6I A;  5LMU B;  1M90 W;  3HR0 A;  2IU0 A;  2UUB B;  2CH7 A;  4CH5 A;  2DOS A;  1GK6 A;  2B87 A;  2F4V B;  3G6B A;  1SP4 A;  3APO A;  2ZE8 A;  3LW5 H;  3TDK A;  1IFP A;  1PGP A;  1Q6U A;  4I55 B;  1FD9 A;  2Y69 B;  1E5W A;  2WAM A;  4QE7 A;  3WU2 H;  3H1J J;  4LP8 A;  4DR3 O;  1HR0 B;  3RL0 B;  1H88 A;  3B09 A;  2ZKO A;  4TV8 B;  3R4Y A;  3H1I J;  2CGN A;  1VQ6 V;  5B3S C;  1D7M A;  3T4D A;  4FPP A;  5AW6 B;  2O3J A;  3D70 A;  1IBK O;  2Q9L A;  2UXB O;  2CUG A;  2J59 M;  2ITD C;  3K3W A;  2VQE B;  2JJ1 G;  2CTR A;  1AR4 A;  4DK0 A;  1VAR A;  5EIB D;  2Z5I A;  4IHJ A;  4L8J A;  1XMO O;  2QRX A;  2ARH A;  4WCE V;  1A02 J;  3D71 A;  4PJ0 H;  1MAB G;  3IC9 A;  1EBO A;  1XRE A;  1AQ5 A;  2KK7 A;  4QMA A;  4D7T A;  3HKC B;  4TOI A;  1GM8 A;  4BIU A;  5EIB C;  3IC7 A;  2QJP C;  3KCY A;  1MKM A;  4JI3 O;  5AW5 B;  1BS3 A;  2YIB A;  2N05 A;  5TIS E;  4FLW A;  5LA6 B;  2KXP B;  1THZ A;  2XAQ A;  1PGO A;  4BRY A;  1FDM A;  1H8H G;  1QLN A;  2JJL A;  3FX7 A;  3D6Y A;  1OW6 A;  5JQG B;  5FL7 G;  1JNM A;  1YDX A;  3K57 A;  1M1K W;  4PJ0 Z;  4ZHQ B;  1OCC B;  2AHZ A;  4J7J A;  4HZ3 A;  5EBW C;  4DR2 B;  2KI7 B;  1RE4 A;  1RPR A;  4DUZ O;  5KAI H;  2XAG A;  2BCC J;  4I2L C;  4PD4 E;  2KS1 A;  4EIJ A;  3ICX A;  4IGG A;  1SF9 A;  3KXD A;  4I9Q A;  2JEE A;  5F2V O;  3P8C D;  1IK7 A;  2YKO A;  3WB1 A;  1EQ7 A;  5BVZ A;  1J95 A;  2R70 A;  3ABK C;  5E1A C;  3G71 V;  4JZ2 A;  1EN4 A;  4JTD B;  1OMI A;  5FLX N;  5APQ A;  2CH7 B;  4JI6 B;  1K97 A;  2A9H A;  2JEX A;  3WUU A;  1PPJ H;  2E74 B;  1FDI A;  5AW8 B;  2EIM C;  3STZ C;  2QKS A;  3WG7 B;  3JAS A;  2ATK C;  5LP6 A;  1Y47 A;  5TIS H;  5M1B A;  3LUT B;  2P58 A;  5LGT A;  3ZMZ A;  1IFJ A;  1JTH A;  4YJ2 A;  1HNX B;  2OCC B;  5IJ9 A;  4U3F J;  2POH A;  3CXH H;  5AVR B;  2BSK B;  1GW3 A;  3BVH A;  2R9R B;  1PP9 D;  1VQN V;  2Y4U A;  2QEX V;  1Y76 A;  3O65 A;  1BCC G;  3H1L G;  3AED C;  2HPC A;  2JWA A;  3ABL C;  1BCC E;  1FXK B;  1EC5 A;  1BSN A;  3RGU A;  2E3C A;  4JI1 B;  2G3A A;  2WLJ A;  4OX9 O;  5DM6 V;  2EZP A;  1NTZ E;  3AK3 A;  4MW8 A;  1N73 A;  1FJG B;  3CD6 P;  4DR3 B;  4X65 B;  4GIF A;  3ZHQ A;  2C0X A;  2JS3 A;  4N78 D;  1SQB H;  1IFN A;  3AE6 C;  3ASN B;  3K5N A;  4R50 A;  3PHL A;  4DV5 O;  3JYC A;  2PFX A;  5B1N A;  1L8D A;  1JPX A;  4YXW H;  4ZMD A;  3AG3 C;  4UFZ A;  4LH7 A;  4PDL A;  1JTH B;  5CA0 A;  2XUM A;  2KS1 B;  3A0H Z;  2ZAE B;  2W27 A;  3DC5 A;  3T1H O;  2FYZ A;  3TGU H;  2QJP B;  3VYI A;  1Q6H A;  3H1H G;  4UB8 H;  4Z1M H;  4FLT A;  1EN5 A;  1GK9 A;  3AEI A;  1S72 P;  4IFD K;  1HF9 A;  1WMK A;  1Y74 B;  5B66 E;  3H1K D;  2ZR3 A;  2K1A A;  5AW4 B;  3CC2 P;  3WFV A;  4DR1 O;  3WUT A;  4DV5 B;  1WN7 A;  4ZIB A;  2F4V O;  3CX5 E;  2LW1 A;  1KOR A;  2IX7 C;  5FPR A;  1M56 C;  2Q7C A;  1N7S C;  1EDI A;  3AG1 C;  3BEH A;  3MHV A;  4BW5 A;  1LP1 B;  5GTH E;  5KUK A;  1G2C B;  3ZMU A;  3JD0 A;  3M99 B;  2YNY A;  3HD7 A;  1FZC B;  1ZRT E;  1U96 A;  3TYY A;  3CCS P;  1VQO P;  1WPB A;  3A0R A;  4WFA V;  2PAJ A;  4JI7 O;  5H9C A;  4IYH A;  4IL6 X;  1URQ D;  4WY4 A;  1EDL A;  1LWU B;  4OGQ C;  4I50 B;  1U7M A;  1BDC A;  1B3Q A;  1FU1 A;  2QR4 A;  2X6B A;  1NTM E;  1KKC A;  1GN3 A;  4DR2 O;  3JCZ A;  2BCC G;  3ZX6 A;  1TU3 F;  4MSW C;  1L0N D;  3GWK C;  1HVV A;  1M8O B;  4HAM A;  4JGS A;  2LP7 A;  1SQB E;  1XMQ O;  2N1T D;  1NKD A;  2UXX A;  4O2A A;  2UWJ E;  3L9D A;  1YTZ T;  2OTK E;  3M0D A;  5AVY B;  3CCU P;  2FFD C;  2FFD B;  2PYL A;  3F89 A;  1BSH A;  1KIL B;  2EJR A;  1KC8 Q;  3SWK A;  3HD7 C;  1MUU A;  1IC2 A;  4XDL A;  1SQB J;  3KDP B;  4LF5 B;  3JAL A;  5B1A B;  2X6A A;  3SSU A;  2ZE7 A;  3Q4H A;  1VF5 D;  1N7S A;  2WPV B;  3H1L D;  2WWW A;  1FZE A;  2W6J G;  3I56 P;  2QM8 A;  4MVM A;  2WLI B;  3ZN0 A;  1I0H A;  3M91 A;  2DJV A;  3CCJ P;  5KUM A;  3HKE A;  1FAF A;  1EXI A;  5C8Y A;  4B08 A;  1SQQ E;  1QCE A;  1FJP A;  3L70 G;  2Z3Y A;  2RN0 A;  1FZG A;  5CA0 B;  4JI3 B;  1H2S B;  4OX9 B;  3ZED A;  4LF9 O;  1QLE B;  2Z4E A;  2Q73 A;  2VRZ A;  4DO2 A;  4CZZ A;  1IXM A;  1AP5 A;  3OTO O;  2CK3 H;  1OJH A;  2RCV A;  1V54 B;  3OUF A;  2UUC B;  1PL4 A;  4PD4 F;  2NRG A;  4GCZ A;  1P7B A;  1FS0 G;  3BRV B;  3V2R A;  4WFB V;  4B3S O;  1WP7 A;  4CC6 A;  2HLD G;  4O4J A;  3B8E B;  4NPF X;  4JV5 B;  3JAT A;  4O4L A;  2B1I A;  1US6 A;  4JAS A;  1KD1 W;  4JI2 B;  1KB9 F;  2K9Y A;  3P7K A;  4TV8 A;  1S1C X;  2Q1K A;  1M1J A;  1IBK B;  2RH0 A;  1JY2 O;  2QWR B;  3AEC C;  4FLV A;  1K9M W;  3A8T A;  1VQM P;  4PV1 C;  4FM1 A;  1NTM K;  1XNR B;  2G8Y A;  2WA3 A;  1QLE C;  5K1P A;  2M5A A;  2A3Q A;  5APW A;  4L73 A;  5BZB A;  3RYI B;  1AA0 A;  1WT6 A;  2AXT H;  3MUD A;  1PNM A;  5BMV B;  3KHU A;  2K1E A;  1XTG B;  5KJ7 D;  4FLY A;  5KLV H;  1FJK A;  3RYF A;  3UT5 A;  4O2B B;  3JCU E;  4K35 A;  2Q7E A;  3ZCC A;  2UUA O;  1PNK A;  1RE3 A;  3C90 A;  1D5A A;  3B5N C;  1JMK C;  3ETG A;  1EDK A;  2JK5 C;  3RK3 D;  4JI1 O;  5B3S B;  5IYD O;  3B4S A;  1B6Q A;  1ZUQ A;  1M1J B;  4R4M A;  5KLV J;  2YC0 A;  1DTO A;  4GX2 A;  1GL2 D;  2P10 A;  1KKD A;  1OVR A;  1PP9 E;  1DD4 A;  2WMM A;  3EVK A;  1KYO I;  1AFO A;  2A45 I;  2A0L A;  2BCC H;  1EFR G;  2F43 G;  5KX5 A;  3SYA A;  2PI4 A;  4XDK A;  1JY3 P;  4KXR A;  2QIW A;  2ZT9 C;  5EFW B;  2AZ2 A;  2ZR2 A;  1B06 A;  3VQY A;  3JAM N;  2ZDI A;  5CCG A;  3SJQ C;  4LWS A;  2I1K A;  2VQF O;  4H33 A;  5CMZ A;  5KMG B;  1SZT A;  4DR7 B;  1BHA A;  3SWF A;  1N7L A;  4GKK O;  3OGI B;  2MJZ A;  5LOV A;  2KP8 A;  5IY5 C;  2JKV A;  1TAE A;  4MVS A;  2QVA A;  2L5G B;  2Q3E A;  1Q8I A;  4DT0 A;  1PV0 A;  2OGU A;  4OPA A;  3RN4 A;  1Q81 W;  2V7Q G;  3ZHR A;  3F5W C;  3PTZ A;  3N2G A;  2WSC J;  4PD4 I;  3L70 D;  4B3T B;  1Q86 Q;  4N23 A;  3GW6 A;  2EIL B;  1M56 D;  2KLU A;  2JGU A;  1IXB A;  3VMA A;  2XAH A;  4LF6 O;  4FZ0 A;  3L70 J;  5FNV B;  4NXN O;  1RF0 C;  1CI6 A;  4CH4 A;  3E86 A;  3ZRW A;  4YXD C;  2D2C B;  4LF4 O;  3ZIA G;  2CTQ A;  2WLN A;  1SET A;  3E2E A;  1S5L H;  3G3Z A;  4MTF A;  1SQX E;  4LFC O;  1VQ5 P;  2P5O A;  2Q4P A;  1SQB K;  2W6A A;  1FAV A;  2CTW A;  1G2C A;  4J42 A;  1I5Y A;  3HKB B;  3HD7 B;  1JUN A;  2IH1 C;  4DV2 B;  1VQ5 V;  1EZV H;  4JI0 O;  3CCU V;  2QE7 G;  1P84 H;  2GSM B;  1PNL A;  2R9A A;  5B5E E;  5KA5 A;  4AIL C;  5L3B A;  1P84 E;  2W8Z A;  3RK2 B;  1FZA A;  1URQ A;  4WY4 D;  1Q7Y Q;  1YJ9 V;  1OXZ A;  3CCV V;  3CRM A;  1XMO B;  4GLX A;  5KMG A;  5L3G A;  2AEF A;  1BGY J;  1VF5 C;  1GM7 A;  1RQV A;  4LNU A;  4I5S A;  3GB7 C;  4UCU A;  1NU1 K;  1I08 A;  1YQ3 C;  1USD A;  3HD7 D;  2W0X A;  3APQ A;  4EB6 A;  1Y9B A;  1JR9 A;  4ASV A;  1RF1 A;  3H1I E;  4J7Z A;  5B1O A;  3E35 A;  4XE5 B;  3HKC A;  1VQ8 V;  4I1L A;  1NO4 A;  1BGY H;  4JI8 O;  1GZL A;  2WTY A;  3A3Y B;  2P4K A;  1YIT V;  4B86 A;  2PRR A;  5CHX A;  2ADQ B;  1T3U A;  1EZV G;  2D2C D;  2DQ3 A;  2B87 B;  1S9K D;  2QM7 A;  3H1J H;  3KKY A;  3I5D A;  4CBC A;  3WB2 A;  4C7N B;  2QGN A;  3HUS B;  1E1Q G;  1VP7 A;  1DK1 A;  4X20 A;  3E8G A;  3A0B Z;  2MK3 A;  2Y0P A;  2YI9 A;  2R5D A;  2YI8 A;  1OVU A;  2QJY C;  2Q0O C;  4XFJ A;  5GW7 A;  2M7W A;  4J11 A;  1JJO A;  3N2G B;  1JVM A;  4B3R B;  1M57 D;  5CCH C;  2CDY A;  1RY3 A;  3LNM B;  1OX3 A;  2Q5Z A;  2UXB B;  4X64 B;  4UV9 A;  3IFM A;  1J1D C;  2NNU A;  4GZR B;  3LSQ A;  4JI5 B;  3QO7 A;  2IW5 A;  1ZTE A;  1BGY E;  1JB0 J;  2QE7 H;  3CCE P;  1CI6 B;  3ZN1 A;  2IPP A;  2KB7 P;  4AYC A;  3OE7 G;  3HE4 B;  1F7Y A;  4MVQ A;  3WU2 E;  3CD6 V;  2OYH A;  4E4E A;  4TV9 B;  2W6J H;  3ASO B;  4KHX A;  1YI2 V;  3E1R A;  4YY3 B;  3BCC H;  1KIL A;  1LT9 B;  3CPW O;  3SPJ A;  4X62 B;  4D6T E;  1NTM H;  2YSU B;  3K0D A;  1H2N A;  4JAV A;  2UUB O;  1FS0 E;  2E5Y A;  3CRR A;  2P2U A;  2QJY B;  5AW2 B;  5JH7 B;  1K8A Q;  2PUS A;  1TUB B;  3TGU G;  1MNG A;  3TNU A;  1YJN V;  4BRY B;  3MZW B;  3AEA C;  5D5P A;  1R6T A;  1EM1 A;  4CS4 A;  2WVR A;  2DMX A;  1NVP D;  1BCC H;  2H88 C;  2E74 C;  1HR0 O;  2Z0A A;  2HVJ C;  2YDE A;  3ZHV A;  1YXB A;  1IBL B;  1GMJ A;  3K5M A;  3L70 E;  2VS0 A;  2LJ2 A;  4QPJ A;  3CRA A;  1KYO E;  3Q5S A;  2JVD A;  4GX1 A;  1OW7 A;  1MG1 A;  1EDJ A;  1H2L A;  4WBN A;  1NU1 D;  3CC7 P;  1X0T A;  1W2B O;  2XAJ A;  1X4T A;  5APY A;  3Q5P A;  5APX A;  3QF7 A;  4RWU A;  1I94 B;  1I5X A;  4ICG A;  4RES B;  1GM9 A;  2Q67 A;  1GTW A;  4FM0 A;  2UU9 B;  1NU1 J;  2RNB A;  5KHG A;  1H8E G;  2QSA A;  3L73 E;  2E76 C;  4DR6 O;  4DV4 O;  1GK4 A;  1M93 A;  3FD9 A;  3B71 A;  4U7N A;  4DV2 O;  5LL6 Y;  3CHX A;  3UO2 A;  1L0L E;  3RW0 A;  1R5S A;  3ZRS A;  1Y74 A;  2EIK C;  3RVY A;  3PLN A;  1XNQ O;  3Q1M A;  1XL4 A;  2O1J A;  1USE A;  1UII A;  1SQQ G;  4EEQ A;  1R5L A;  2JGD A;  5H6Q A;  5KAI E;  2D2C C;  1SQB G;  2X0L A;  1CP9 A;  4F6R A;  2WLL B;  2Y48 A;  1LTI C;  1PP9 J;  1YSC A;  2DW4 A;  1S4X A;  1SQX K;  4RQF A;  3AG4 C;  1YEW A;  1KUQ A;  1AVO A;  4UB8 E;  2P90 A;  1L0N H;  3I5C A;  3S1K A;  3T97 B;  2Q0A A;  4PA4 A;  1WNS A;  2DWD C;  5LBQ A;  4N3Y B;  3FYI B;  3M9H A;  1ZR2 A;  3ML0 A;  3KZI E;  1T8Z A;  5KAF H;  1OV9 A;  2WIT A;  4P9P A;  3SYC A;  2OCH A;  5EYP B;  2WPR A;  1GN2 A;  3SPC A;  5KTB A;  3M7M X;  4JYC A;  1HDJ A;  1E79 H;  1JCC A;  3E22 B;  1XMQ B;  3JAR B;  3JAK A;  4I4T A;  2WLK A;  2JDI G;  3DTU B;  4UB6 E;  3H1H J;  3L35 A;  1NU1 E;  1WB8 A;  1RHZ B;  2BCC E;  2FYU H;  1ZV8 A;  1NTK H;  4X66 O;  1NVO A;  2C2A A;  1SQV K;  2HJF C;  5H5N A;  3ABM B;  2N1T B;  2LW7 A;  1KBH A;  2XV5 A;  1RSO B;  2N04 A;  1YZB A;  3RL0 g;  2OYI A;  3F7Y C;  3IFX A;  5LHG A;  3H1H E;  1XHZ A;  2PZS A;  2EIN C;  2DN9 A;  4L87 A;  2FL4 A;  1SRY A;  5E79 E;  4U3F H;  3TGU D;  5BU8 B;  5KAF Z;  3EWK A;  1K34 A;  1KEC A;  4X66 B;  1SQP D;  3K9A A;  3ZMT A;  3U0Z A;  4JTC B;  1NYH A;  2P06 A;  3ZBH A;  1S72 V;  2XT9 A;  3TGU J;  3C1L A;  1XQ8 A;  1S76 D;  5APU A;  2QTO A;  1N8R W;  3CCR P;  3VBB A;  3HKB A;  3A2F A;  4FVM A;  3JAW A;  1ZP0 C;  5CA1 A;  2FML A;  1QX8 A;  4LC1 A;  1PGJ A;  1M57 C;  2L91 A;  3B5N B;  1PPJ D;  2XZR A;  1HBW A;  4JI4 B;  2ZYA A;  1VEW A;  1NTZ G;  1K4C C;  3CXH F;  4IL6 H;  1VF6 A;  3LNN A;  4U7O A;  2W83 C;  4HYT B;  4DR5 O;  3ZRW B;  1ZX3 A;  2YO2 A;  4I0X B;  3OEH G;  3M9Q A;  4LF8 O;  1TVK A;  1SQF A;  4OH8 B;  1KFN A;  2RMK B;  4JI4 O;  2P7J A;  5D5Q A;  1GN4 A;  2SPZ A;  1R8E A;  4LCU C;  2ZE6 A;  4MVR A;  1SQV D;  5KLV G;  4RQE A;  2EUL A;  1KQL A;  3QH9 A;  4UVB A;  5CBG A;  1J5E O;  3L74 J;  2ZE5 A;  3VN0 A;  1SQQ D;  2RQ6 A;  2KZI A;  3OW2 O;  2OTL V;  1Z2G A;  1YJW V;  1SQV H;  2RMZ A;  5CA1 B;  3H1J E;  1GRJ A;  2AHY A;  1KIL C;  3B5N A;  2XAF A;  4QPK A;  5J2U A;  3H1H H;  3E7K A;  5LYJ B;  1WPX A;  2UU9 O;  3Q3D A;  5EK0 A;  1N73 B;  4BXL A;  3CXH D;  1LTJ A;  3KZI H;  3HUS A;  1DEB A;  1JEK A;  3CRC A;  2Q3I A;  4PA7 A;  1NTM J;  2YMK A;  5TJH A;  4PA3 A;  3MAQ A;  2ZXW C;  1SLQ A;  4W7Z A;  3G71 P;  2GUS A;  3PP5 A;  4MTG A;  5LGN A;  3BCC J;  4H44 B;  3SJB C;  1AI7 A;  4D6T H;  5IYZ A;  2NPS A;  2H3O A;  4JAU A;  4NXM O;  3ZHS A;  3IR9 A;  3G80 A;  3AE9 C;  1KQS U;  4DW0 A;  2BTQ A;  1RSO A;  1JJ2 U;  1OCO C;  5J9P C;  5BR8 O;  1FOS F;  1QNM A;  4WFH A;  2ZYG A;  1AJP A;  2KKW A;  2Y0I A;  3H1K J;  3GVM A;  2WA4 A;  3OMA B;  4ZKP A;  3T4Z A;  1L4A A;  2BTO A;  4LWS B;  2ADP A;  1Y66 A;  4DUY O;  2KYV A;  1NJI W;  1KMI Z;  1KP2 A;  3LW5 J;  2LR2 A;  1HJB A;  3BA9 A;  4B7E A;  1WJZ A;  2YID A;  4J10 A;  3QVN A;  2LGQ A;  2XAS A;  3ZDM A;  1BE3 G;  3AG4 B;  1IZ3 A;  1HNW B;  1YIJ P;  4LF7 O;  1RH5 B;  3CL3 D;  4YJ3 B;  2VQF B;  5LGU A;  1XOU A;  3OAA G;  5L3C A;  2EIJ B;  1NTK G;  2H89 C;  4GYC B;  4RUE A;  1XNQ B;  5AVV B;  2FB5 A;  3VOP A;  3NFQ A;  5E79 H;  5LHH A;  2KZJ A;  3W67 A;  4FLX A;  1N36 B;  3TXS A;  4B3T O;  1IDS A;  1JY2 N;  5CCG D;  3JD2 A;  5K5G B;  4Y28 J;  4KT0 J;  3RYH B;  2Y0C A;  3A0H H;  4JTA B;  5GON A;  4K8X A;  3H1I H;  1S2E A;  1GL2 C;  1NHL A;  1Z5W A;  2YIA A;  2ETN A;  3KZI Z;  4DRX A;  2VWJ A;  1P84 D;  1H89 A;  1IBL O;  2M3B A;  1NI8 A;  1XEQ A;  4A7P A;  3CJH B;  4TT3 H;  2DW3 A;  3T97 A;  1T6A A;  3A0B E;  3M0D C;  1VQK V;  3AG3 B;  3RGB A;  1UJW B;  1L0L G;  3CCV P;  1VF7 A;  1FFX A;  5CN0 A;  1AB3 A;  3L73 G;  3C9I A;  5KJ7 C;  3FB7 C;  2LGW A;  3K5O A;  4PI2 A;  4DW1 A;  3IAO A;  2NN4 A;  1K05 A;  2LXC B;  2IFM A;  2GHY A;  2PGG A;  2FXP A;  2HOD A;  3L75 G;  1NWQ A;  1LTT C;  1SQX D;  1YJW P;  4FM2 A;  1W2B U;  1SS1 A;  3AG1 B;  3KPE A;  1AJY A;  3W7W A;  3DSQ A;  2PP6 A;  3SYQ A;  1LTB C;  3OA7 A;  1GAX A;  2Y0D A;  3RK3 E;  3GHG C;  4KJM A;  1K73 W;  4Q6G A;  3K58 A;  2ZNJ A;  2FY8 A;  3SWY A;  2KG7 B;  1JQ0 A;  1BMF G;  4X8A A;  4DRX B;  3D36 A;  1M9N A;  3K9S A;  2FXM A;  4K8Z A;  1PFI A;  1M57 B;  3MDS A;  3CMA V;  4X1K A;  2FYU D;  4EOT A;  3OTO B;  4IYI A;  3W68 A;  3G9R A;  1R1B A;  4KHP O;  1JY2 P;  5B5E H;  1BZK A;  2AXC A;  1GU5 A;  5JCO A;  1IK9 A;  5EYP A;  3CWB E;  1J1D B;  4AUW A;  1DLB A;  1QU7 A;  1G1X B;  4NTW A;  3AE7 C;  1YTZ I;  2EIM B;  1YTF B;  4D6T G;  2K3R A;  1SQX H;  3HKD B;  5AVQ B;  3E8H A;  1SQP H;  2N74 A;  2E5L O;  3AG2 B;  1ZXG A;  2FTK A;  2R32 A;  2H8P C;  2QKA A;  1AR1 B;  1N7S B;  1P84 I;  2OTL P;  4H13 C;  4YTP C;  1BE3 D;  4G2K A;  3F7V C;  1Y6X A;  3OEE G;  1NZ6 A;  4JYB A;  3F5H A;  2A7W A;  2GTA A;  2Q6Q A;  1BGY G;  3GMA A;  1FBM A;  4NR1 A;  1NTK D;  1K5S A;  4LF5 O;  1GO3 F;  2YXH A;  1BE3 J;  3L71 E;  3OM3 B;  3IJ4 A;  2XND G;  3FAV A;  3L75 H;  2AEJ A;  1N32 B;  1MOF A;  3OD4 A;  3W7X A;  3QNE A;  1NTK J;  1FDO A;  2JJ2 G;  2HOD B;  2LO1 A;  1N73 C;  1I7F A;  3JAK B;  4I4T B;  4RJT A;  2FYU E;  5B1B B;  4TUY B;  1E79 G;  3CS5 A;  2E5L B;  3FWL A;  4UCR A;  3SJA C;  1BDD A;  5IWA B;  1VF6 C;  2ZVO B;  4EYY Q;  5KKZ B;  4MW3 A;  4PDV A;  2KG7 A;  3R65 A;  3G6E P;  1NOH A;  2RKL A;  3GHG A;  3GWO A;  1Q86 W;  1CEZ A;  4H13 B;  1WA8 B;  2WPS A;  3MHS C;  2GV9 A;  2QM4 A;  4G28 B;  4NYK A;  4HJG H;  1L0L D;  3ABL B;  5KHH A;  4EFE A;  1JMB A;  4UB8 Z;  4X20 B;  4X1Y B;  3FX0 A;  4GOE A;  4AHC A;  2B88 A;  3ZMS A;  1QVF U;  1Y8A A;  1KB9 D;  5KJ7 A;  3H1I G;  2WLM A;  3VOU A;  1NJI Q;  2A45 G;  2BOC C;  3TF5 A;  4DV0 B;  4HNA B;  4JV5 O;  2WSE J;  1K4D C;  2OYI C;  1SFC D;  1JOC A;  3L75 J;  1Z5V A;  4GDO A;  3FKS G;  5GTH Z;  2BTQ B;  1FJG O;  1NTK K;  2ZXE B;  4NPE A;  5JJE B;  2F95 B;  2A79 B;  2IH3 C;  1LTA C;  1ZLL A;  3BFR A;  1ZWI C;  2UXD B;  1N34 O;  2F1M A;  4J9Z B;  1UPG A;  1N86 A;  3SPG A;  2WT7 B;  2LKM A;  4RUF A;  2KSJ A;  2WQY C;  4LFB B;  1K9M Q;  2A06 D;  3FB6 C;  3KCX A;  1HGV A;  1P4R A;  1X59 A;  1G6U A;  4JI7 B;  2IBZ G;  5L8R J;  5JQG A;  3N2K A;  4P30 A;  4L74 A;  1MMM A;  4H44 C;  1OFC X;  3UKM A;  2QJ1 A;  2E43 A;  1SC5 B;  4R4L A;  5KAI Z;  1NH2 D;  1W59 A;  3CME P;  2L6L A;  4X9Q A;  1LT9 C;  1YCI A;  3M8A A;  3M06 A;  5IJ0 A;  3GHG B;  1N36 O;  3V2P A;  1S5L X;  1VQL V;  2CAZ C;  4X1I A;  2HHH B;  2DYR C;  1U7J A;  4I55 A;  2FYU K;  1L4A D;  2DE0 X;  2UXC B;  2QWO B;  1AP6 A;  2ZT9 B;  3Q5R A;  3L71 H;  5JJN B;  1BGY D;  3E8F A;  1MZ9 A;  4QJF B;  1LWU C;  1K73 Q;  4C7U A;  4UCS A;  3JD3 A;  3SFE C;  5EZY A;  1BHB A;  3M0A A;  3M9B A;  4PJ0 E;  2H94 A;  3BHP A;  4WY4 C;  3VMZ A;  3CCL P;  1KN7 A;  3BAT A;  3BAA A;  3S4R A;  1MA1 A;  3PJS K;  1L0N E;  2IYP A;  1ZSP A;  2X7R B;  1PZQ A;  5DN6 G;  1FXH A;  1SQQ K;  4I50 A;  4JI2 O;  1DD3 A;  1NBM G;  2IJJ A;  5A2Q N;  3JAL B;  3CX5 F;  2LFS A;  3O8Z A;  3V2Q A;  3Q4H B;  2N1T A;  1NKN A;  4W7Y A;  2DYS C;  1DF4 A;  5CBF A;  1M5I A;  4CS2 A;  2WLH A;  4X65 O;  4W80 A;  3B40 A;  3QG5 A;  4FK5 C;  1JFF B;  4IOI H;  3HPL C;  4I9W A;  2AZ0 A;  1KB9 I;  2WSS H;  2HJD A;  4O2A B;  4OVN F;  1PP9 G;  4OPH A;  1HW7 A;  1YHQ V;  1N33 O;  4AI8 A;  4H44 D;  1S5J A;  1V54 C;  1ZOY C;  4UVA A;  2I1J A;  2JR8 A;  1Q82 W;  4B7K A;  2F23 A;  1AJN A;  5H2F E;  1HNX O;  2CGO A;  2GUZ B;  3UO3 A;  4GT1 A;  1NU1 H;  1FZB A;  3H1I D;  4JF3 A;  4HYO A;  5H2F H;  2BE3 A;  1CXZ B;  2XOK G;  4GUN A;  3K5L A;  4DR1 B;  1DH3 A;  3CCQ P;  4KL1 A;  5IJ0 B;  2R3S A;  5BXZ A;  1G1J A;  2ZM6 B;  1IZN B;  4U3F E;  1EXJ A;  2FBW C;  3SPI A;  3RBX A;  1ZW0 A;  5J2T A;  4ZBM A;  4MTX A;  3CPW U;  4DV3 B;  3CC2 V;  1IFI A;  3CCQ V;  4DV4 B;  3TJT A;  4JI0 B;  4O9B A;  1YIT P;  4LFA O;  5BY1 A;  4O4J B;  3CC4 V;  4DV1 B;  1NGM B;  2WSF J;  2OWO A;  2GA1 A;  1XBL A;  2JEU A;  2E42 A;  5CB4 A;  4F4L A;  5KHI A;  2A06 G;  4YIP A;  3V4W A;  3H1H D;  3WMM 0;  1GW4 A;  1XI1 A;  2IBZ D;  1RM1 C;  3H1L J;  5GTH H;  4GX0 A;  4YY3 O;  3H1K G;  1KB9 E;  4WF9 V;  2M6Y A;  2J58 A;  3J80 N;  3CJH A;  5KLI C;  1NR1 A;  3OUS A;  3OR6 C;  4Z2W A;  1NAY A;  3ABU A;  3D36 C;  3WG7 C;  2WPD G;  3CYO A;  3ABM C;  1BCC D;  2KNC A;  1OW8 A;  2YXQ B;  4OWF A;  4QIW F;  3RK3 C;  1JFF A;  4DV7 O;  3OT7 A;  2YIU B;  2D3O W;  4O4I A;  2YIU C;  3B5N D;  5CJ0 A;  2Y4T A;  3CMA P;  3SGI A;  3CRQ A;  1VQ9 P;  2LFR A;  3OMI B;  3L74 E;  3H9V A;  1N34 B;  2PI5 A;  2UXD O;  2Q8V A;  2Y9Y A;  5BU5 A;  4WWI A;  4TV9 A;  5E79 Z;  1R3J C;  2P4V A;  2YXL A;  1NTZ J;  2QWP B;  4IFF A;  3WUV A;  3K79 A;  1AV1 A;  2JDI H;  1H8A A;  3G4S P;  2OYO A;  4BWA A;  1QLE D;  5KLV K;  2BCC D;  3VQX A;  1L0N G;  4K3A A;  4DR7 O;  1SQP E;  3SDL A;  5TIS Z;  5CCH D;  1ENV A;  1OCR B;  1OCR C;  2EZO A;  2OQQ A;  1R6K A;  2B5U A;  3L71 D;  4DUY B;  2H8P D;  3BY6 A;  3L4F A;  4XDJ A;  4J7K A;  2LXB A;  3QTC A;  4Y99 B;  2WLI A;  5HFM A;  2RN9 A;  1K7D A;  1JY3 N;  3I55 V;  2WPQ A;  1VIB A;  1SQV J;  3AE4 C;  4I7Z C;  1DEE G;  3AG7 A;  3NR7 A;  3BA8 A;  3NMD A;  1HTL C;  3RVZ A;  4D7S A;  2O01 H;  1K8A W;  2K9J B;  4LF7 B;  1KYO H;  4NTY A;  2RJZ A;  1TUB A;  1SQQ H;  2PY5 A;  3OMN B;  4WY4 B;  3SYO A;  4WB4 A;  3L73 J;  1MZF A;  1V55 C;  3H1K H;  1Q6I A;  2OCC C;  1QBZ A;  4X88 A;  4QNH B;  1TA8 A;  1HWY A;  4DV0 O;  2KNC B;  1NTM G;  1BE3 H;  3P32 A;  1YQ4 C;  1JOY A;  2JRI A;  5J2T B;  3BRT B;  3BCC G;  2IJI A;  1NTZ K;  4WBA A;  3I56 V;  3AE8 C;  1RP3 B;  2CK3 G;  3IN6 A;  4PD4 D;  1WP8 A;  2GDS A;  3K06 A;  1DGS A;  4UUJ C;  2KSE A;  2JIZ G;  4U3J B;  1FPO A;  5LP6 B;  1J1E B;  3CCM P;  2HYN A;  3JAR A;  3K5B A;  1KTM A;  4PD4 H;  4NTX A;  5B5E Z;  2PTM A;  4C7R A;  5AW7 B;  1LJ2 A; 
#chains in the Genus database with same CATH homology
 3B4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...