3B4SA

Crystal structure of a luxt domain from vibrio parahaemolyticus rimd 2210633
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
b'ADGRIFKMFIEHLEFEKGLDAFSQSWIKALEDSEFLAILRLLFHHIVTSESAHEFAANGIDRLYKMVESQFGSGGDKELEWLIGRSLIQMSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein LuxT
publication title The crystal structure of a LuxT domain from Vibrio parahaemolyticus RIMD 2210633.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Structural genomics, unknown function
total genus 30
structure length 92
sequence length 92
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18285 LuxT_C Tetracycline repressor LuxT C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.790 Mainly Alpha Orthogonal Bundle Helix Hairpins luxt domain from vibrio parahaemolyticus 3b4sA01
1.20.5.830 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces luxt domain from vibrio parahaemolyticus 3b4sA02
3B4SA
chains in the Genus database with same CATH superfamily
2NZ2A 3FKSG 5H6RA 1OJHA 1KQSU 4J7JA 4ASUG 1VF5B 2YMYA 1MZEA 4HJGH 4DJGA 4QPJA 5IWAO 2UU9O 2QEXP 5CCGD 4TSFG 4EEQA 2YXYA 4JI2B 4LF4B 1NTKG 3E22B 3RBZA 2QWPB 4GKGA 2Y9ZA 4JI0B 3SYOA 4K8ZA 4IOIH 5EIBD 1KC8W 1SRYA 4U3FJ 3RL0C 1VQ5P 4WCEV 4ZNCA 1T2KD 3VN0A 2FYUD 3TGUG 2X6AA 1QNMA 2EIJB 2P67A 5LBQA 1Z5VA 1KILB 3CMAP 3HKDA 3ABLB 4UB6E 3RYFA 2Q7HA 1JFFA 2A06G 2VRSA 1ZLZA 2DW4A 3D36A 4D6TE 2OTJV 3CCMV 2DYSC 1QL1A 3RYIB 5L3GA 2WVRA 2H8PD 1GAXA 3IJ4A 4GX2A 1YBKA 1EDIA 3D6YA 4YXDC 5KAIZ 2P90A 1RE3C 1SFCA 2ZAEB 4UV8A 1MG1A 4DV3O 1XMOO 2UUCO 4X88A 4DW1A 2E5YA 3A0BZ 2IJHA 1H2MA 1FAFA 3VQVA 1XUQA 5LYJB 2E75C 2ZT9C 1VQLP 2WA3A 3ZS8C 1GL2A 1VQ7V 5IY5C 3B5NC 2GV9A 2LXCB 4CPGA 1FXKC 3L75J 3G3ZA 4W80A 1IC2A 3KPEA 1OCZC 1K3EA 1S72P 2BTQB 2ADQB 5H9CA 3ZHRA 5IE9A 1BCCG 3PRJA 3L71J 1JY3O 1AJQA 4H0LC 5JJEB 1HUCA 3CCSP 2FY8A 4PDVA 3KCXA 2WZ7A 1PL5A 4A7PA 4IYHA 2ZE8A 1Q86Q 1HH0A 2OCCB 1NJIQ 4IYIA 2R9RB 3STLC 4TV9A 3G6EP 4I4TA 5APWA 4UV9A 3ZHTA 1PM9A 5CN0A 3JC22 4KHXA 4HKZH 3JATA 3CMEP 3CC7P 3L37A 4TV8A 1Q6IA 3BVOA 5BU8B 2F43G 2GTSA 2ETNA 2YEVB 5CA3A 1L0LG 1L4AC 2LKMA 2O1JA 1WLEA 2XNDH 2P58A 4DR6O 1RPOA 3BA8A 2AXTH 2FYNC 2Q5UA 4X64O 2IYOA 3L70D 1NTZK 4DR1B 1GMJA 1XEQA 3J80N 2QJYB 1HDJA 3ZEDA 2Y0IA 3G6BA 4IGGA 1L8DA 3LIDA 2QDOA 3PN1A 5D5PA 3SFDC 2E43A 2FTKA 3CCEV 4DR7B 3TNUB 4HBNA 4OGQB 3CS5A 4DR5B 5KLVJ 3K0GA 4RUFA 4UCVA 1THZA 2KS1B 1IFIA 2ZVNB 4X8AA 2B88A 2Q1KA 3T97B 1NR1A 2H88C 1CI6A 2Q73A 5EZYA 2AHYA 3NXSA 2BCCD 5JQGA 1IK7A 1Q6HA 4TLFA 5DEDA 2ARHA 2MW2B 5LA6A 1TA8A 1SQVG 5APQA 2OTKE 3P8CE 4PD4D 3WUVA 2FL4A 4D6TG 5HFLA 1IBKO 1YTZI 3I56P 1P84F 1G1IA 2HODA 4W7YA 2WSSG 5H2FZ 2BSKA 4YHHB 4HNAB 1GRJA 5CB4A 5IDJA 2N1TD 2WSFH 1IFMA 3M9BA 5C8YA 2IH3C 3JAWB 1NTZH 1Q86W 3OJAB 1I7FA 3JCUE 3W68A 1M9NA 3W7SA 2BTOA 4O4LB 1I5YA 3IF4A 4NPEA 1DK1A 3MTUE 1BHBA 3K06A 1Y66A 4PI0A 3DC5A 1OFCX 4UVCA 2GDSA 2WITA 3WU2H 2IJIA 4BIOA 1MKMA 1GM7A 3L74J 4LC1A 3RK2B 3N27A 2B9BA 1LTAC 1SQPJ 5KKZC 2QWNB 1IBLB 2MK3A 2OIEA 2ZYGA 3SPGA 3SSUA 2A0LA 4RKUJ 2YIBD 1W2BU 2Q7CA 1PP9D 2GUSA 1RM1C 3E22A 2RH0A 1BGYG 1W2EA 2XZRA 3KCYA 4PELA 4FLWA 2R3SA 4C7NB 1NWQA 1N8RQ 2GBOA 2CTQA 3CX5F 3H1HH 1AR1B 1UIXA 3BASA 2IZ1A 2QEXV 2QJPB 4FPPA 3RL0D 3X2QC 2UXBB 1VDFA 4JPZB 3OTFA 3MHVA 1TUEB 3H1KJ 1M1KQ 3G80A 2BASA 1UFIA 3AK3A 3H1IH 2XHBA 1HP8A 2HYNA 1GZLA 3Q2YA 1FU1A 3BATA 1VQ5V 4J11A 1Z2GA 3IR9A 1S2EA 3ZHQA 1KB9D 3L72D 3O6QB 2BEZF 4LF5O 2JWDA 3RYIA 3MD0A 3JSVC 1PNMA 3E83A 3CMAV 4X9QA 1J1DC 1URQC 2OYIC 4U3FE 2QWOB 3OUSA 4HH2A 3H25A 5EBMC 3UQ8A 4G28B 4J10A 3OE7G 5C39A 4DK1A 2FYUK 1IFNA 1JCDA 2HPCB 4JI7O 4F6RB 1SQXD 4N6JA 4LFAB 4DV7O 1QQCA 2ZINA 4NXMB 2PYLA 4ZMDA 4R8CA 3B5ND 2EBOA 1B6QA 3AE5C 2QVAA 3BABA 1QR9A 2BTQA 1JTHB 4IL6E 1VQLV 3A0RA 1LTJA 3HR0A 1KORA 1SQBD 1MA1A 1NS1A 2LQTA 2R9IA 3GW6A 1DLBA 4I7ZB 2VWKA 2G8YA 3H1JJ 1S72V 3JARB 3ABMC 1JB0J 3M8AA 2ZDIA 5LGUA 2P4KA 3II6A 2WPDG 2EINC 3SJAC 4FM2A 1XILA 1NKDA 1SP4A 3CCSV 4IT5A 2IFMA 3L75E 5F2VO 1R6NA 2OWOA 3K58A 4UB6Z 1KP3A 4C7UA 3U11A 1M56D 3GG2A 1NTME 2AEFA 3M06A 4EIJA 1N8RW 4DV4O 1WAZA 3AEGC 3E2EA 4MN4C 3JD3A 2YEVA 3G6EV 1SESA 2FYUH 1JOYA 2OT5A 2LFRA 1GN4A 3DC6A 5KHIA 1XNQO 3QO7A 2D2CB 1L4AD 4CC6A 3CMEV 2JO1A 4GLXA 3CC7V 4LFBO 1M90W 3S4RA 3SGIA 3OGIB 2E42A 1PD3A 2WMMA 2YICA 4LBEC 2HG5C 3TXSA 1P84I 1OW8A 2DWEC 2PGGA 2CTPA 1JQ0A 2YUAA 4IL6H 2M0BA 5GTHE 2KS1A 4UVAA 5LGNA 1EFRG 1JCHA 1JJ2U 1KQSO 1VEWA 3CXCU 3P8MC 1YDXA 3T97A 2KYVA 3OEHG 1MZFA 2B89A 3TGUD 4X1KB 1N0JA 1PL0A 2QKSA 3L73D 2DQ0A 2JR8A 1M57B 1S5LZ 3OT7A 3W67A 4AQYO 3QF7A 3MZWB 1FBMA 4MW8A 4JTAB 1PGQA 3LNNA 1D2DA 1AJPA 3AG3C 4MVRA 1NTMH 1Z5WA 5KLVE 1VQPP 5EC1C 4G27B 1N7LA 3CWBD 1F4NA 3SPHA 3OR7C 4TUYB 3CJHB 4U3FG 1GTOA 1VQ6V 4HNAA 4DR3O 1J5EO 4JYBA 3JAWA 3BCCH 4WVZA 1KP2A 2Q3EA 1XNRO 3KQGA 2K1AA 4N3YB 4DRXB 2KI7B 4O4LA 1ZXGA 3JCZA 4H37A 1ENVA 1N34B 2E5TA 1K73Q 2FB5A 4XDLA 2W6JH 4AILC 2WLHA 5AVTB 2E76B 1BCCJ 4OX9O 1HNWB 1QX8A 2ZIMA 2YMKA 3ABTA 1H2NA 3IFXA 2R5DA 1L0NK 2F1MA 1X79B 2WSCJ 1J2JB 1OCOC 1P84E 4B3TO 1SZXA 4C7NA 1DD3A 1KYOH 3L75G 1FC2C 3CLQA 1PPJE 3HKCB 2KK7A 3K3WA 2B5UA 4R50A 5EK0A 1SQQE 3SJQC 3L71G 1ZX3A 4N78D 4Z1MH 2JJLA 2WT7B 3AG1C 3B8MA 5TISE 5AW6B 3APOA 3F7VC 4LF8O 1FYJA 2JVDA 4DK0A 4X66O 1KUQA 1NVOA 4LF7O 5BR8B 4QJFB 1ZR2A 1G1XB 3JCUZ 5EYPA 1V54B 5CBOA 2ITCC 2QKCA 2M6YA 2KSJA 5CBNA 3B09A 3C9IA 3CCLP 2Y9YA 1SS1A 3A0BE 2ZD9A 1L0NH 4UCTA 1HBWA 3APQA 1OX3A 3M0AA 2DN9A 3H1KE 2HPCA 2IW5A 5CMUA 4F6RA 5L8RJ 4J42A 2F93B 2V7QH 5LP6C 4DV3B 1XMOB 2UUCB 2IFNA 3M9HA 1VPCA 4LLHA 1FZFA 3JASB 3GMAA 3WG7B 1P84H 3AE1C 5KAFE 3A5TA 3H9VA 1K5SA 2YS8A 2EIMB 1K73W 2JKVA 2BE3A 4H33A 1JTHA 1M8OB 4O4HB 2GUZB 1EN4A 1EQ7A 2EIKC 2ZYDA 1M1JB 1LT9C 4D6TD 1RH5B 1RF0A 3SJCC 1T2KC 4I6MC 1YJNP 4CS3A 1NO4A 5KLVG 3AE4C 1HJ0A 1SQQH 1JCCA 2XOKG 1SQXK 3ABVC 1VQ4P 3CCMP 1DTOA 5KHGA 1XBLA 5B1BC 3LW5H 3SR2C 1PP9H 3NR7A 1MFZA 1Q82W 2EZPA 3C1LA 2ZXWC 1ZLLA 3TJTA 3E35A 4WY4B 1EZJA 2BEQD 2DE0X 1N73C 4LF6O 1AQTA 2YKOA 4L73A 5KAIH 1R5SA 1SQBK 3IFMA 1LUWA 1TAEA 2O01J 3FB8C 1S5JA 3H1LG 3H1JE 2ITDC 1VQ7P 2Q4PA 2H3OA 1K33A 1ZN5A 2DYRB 4FIPC 3A0BH 2CUGA 4PA4A 2O1KA 1USEA 3SWKA 1GDTA 4UFZA 2UUAO 3CX5H 1X8YA 3O65A 1GL2B 1PV0A 4DR6B 2CDYA 1BE3H 2QGNA 2WLMA 3CRRA 3FB5C 4X64B 3AK2A 1EDLA 3K08A 3K57A 4FLZA 1WP8A 3VMXA 4JYCA 2Y4TA 3L74G 2P2UA 5KA6A 1M4UA 1XREA 1FDOA 1SQXH 3LDCA 1KILE 1W5CE 1SQPG 4KUMA 4B86A 1NTKE 1SETA 1Y76B 5IYBO 1LTIC 5CA1B 3G67A 3PJSK 5APSA 3L9DA 4GX5A 1N7SC 4YPCA 3CI9A 1NTKK 2YIUC 1EDKA 3HE5B 1KTMA 3RK3C 4W4KA 1OW7A 1YQ3C 1SQBH 5JJJB 2Z3YA 3CJHA 1QGKB 1RSOB 4RJTA 1PGPA 1IBKB 3EFGA 2KSEA 1OZ0A 1LWUC 2ZXXA 1MV8A 1VQPV 3H1KG 4I1LA 5AW1B 1QLED 2IU0A 4DRXA 1ZMEC 3ASNB 3AEAC 4EFEA 3HRNA 4PJ0E 1P7BA 3VMZA 3FB7C 2YKPA 4I5SA 1LTGC 5APXA 1SC5B 3Q1MA 1OCRB 3P8CD 4WBNB 1W59A 2WLKA 4HB1A 4QIWF 1AR4A 4X62O 1I94B 1VARA 5JVDB 1D7MA 4DR4O 2ODMA 3K03A 2L6LA 5GTHZ 4FLXA 3MUDA 2IYPA 4NPDA 1R1BA 2B1GA 1UJWB 5CCGA 3H1ID 3CRQA 3J81N 1RF1C 2ZKOA 1RQUA 1IO4A 4RQEA 3SYCA 2IBZI 4LCUC 4PA9A 4JV5O 1NTKH 5LA6B 2UUBB 2OYHC 2OYQA 3HKCA 2LO1A 1BCCE 5E79E 2E74C 1NT2B 2X6CA 3RL0B 4DUYO 4GUNA 5H2FH 1JPXA 4D7TA 2NNUA 1JY3P 1YSCA 5GONB 4GKKO 3WMM0 2WT7A 2N1TC 1Y4MA 3TGUH 1FD9A 3H1JG 4FZ0A 1RE4C 1ZOYC 3OA7A 2YXLA 3LSUA 1MNGA 2KKWA 5AG2A 4CS4A 2A06H 4YJ3B 1FZCC 4I9QA 5IYZB 2DYSB 5GW7A 4K3AA 4Y99C 3LSSA 1YI2P 3AEFC 4LF5B 2WSEJ 1L0LE 1YTFB 1VQOV 2QTOA 1EBOA 2HJDA 3FFQA 2ZQMA 1L0LK 3CCLV 3AG2C 3OMIB 2ZT9B 2E75B 2X7RB 1BSNA 3B5NB 1KKDA 1W0JG 3JASA 3IAYA 1FXKB 2Q0OC 4JI7B 4DV7B 3ETGA 1LJ2A 2Q8VA 4GX1A 4BXLA 4O4HA 1OCZB 2GUZA 4ZKUA 1M1JA 4UCSA 4X1IB 1CP9A 4H0LB 1K4CC 2KIKA 1JMKC 1NU1G 2XASA 1VF6C 4QPKA 4JAAA 2IBZE 2A79B 3HKBB 2P1JA 1TUBB 1YJNV 4NKGB 3RGUA 3K04A 2QR4A 3FB6C 5TISZ 1SQVE 5J2UB 2KB7P 2Z5HA 1Q43A 4WY4A 2EJ7A 1VQMV 3CE2A 3T1HO 1VQ4V 4NXNO 5M1BA 2Y0DA 3V2NA 1EZVG 5C93A 2NPSC 1HNZO 4DV4B 1QU7A 4ZBMA 1L0LH 4B3SO 4BWAA 5LOVB 4R6ZA 1AI7A 2WLLB 2FYNB 4YXWG 1XL6A 5DECA 3OTOB 4L76A 1JX9A 2A7WA 1XNQB 2RDCA 1Z56A 4ZI7A 4MTFA 5A2QN 5J9PC 4LFBB 1BZKA 3D71A 1NHLA 2LJ2A 5KLIB 2JGDB 4LNUB 3OEEG 4CH6A 3HD7C 5KAFZ 4MVOA 2JJ2G 3JSLA 1LTJB 1NTMD 1H2KA 5H6QA 3C3TA 2JS5A 5LHHA 1Y74A 1YF2A 1K8AQ 3OFNG 3RWRD 1WT6A 3LUTB 2HKOA 1S5LE 3BCCD 3KHUA 4YY3O 1VF5C 5AW5B 2W6BA 4IL6X 1Y76A 1BGYE 3DGEA 1RY3A 5CA1A 1M56C 3VQXA 4UB6H 2KP8A 1WP7A 4DT0A 1SQVH 1NH2D 1Y8AA 1N7SD 3HE5A 4CH5A 1H8EG 4D6TH 4MVUA 3BA9A 2FFDC 3RK3D 1RSOA 4DYLA 2EX3A 3L35A 2DMXA 4PA3A 2POHA 2WSSH 1KD1Q 4J7ZA 3VOUA 1FZEA 2EIJC 1NYHA 1BQ0A 2A9HA 3JSNA 1AI5A 3STZC 1JY2N 1GU4A 4PA6A 1KILC 3LIEA 3ABLC 3W7UA 4DR3B 2B1IA 1J5EB 2JEUA 1VP7A 3WFVA 4I50B 1ZWIC 1HNXO 1XNRB 1KYOD 3JALB 2XNXA 4C7RA 2VS0A 2HHHO 4WWIA 2JRIA 3W7TA 2ZM6B 3BRCA 5EFWB 1AA0A 4JAUA 4WBNA 3HB3B 1I08A 4W4LA 1T3UA 2P10A 4H13D 3E8BA 5JVDA 3L70J 1T6AA 5KKZB 4OX9B 4LFCO 1NZ6A 3U0ZA 2XV5A 2P7TC 2IBZG 2W90A 1DEEG 4YJ2B 3V2PA 4WFFA 5APTA 5AVYB 3B8NA 1V55B 5BY1A 2WPQA 2UWJE 1S5LH 3E1IA 1BGYH 3CXHF 3P32A 1VQ6P 1NH4A 4B3TB 1R3IC 2W6AA 2Q67A 2L35A 2XU6A 4W7ZA 2E74D 3HE4B 3H1LJ 5GONA 3X2QB 3NMDA 1L0ND 1DIPA 1K8AW 2RQ6A 2BCCJ 1JNMA 2D3OW 3NTNA 2XT9A 2AEJA 1FJPA 2KZJA 3KZIZ 4YJ3A 3AG7A 2QM4A 1NJIW 5IYZA 3K5NA 3UT5A 4LF8B 1P84D 4X66B 4IFMA 1J1DB 3FX7A 1JO5A 4LF7B 1K5QA 1URQB 3T1YO 4PJ0Z 1E1QG 3BEHA 4HYTB 2OYIB 1Y67A 1RE3A 1T8ZA 1J1EB 4TOIA 3AEDC 1PPJD 1KD1W 1NVPB 2IZ0A 5AW8B 1YI2V 4FM1A 3FXDA 3RL0g 3V2QA 1RFYA 3Q5PA 3FYEB 1GD2E 1SQQD 3AG4C 1E79H 1QEXA 5IJ0A 4KJMA 4YIOA 1GKFA 3B5NA 3HUSC 3CRMA 1FXKA 3CC4P 4JGSA 5KHKA 4J9YB 2Z0AA 1K4DC 2VQEB 2QG4A 3ZRVA 2WLNA 3OM3B 4X1IA 2JDIG 2CPBA 5LL6Y 3JD1A 1ZR4A 1UIIA 5E79Z 1WPXA 2A45I 3EQ2A 3ABMB 2YC0A 3FGAD 3HKBA 5EBLC 1NOHA 3ABKC 5AVZB 1X9VA 2EINB 1TUBA 3MP7B 5B1AC 1PZQA 4Q20A 4OXSA 4I0XB 5KA5A 5J2UA 1U57A 4OWFA 3CX5D 2I8DA 4TQFA 3E1RA 1WA8B 1AI4A 4UUJC 3JCUH 3E86A 1KB9F 1BE3D 1Q8IA 2WWWA 4PI2A 3K59A 5EYPB 2K9PA 3T2MA 2QSIA 4JI4O 2FMLA 5KTBA 3A2AA 3M7MX 1L4AA 2NPSD 1FJGO 4LF6B 1PKXA 5LOVA 4H44C 2W0XA 2Z4EA 4D7SA 2WLLA 1NTZG 2CPSA 3L72J 2EILC 1HR0O 4MVZA 4O4JB 1GN2A 4OVNF 3KYQA 5APYA 4Y28J 1VQ8P 2RN9A 4O9BA 3E89A 2EJRA 3FAVB 4CS2A 1N33B 2JGDA 4LNUA 2HLDG 2P4VA 2PY5A 3B77A 1B06A 2R9AA 2UUAB 3Q5RA 2IPPA 3OMAB 3MGNA 4OPAA 1IXBA 3VTPC 1D5NA 3HD7D 3ASOB 2CTWA 2QRXA 2XAHA 4XDJA 2P7JA 1B3QA 2ZNIA 2KSDA 4LGDE 2UXCO 1BDCA 2YXQB 4FFBB 2ZR2A 3H1JD 2XAFA 4K0KO 1VF5D 3PLNA 2Q3IA 3BHPA 1S0VA 3H1HG 2X0LA 3SWYA 4KP4A 3QNEA 3TYYA 4J80A 3AG3B 2CH7B 3L71E 1H88A 3S3XA 3SPJA 1NTMK 1SA0A 1IFPA 1Q3EA 1EXJA 5BXZA 3SYPA 1F51A 5KJ7C 2C2AA 4U3FH 5AVRB 2H94A 1XI1A 3ZCCA 1XHXA 1M1KW 2QE7G 4EI2A 1MABG 2ZVOB 1WJZA 3K9SA 4PV1B 5B1NA 1KILD 2Y4UA 4I50A 4P30A 3CXHI 2L91A 3CCUP 1RQVA 3VP8A 5L3BA 1KBHA 4FLTA 3JALA 1PV3A 2WTYA 3V6IA 1NTKD 5H5NA 5LMUO 3L4FA 3HPLC 3UCSC 1NU1J 4DO2A 3BRTB 2JGUA 5KMGB 1OIPA 1ROPA 1KMIZ 2KG7B 4PA7A 4IFDK 5J2TB 3V4QA 4AI8A 3LDDA 1F4MA 4QE7A 2F4VO 1N32O 1OCOB 1YIJP 1R73A 4K35A 4YJ2A 4X62B 4R4MA 4DR4B 4GOEA 1FS0E 2OTLP 3R66A 1AV1A 2ITAA 1BMFG 4MVSA 2A06D 3L75H 2Q9LA 4CH4A 1H8HG 1AROP 4R7CA 4F4LA 4L8JA 3HE4A 4JV5B 1KQGB 3M0DC 1HWYA 3ZMSA 3L70E 3L71H 4X65O 1VMGA 1E1RG 4I7ZC 2QA4P 3AG1B 3L73J 5KLVK 1QLEC 4DUYB 1GK6A 3KKYA 1S5HC 4GCZA 4GKKB 2DJVA 5B5EZ 3OAKA 2JEXA 3V4WA 1X4TA 3KG2A 3SJBC 5AW7B 1A02F 1AFOA 1QLNA 3CWBJ 1OHHG 3ZMZA 1URQA 2OYIA 1FOSF 4HZ3A 2DOSA 2ATKC 2JEEA 3H1LE 2YSUB 3U10A 2FYUG 1EC5A 2PTMA 5KX5B 1BCCD 4DR1O 5KHHA 3CXHE 4UB8Z 1A02J 1Q90D 2D2CC 5GTHH 1O9HA 1ZSPA 1N36O 4JF7A 3MHHC 5LP6B 2PF4E 1VF7A 1YXBA 4O4IB 4UVBA 1HW7A 1KU9A 2NRGA 1OV9A 3VBBA 1KB9I 1E5WA 4WFBV 4JI8O 1GN3A 4BIUA 4DR7O 2WLJA 3ZRSA 1KZUB 2EIKB 3AEIA 1FE6A 5IWAB 2UU9B 3CC4V 1LT9B 2A45G 3B8EB 3ZHVA 3L74E 5KUKA 1KECA 1CZQA 3AK1A 1TGOA 1Y6XA 1WMKA 4FM0A 4HAMA 5KLVH 1SQPE 4U7JA 1L0LD 1SVFA 1SQQK 3H32A 4BIZA 4RESB 4TT3H 2VRZA 1DEBA 3BVHA 5B1BB 4EFBA 1K9MQ 4WFGA 1CSBA 4NVPA 4Z2WA 3AE7C 4I0XA 3AE2C 3C90A 4JI6O 1AILA 1FXHA 2Y0EA 2ZXWB 1H0TB 3VQWA 3AE9C 1WA8A 1VQOP 1VIBA 4YIPA 1BHAA 5FPRA 1N73B 5JJNB 5JCOC 4RUEA 2ZCEA 3QO8A 4CC5A 3ABUA 4GODA 2V4HA 3T1HB 4NXNB 2FXMA 4DV1O 1MUUA 1K04A 4X1YB 1H2LA 2Q0AA 4O4JA 1HNZB 2GA1A 3VMAA 4H44D 4GT1A 2HR3A 2PI5A 3CXHH 1FDIA 4FLUA 1G8MA 2IBZD 3FAVA 4B7KA 2A3QA 4B3SB 4KHPO 3CCRP 4JTCB 1IDSA 1FS0G 1GO3F 2WA4A 3BPZA 3DSQA 2GUVA 1VQ8V 1SQVD 1Q2NA 3CC2V 2QJKB 4BR6A 2CK3G 3QTCA 1PPJH 1IVSA 4B08A 2P5OA 3RYCA 1Q7YQ 3GHGC 1H2SB 2OYOA 3JYCA 3ZMUA 1LTTC 1JUNA 3L74H 1G2CB 1KB9E 3QVNA 5B66Z 3FD9A 3FX0A 3L70G 5B1OA 3RK2D 4FFBA 3UIAA 3PP5A 1VQMP 1SQPH 4DV0O 2R32A 5L3DA 3EWKA 5APVA 5TISH 4NB5A 4U7OA 3P3PA 5D5QA 2M5AB 4GKJO 4LP8A 5CA0A 1NH2B 1N7SB 4AYCA 2YIUB 4YY3B 3BY6A 4XA4A 3RK3B 2CH7A 1GMGA 2HFEC 1FKAO 5CJ0A 1EN5A 5AW9B 1DF5A 5CCHC 4Z1MG 1QCEA 4MTGA 1WNSA 2R44A 1AQ5A 1EZVI 3BFRA 1HGZA 5KJ7D 1LWUB 4JASA 2BCCG 5EBWC 4JI5O 3H1KH 4L75A 1K9MW 1P49A 2YO2A 3TF5A 4FVMA 5LMNO 2RKLA 4YTPC 4TWKA 4ZI7B 5JH7B 1V54C 2IJJA 3OGCC 2YNYA 2WAMA 1BGYD 1EN6A 1H8AA 1GK4A 5KAFH 2H43A 4BW9A 1GM9A 3CCUV 1HNXB 2LXBA 2N9BA 1AJNA 5KMGA 2HVJC 2HHHB 2KG7A 4U3JB 5K1PA 5J2TA 1Y74B 3I55P 1BS3A 5FNVB 1R6KA 4EB6B 3Q4HB 4PHZA 2N9YB 1SKVA 4LFCB 4EOTA 3CB2A 1OVVA 4B3RO 3K5MA 5KHJA 2OYHB 1G6UA 2N05A 2B9ZA 1YIJV 2E74B 3B4SA 1SQGA 2OTLV 2LW7A 3N2GA 4PDLA 4XDKA 1NU1E 3WB1A 3SWFA 1RHZB 2R3CA 1Q81Q 1Q7YW 1S5LX 1OVUA 4L87A 5AVXB 2WSFJ 2N1TB 2NR5A 3TDKA 2XAGA 1F23A 1NTZJ 1BDDA 1MOFA 1R6TA 1NKZB 5GTIE 3H1JH 3KZIE 3B2EE 1K7DA 2F66C 1LGHB 1US6A 3U1AA 1U7MA 3N2KB 2QA4V 4MW3A 1FZCB 3D36C 5CHXA 3PHLA 4Y99B 1EZVE 3A0HE 4MTOA 3E7KA 2Z5UA 1P4RA 5AVSB 4AQRD 3LNMB 3M91A 2C9NY 4H13C 5KX5A 2ILMA 3CPWU 1SFCC 3T1YB 3FWLA 5CMZA 4RWUA 4FZ1A 3AG2B 1XTCC 3ETEA 5LP6A 3L72G 4XE5B 2D2CD 1YEWA 3R4YA 4O4IA 1OCCC 3ZRXA 1TU3F 1USDA 1GL2C 4LWSB 4RAIA 2K3RA 5K5GB 1AI6A 1GM8A 3ZJZA 2H7HA 3H1HJ 5B3SC 2N04A 4DV2O 1LT9A 3EHBB 5LXTB 1H38A 2E5LO 1URFA 2IDBA 4DXWA 5ITZB 3ZN1A 4L74A 5FPOA 3H1IJ 2WLIB 2R5BA 2YIDA 2O3JA 5LHIA 1FOSE 1QVFO 4WBAA 3A2FA 4N23A 3W7XA 1FZBA 1IBMO 1H0TA 3KZIH 1YQ4C 3D3QA 4TQDA 3ZIAG 4EKWA 3S1KA 1M57D 3UT5B 1N73A 5AVUB 5AVWB 4DUZO 4PJ0H 4JZGA 2NPSB 2YKQA 1AR5A 1Q81W 4J9ZB 1GW4A 2KQXA 1PGJA 2UXDO 2YI8A 2WPRA 4X1YA 3P30A 3IN6A 2WQYC 1N34O 3TK1A 1DD4A 4AUWA 2KNCB 3K79A 3R65A 5IJ0B 4YXWH 1XHZA 5IY5B 4JBZA 3TXQA 3H6PA 3ASNC 4MTXA 1HR0B 4FLVA 1WB8A 2MKVA 4DV5O 3MDSA 4P2ZA 1JMBA 2M8RA 1NR7A 4UCUA 1NKNA 1VQNP 2ZFCA 5IJ9B 3T1CA 1BQZA 4XFJA 3CCRV 1UPGA 2Y69C 2E76D 1BCCH 1JR9A 3SPCA 5E79H 3AE3C 1S77D 1G2CA 1XQ8A 4U3FD 2M7WA 1ZL8B 3VOPA 2M3BA 4CH3A 3D70A 2WSCH 3E8FA 4JYYA 1JM0A 2C0XA 2M5AA 1M56B 2UXCB 4R4LA 1B04A 1N7SA 3N7NA 3DXRB 4K0KB 1DX7A 2FYZA 4QNHB 3K5OA 1GK9A 1AJYA 2P06A 1SQVK 3MIWA 2FFDB 1JJOA 2W0FC 2FYUJ 2HFED 3T4ZA 3JAKB 4MVQA 1CEZA 3CL3D 1ZP0C 1L4AB 5CCHD 1LWUA 4DOJA 3OD4A 1W0KG 5BR8O 3L73G 3CD6P 2KZIA 3DTUB 3WUTA 1V9PA 1AVMA 1TVKB 1MSDA 3BRVB 3PTZA 3RBXA 1QR8A 3RN4A 5JH7A 1YJWP 3RFRA 5APUA 3KXDA 3CWBG 3L75D 2Q9IA 4NTXA 3K5BA 3EFFK 2CTRA 3MHSC 4BAYA 5BMVA 1N0NA 4U3JA 4LF9O 1N2DC 4O2AA 5LMUB 2AXTE 1HF9A 3L71D 4CBCA 5FNVA 2AXCA 4JTDB 2OIGA 4EB6A 3Q4HA 2VQFO 2Z5IA 2IBZH 3RVYA 1RF1A 4JAVA 1A32A 2K9YA 1DGSA 1IURA 2I1JA 3I55V 1ZW0A 1FXVA 4FFKA 1N32B 2F4VB 1YTZT 2OYHA 2AGAA 4ASWA 5EC2C 1NTMJ 2RMZA 1X59A 3QH9A 1H2GA 1YJ9V 4MS2A 1CPYA 4AQYB 3JD2A 2J58A 4DV6O 2NN4A 2K88A 1SA0B 2JK5C 2N1TA 3BCCJ 4QGPA 5DJUB 5B5EE 1RE4A 4RO0A 3OW2U 4QE9A 1SERA 4X65B 4AHCA 1NI8A 2O01N 3N2KA 3BAAA 4FMTA 2F95B 3EXAA 3K0DA 4ASVA 1FZCA 4ZKIA 4DR2O 4EDFA 4O2BB 1CXZB 2PFXA 3WB0A 5HFMA 2Q5ZA 4WY4D 1BSHA 2Q6AA 1KYOF 3E8HA 2ZIOA 4UB8E 5CBHA 1LTBC 1KV4A 2BOBC 1PFIA 1NTZE 3IC7A 2O01H 4DCKA 1SFCD 3AG4B 5KLVD 4I55B 3CCJV 1AVOA 1VQ9P 4JPRA 2YIBA 3CRAA 2RMKB 3HUSB 2WPSA 2GM4A 2C0WA 3CCQP 1EDJA 2HLOA 2JS3A 4LWSA 1RM1B 1ZRTE 1N36B 2JP3A 4WFHA 1GL2D 3NFQA 3WB2A 3WU2E 1YZBA 2DW3A 5KLIC 4NR1A 1HVVA 5LXTA 5L3FA 1AVYA 2FKXA 4JI8B 4I2LC 1R3KC 2QTSA 1LTJC 1T3JA 4PD4F 2JDIH 1COWG 1VF6A 4MT8A 2DWDC 5ITZA 5IYCO 1HWTC 1J95A 2WLIA 3H1LD 1N4CA 4IIJB 3ABKB 2AHZA 1LP1B 4JI3O 3D3IA 5B1AB 2ZDIC 3ZBHA 2QSAA 4C46A 5B5EH 2P22C 3CXHD 3JAMN 2XAJA 5GTIZ 5DJTB 4GZRB 2OCCC 4B3MO 3H1HE 4LH7A 3UM7A 1XMQO 1ORQC 4JI6B 1FFXB 2LR2A 2NPSA 3TCUA 2JIZG 1L0NJ 3VYIA 3RGBA 3A0HZ 3HTKA 1R8EA 2XNDG 3H1IE 3U1CA 4H44B 4UB8H 2V7QJ 1SS3A 2EILB 3L74D 2KNCA 1GN6A 1IFJA 2Q6QA 3A3YB 4DV1B 1MZ9A 1SQPD 2FXOA 2QJYC 1FZGA 1PGOA 4NTWA 1AP5A 4A5UB 3RVZA 1JMMA 4BRYB 3HD7A 5IJ9A 4ZHQB 1I94O 1VQKP 4KHPB 5A9GA 3QWOC 4RQFA 3D8CA 2CGNA 1SQQJ 2PI4A 2ZE5A 5L3EA 4OGQC 2GSMB 5B66E 3ICXA 1I0HA 2X6BA 3UO2A 4ZIBA 3GF7A 5L3CA 1VQNV 1ZL8A 3LW5J 2XUMA 1PP9J 3H32B 3TSIA 1OZHA 2C9LY 4MVMA 2UUBO 3RW0A 3H1KD 3QG5A 1U7JA 3CYOA 3ETDA 3ML0A 2FBWC 3DXRA 1V55C 4DV0B 2UXNA 2QM8A 1X0TA 1I5XA 1KN7A 3GF3A 1S9KE 2FFDA 1NAFA 2KUBA 3Q3DA 4GKJB 4JI1O 3JAKA 2VWJA 3K9AA 2W6IG 3B71A 2QWRB 1OMIA 1O9GA 5TJHA 2J59M 4KT0J 1X22A 1KILA 5AW3B 1TVKA 2QE7H 1M90Q 2R72A 5DN6G 2OGUA 2RN0A 1BE3J 2PGDA 2F23A 3CC2P 1K92A 4F6EA 4JI5B 4JYAO 2ZR3A 4UXNA 3CD6V 2HJFC 1WB7A 2PZSA 2LFSA 3CPWO 2FYUE 5LMNB 1FDMA 3V5BA 5JWPA 1S76D 2ADPA 1J1EC 1QHTA 1SQXJ 2E3CA 1YTFD 2WSEH 1YJWV 2XDJA 3RYCB 1KQLA 1E79G 3RK2C 2YO3A 5B66H 3A8TA 2B87B 5LYJA 1ZV8A 4JI2O 4LF4O 1FPOA 4NTYA 4EYYQ 2ZT9D 2PUSA 2E75D 2Q7GA 1K05A 1QVFU 2RJZA 4ZOLB 4JI0O 1XTGB 5CA0B 3SFEC 4WB4A 1SQBJ 3GLMA 1KYOI 3ZHUA 4B3RB 2KB1A 2LP7A 2W27A 2H89C 2QJPC 3ZMTA 4H0LD 1R3JC 1XDCA 2W8ZA 1QLEB 3H1IG 5AW2B 2N74A 5FL7G 3T4DA 5AW4B 1QVGU 2SPZA 2W83C 1OWAA 4O2BA 1HGVA 3RT3C 3ZX6A 1NAYA 3G9RA 1IK9A 1MFTA 1SZTA 4PD4I 3FWNA 2Q68A 3G71P 3BCCE 3OTOO 1R5LA 4I55A 2O57A 1NU1D 2K9JB 1IJDB 3CHXA 1Y9BA 3HUSA 2AXTZ 4HYOA 4GIFA 5AVQB 1NQTA 1NTKJ 2DQ3A 3RK3E 2AW9A 1VQ9V 1G4YB 2GTAA 2QJ1A 4JF3A 3CCQV 4NYKA 4JZ2A 3TNUA 3GB7C 4ICGA 2A45H 3N2GB 1EZVD 2P6JA 3ASOC 1RF0C 4ZKPA 3TGUJ 4DV2B 2AEMA 4IIJA 3M9QA 2IJKA 2E5LB 1LP1A 3IAOA 1KYOE 2V4DA 2QWQB 3H01A 1D5AA 1N86A 1GTWA 1JY3N 4IFFA 4OH8B 5AVVB 3HKEB 3ZN0A 2RCVA 2KLVA 4Q6GA 1FFXA 1IBMB 4BW5A 1JY2P 1GW3A 3AECC 4PDMA 1PNKA 2QKAA 3JD0A 4OPHA 1L2PA 3CRCA 4KL1A 3OUFA 2Y0PA 4DUZB 2BCCE 1ZAUA 1Q6UA 3B40A 4GYCB 3I56V 1AP6A 1QL2A 3ITKA 1ZUQA 3KDPB 2UXDB 4PD4E 3ZRWB 4PV1C 1G1JA 4FK5C 2EZOA 2ZM6O 1IZ3A 4BRYA 3CX5I 4DR5O 4Z1VA 3JD4A 1YITP 4ZHQA 1L0NE 2IM9A 1OW6A 3ZMVA 3WU2Z 1BSMA 3CCVP 4DV5B 2CK3H 3GHGB 2AZ0A 2FXPA 4OGQD 2PRRA 3Q5SA 3PH0A 1P7GA 1WPBA 1VQKV 3AEBC 3J7AU 3L70H 3VQYA 2GHYA 4U7NA 1SQPK 3I5CA 2YDEA 1Q82Q 3D6ZA 4UCOA 1M57C 1AB3A 4GOFA 2G3AA 2XKMA 1T5EA 2HP8A 3MAQA 1JA8A 1NTMG 1XOUA 4YHHO 2ZE7A 1NGMB 3OAAG 1S1CX 3R2PA 1YHQP 1L0LJ 2IH1C 2AZ2A 5KJ7A 1KFMA 3SYAA 3OW2O 2J5UA 3UKMA 3OMNB 3H1LH 3BCCG 1PP9E 4KFMA 1FAVA 5CJ4A 3U59A 2BCCH 4E4EA 3RYHB 4IHJB 3O6QA 2HEPA 5CBFA 4PD4H 1WRGA 2W6JG 3G4SP 3SDLA 5KAIE 3P3NA 1LR1A 2RNBA 4B7EA 5LHGA 2E76C 1URQD 1U96A 1IBLO 5BU5A 3VMYA 3IC9A 1DH3A 4X20B 4E2LA 2OCHA 2ZE6A 4X89A 1F7YA 1LUVA 2B87A 3L72E 3IGAC 1NVPD 1Y47A 3CX5E 5K1XA 3QO5A 2VQEO 1LT1A 1BE3E 3MUDC 4LF9B 4J7KA 4LR3A 5CCGC 1LTSC 5KUMA 4ZOLA 1SQVJ 3C8VA 2VQFB 4D6TJ 1YCIA 2XTAA 3C3SA 1JY2O 4XBFA 2K1EA 2UXBO 3LSQA 5EIBC 1SLQA 5LGTA 2JJ1G 3M0DA 2YXHA 1SQXE 3ZHSA 2QM7A 2EULA 2NLJC 4JQ0D 1MSWD 2K37A 3JARA 3LDEA 4TT3G 2OTJP 3N4XA 3AEEC 1XL4A 4DV6B 5IT9N 2Y48A 3S3WA 1IX9A 1WN7A 3HKDB 1L1FA 2FKWB 3RYFB 4DW0A 1JFFB 3AE6C 4GDOA 4ABMA 2H8PC 3F7YC 1SQBE 4FJCC 4DR2B 2L5GB 1HTLC 2I1KA 4P9OA 4H13B 1L0NG 4LFAO 1PL4A 3UO3A 1MMMA 2MJZA 4NXMO 1SFCB 1QBZA 2CE4A 5BMVB 3OR6C 2ZNJA 2K9JA 3O8ZA 3GWKC 4O2AB 1PNLA 2PAJA 2YXRB 4LH6A 3THOA 5DM6V 4M3LA 2V7QG 1N33O 2XAQA 1KB9H 3L72H 1OCCB 3F5TA 3G71V 3E8GA 2KXPB 1RF1B 2LGQA 2ZXEB 1YJ9P 1BGYJ 1U97A 1S3JA 4WF9V 3WG7C 1HJBA 1OVRA 2EIMC 5B3SB 1RP3B 3CP1A 3TETA 1PPJG 2HG5D 2QJKC 1M1JC 4IL6Z 1FZAA 1GH6A 2LGWA 1SQQG 4G2KA 3AE8C 3SPIA 4X1KA 1NU1K 1W2BO 2M3EA 1IFDA 4WFEA 1ZTEA 1PP9G 2QIWA 1NTZD 2WPVB 3EVKA 1K97A 2PYJA 4I9WA 1OXZA 3CSXA 4JI3B 4K8XA 3HKEA 4TV9B 4RO2A 1M5IA 1NBMG 4I4TB 2KLUA 2OQQA 5JCOA 4WY4C 5H2FE 1KFNA 4B3MB 1KKCA 2G38A 2Q69A 3K5LA 1ZRTD 3CCJP 1XMQB 3JATB 2CGOA 1FJKA 4TUYA 3F89A 1YYCA 3TGUE 4TV8B 1PIXA 2UXXA 2ZJSE 3FYIB 2ZYAA 3L73E 1CW5A 3F5HA 2BOCC 2DYRC 2Y0CA 3I5DA 1JOCA 2LW1A 2A06E 3ZRWA 3WUUA 3CCEP 1BE3G 4QMAA 2HVKC 4PV1D 2V1DA 1EM1A 1BL8A 2YI9A 3CWBE 5BZBA 4CZZA 3F5WC 4PDRA 4UCRA 3H1HD 4FLYA 4BWNA 2Y69B 3GHGA 1SQFA 1SF9A 1VL2A 2OARA 3CEIA 1KC8Q 4GX0A 1SQXG 2PP6A 1LNQA 1DF4A 1NU1H 3O9OA 1YITV 2R70A 3M99B 3P7KA 3FXEA 3CCVV 1CI6B 5EZYB 1JVMA 4DZOA 5GTIH 5JQGB 4J41A 3S9OA 1BT8A 2YIAA 3W7WA 1YVWA 5CBGA 4WFAV 1GU5A 2Q7EA 1EXIA 1Q5OA 3L36A 1S4XA 1IZNB 1SQBG 1KQFB 3A7OA 1M93A 4KXRA 5CCHA 4NPFX 4N21A 1EZVH 3A0HH 5BVZA 1R3LC 2HODB 3GVMA 2JWAA 2IU3A 3SYQA 3HTKB 2BSKB 3GWOA 5IYDO 1JEKA 4JI4B 4JI1B 5CB4B 1QVGO 4MSWC 3L73H 5C8YB 3RYHA 3ETQA 1YHQV 4IHJA 1FJGB 1M7LA 3ZDMA 1IXMA 1H89A 1HNWO 1K34A 5FLXN 3V2RA 3HD7B 4N78E 2CAZC 3CWBH 4JYAB 1RPRA 4X20A 3USSA 1OCRC 3G4SV 2IX7C 1S9KD 5E1AC 4P9PA 2KOGA 1FFTB 5AW0B 3VP9A
chains in the Genus database with same CATH topology
3B4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4S A; 
#chains in the Genus database with same CATH topology
 2NZ2 A;  3FKS G;  5H6R A;  1OJH A;  1KQS U;  4J7J A;  4ASU G;  1VF5 B;  2YMY A;  1MZE A;  4HJG H;  4DJG A;  4QPJ A;  5IWA O;  2UU9 O;  2QEX P;  5CCG D;  4TSF G;  4EEQ A;  2YXY A;  4JI2 B;  4LF4 B;  1NTK G;  3E22 B;  3RBZ A;  2QWP B;  4GKG A;  2Y9Z A;  4JI0 B;  3SYO A;  4K8Z A;  4IOI H;  5EIB D;  1KC8 W;  1SRY A;  4U3F J;  3RL0 C;  1VQ5 P;  4WCE V;  4ZNC A;  1T2K D;  3VN0 A;  2FYU D;  3TGU G;  2X6A A;  1QNM A;  2EIJ B;  2P67 A;  5LBQ A;  1Z5V A;  1KIL B;  3CMA P;  3HKD A;  3ABL B;  4UB6 E;  3RYF A;  2Q7H A;  1JFF A;  2A06 G;  2VRS A;  1ZLZ A;  2DW4 A;  3D36 A;  4D6T E;  2OTJ V;  3CCM V;  2DYS C;  1QL1 A;  3RYI B;  5L3G A;  2WVR A;  2H8P D;  1GAX A;  3IJ4 A;  4GX2 A;  1YBK A;  1EDI A;  3D6Y A;  4YXD C;  5KAI Z;  2P90 A;  1RE3 C;  1SFC A;  2ZAE B;  4UV8 A;  1MG1 A;  4DV3 O;  1XMO O;  2UUC O;  4X88 A;  4DW1 A;  2E5Y A;  3A0B Z;  2IJH A;  1H2M A;  1FAF A;  3VQV A;  1XUQ A;  5LYJ B;  2E75 C;  2ZT9 C;  1VQL P;  2WA3 A;  3ZS8 C;  1GL2 A;  1VQ7 V;  5IY5 C;  3B5N C;  2GV9 A;  2LXC B;  4CPG A;  1FXK C;  3L75 J;  3G3Z A;  4W80 A;  1IC2 A;  3KPE A;  1OCZ C;  1K3E A;  1S72 P;  2BTQ B;  2ADQ B;  5H9C A;  3ZHR A;  5IE9 A;  1BCC G;  3PRJ A;  3L71 J;  1JY3 O;  1AJQ A;  4H0L C;  5JJE B;  1HUC A;  3CCS P;  2FY8 A;  4PDV A;  3KCX A;  2WZ7 A;  1PL5 A;  4A7P A;  4IYH A;  2ZE8 A;  1Q86 Q;  1HH0 A;  2OCC B;  1NJI Q;  4IYI A;  2R9R B;  3STL C;  4TV9 A;  3G6E P;  4I4T A;  5APW A;  4UV9 A;  3ZHT A;  1PM9 A;  5CN0 A;  3JC2 2;  4KHX A;  4HKZ H;  3JAT A;  3CME P;  3CC7 P;  3L37 A;  4TV8 A;  1Q6I A;  3BVO A;  5BU8 B;  2F43 G;  2GTS A;  2ETN A;  2YEV B;  5CA3 A;  1L0L G;  1L4A C;  2LKM A;  2O1J A;  1WLE A;  2XND H;  2P58 A;  4DR6 O;  1RPO A;  3BA8 A;  2AXT H;  2FYN C;  2Q5U A;  4X64 O;  2IYO A;  3L70 D;  1NTZ K;  4DR1 B;  1GMJ A;  1XEQ A;  3J80 N;  2QJY B;  1HDJ A;  3ZED A;  2Y0I A;  3G6B A;  4IGG A;  1L8D A;  3LID A;  2QDO A;  3PN1 A;  5D5P A;  3SFD C;  2E43 A;  2FTK A;  3CCE V;  4DR7 B;  3TNU B;  4HBN A;  4OGQ B;  3CS5 A;  4DR5 B;  5KLV J;  3K0G A;  4RUF A;  4UCV A;  1THZ A;  2KS1 B;  1IFI A;  2ZVN B;  4X8A A;  2B88 A;  2Q1K A;  3T97 B;  1NR1 A;  2H88 C;  1CI6 A;  2Q73 A;  5EZY A;  2AHY A;  3NXS A;  2BCC D;  5JQG A;  1IK7 A;  1Q6H A;  4TLF A;  5DED A;  2ARH A;  2MW2 B;  5LA6 A;  1TA8 A;  1SQV G;  5APQ A;  2OTK E;  3P8C E;  4PD4 D;  3WUV A;  2FL4 A;  4D6T G;  5HFL A;  1IBK O;  1YTZ I;  3I56 P;  1P84 F;  1G1I A;  2HOD A;  4W7Y A;  2WSS G;  5H2F Z;  2BSK A;  4YHH B;  4HNA B;  1GRJ A;  5CB4 A;  5IDJ A;  2N1T D;  2WSF H;  1IFM A;  3M9B A;  5C8Y A;  2IH3 C;  3JAW B;  1NTZ H;  1Q86 W;  3OJA B;  1I7F A;  3JCU E;  3W68 A;  1M9N A;  3W7S A;  2BTO A;  4O4L B;  1I5Y A;  3IF4 A;  4NPE A;  1DK1 A;  3MTU E;  1BHB A;  3K06 A;  1Y66 A;  4PI0 A;  3DC5 A;  1OFC X;  4UVC A;  2GDS A;  2WIT A;  3WU2 H;  2IJI A;  4BIO A;  1MKM A;  1GM7 A;  3L74 J;  4LC1 A;  3RK2 B;  3N27 A;  2B9B A;  1LTA C;  1SQP J;  5KKZ C;  2QWN B;  1IBL B;  2MK3 A;  2OIE A;  2ZYG A;  3SPG A;  3SSU A;  2A0L A;  4RKU J;  2YIB D;  1W2B U;  2Q7C A;  1PP9 D;  2GUS A;  1RM1 C;  3E22 A;  2RH0 A;  1BGY G;  1W2E A;  2XZR A;  3KCY A;  4PEL A;  4FLW A;  2R3S A;  4C7N B;  1NWQ A;  1N8R Q;  2GBO A;  2CTQ A;  3CX5 F;  3H1H H;  1AR1 B;  1UIX A;  3BAS A;  2IZ1 A;  2QEX V;  2QJP B;  4FPP A;  3RL0 D;  3X2Q C;  2UXB B;  1VDF A;  4JPZ B;  3OTF A;  3MHV A;  1TUE B;  3H1K J;  1M1K Q;  3G80 A;  2BAS A;  1UFI A;  3AK3 A;  3H1I H;  2XHB A;  1HP8 A;  2HYN A;  1GZL A;  3Q2Y A;  1FU1 A;  3BAT A;  1VQ5 V;  4J11 A;  1Z2G A;  3IR9 A;  1S2E A;  3ZHQ A;  1KB9 D;  3L72 D;  3O6Q B;  2BEZ F;  4LF5 O;  2JWD A;  3RYI A;  3MD0 A;  3JSV C;  1PNM A;  3E83 A;  3CMA V;  4X9Q A;  1J1D C;  1URQ C;  2OYI C;  4U3F E;  2QWO B;  3OUS A;  4HH2 A;  3H25 A;  5EBM C;  3UQ8 A;  4G28 B;  4J10 A;  3OE7 G;  5C39 A;  4DK1 A;  2FYU K;  1IFN A;  1JCD A;  2HPC B;  4JI7 O;  4F6R B;  1SQX D;  4N6J A;  4LFA B;  4DV7 O;  1QQC A;  2ZIN A;  4NXM B;  2PYL A;  4ZMD A;  4R8C A;  3B5N D;  2EBO A;  1B6Q A;  3AE5 C;  2QVA A;  3BAB A;  1QR9 A;  2BTQ A;  1JTH B;  4IL6 E;  1VQL V;  3A0R A;  1LTJ A;  3HR0 A;  1KOR A;  1SQB D;  1MA1 A;  1NS1 A;  2LQT A;  2R9I A;  3GW6 A;  1DLB A;  4I7Z B;  2VWK A;  2G8Y A;  3H1J J;  1S72 V;  3JAR B;  3ABM C;  1JB0 J;  3M8A A;  2ZDI A;  5LGU A;  2P4K A;  3II6 A;  2WPD G;  2EIN C;  3SJA C;  4FM2 A;  1XIL A;  1NKD A;  1SP4 A;  3CCS V;  4IT5 A;  2IFM A;  3L75 E;  5F2V O;  1R6N A;  2OWO A;  3K58 A;  4UB6 Z;  1KP3 A;  4C7U A;  3U11 A;  1M56 D;  3GG2 A;  1NTM E;  2AEF A;  3M06 A;  4EIJ A;  1N8R W;  4DV4 O;  1WAZ A;  3AEG C;  3E2E A;  4MN4 C;  3JD3 A;  2YEV A;  3G6E V;  1SES A;  2FYU H;  1JOY A;  2OT5 A;  2LFR A;  1GN4 A;  3DC6 A;  5KHI A;  1XNQ O;  3QO7 A;  2D2C B;  1L4A D;  4CC6 A;  3CME V;  2JO1 A;  4GLX A;  3CC7 V;  4LFB O;  1M90 W;  3S4R A;  3SGI A;  3OGI B;  2E42 A;  1PD3 A;  2WMM A;  2YIC A;  4LBE C;  2HG5 C;  3TXS A;  1P84 I;  1OW8 A;  2DWE C;  2PGG A;  2CTP A;  1JQ0 A;  2YUA A;  4IL6 H;  2M0B A;  5GTH E;  2KS1 A;  4UVA A;  5LGN A;  1EFR G;  1JCH A;  1JJ2 U;  1KQS O;  1VEW A;  3CXC U;  3P8M C;  1YDX A;  3T97 A;  2KYV A;  3OEH G;  1MZF A;  2B89 A;  3TGU D;  4X1K B;  1N0J A;  1PL0 A;  2QKS A;  3L73 D;  2DQ0 A;  2JR8 A;  1M57 B;  1S5L Z;  3OT7 A;  3W67 A;  4AQY O;  3QF7 A;  3MZW B;  1FBM A;  4MW8 A;  4JTA B;  1PGQ A;  3LNN A;  1D2D A;  1AJP A;  3AG3 C;  4MVR A;  1NTM H;  1Z5W A;  5KLV E;  1VQP P;  5EC1 C;  4G27 B;  1N7L A;  3CWB D;  1F4N A;  3SPH A;  3OR7 C;  4TUY B;  3CJH B;  4U3F G;  1GTO A;  1VQ6 V;  4HNA A;  4DR3 O;  1J5E O;  4JYB A;  3JAW A;  3BCC H;  4WVZ A;  1KP2 A;  2Q3E A;  1XNR O;  3KQG A;  2K1A A;  4N3Y B;  4DRX B;  2KI7 B;  4O4L A;  1ZXG A;  3JCZ A;  4H37 A;  1ENV A;  1N34 B;  2E5T A;  1K73 Q;  2FB5 A;  4XDL A;  2W6J H;  4AIL C;  2WLH A;  5AVT B;  2E76 B;  1BCC J;  4OX9 O;  1HNW B;  1QX8 A;  2ZIM A;  2YMK A;  3ABT A;  1H2N A;  3IFX A;  2R5D A;  1L0N K;  2F1M A;  1X79 B;  2WSC J;  1J2J B;  1OCO C;  1P84 E;  4B3T O;  1SZX A;  4C7N A;  1DD3 A;  1KYO H;  3L75 G;  1FC2 C;  3CLQ A;  1PPJ E;  3HKC B;  2KK7 A;  3K3W A;  2B5U A;  4R50 A;  5EK0 A;  1SQQ E;  3SJQ C;  3L71 G;  1ZX3 A;  4N78 D;  4Z1M H;  2JJL A;  2WT7 B;  3AG1 C;  3B8M A;  5TIS E;  5AW6 B;  3APO A;  3F7V C;  4LF8 O;  1FYJ A;  2JVD A;  4DK0 A;  4X66 O;  1KUQ A;  1NVO A;  4LF7 O;  5BR8 B;  4QJF B;  1ZR2 A;  1G1X B;  3JCU Z;  5EYP A;  1V54 B;  5CBO A;  2ITC C;  2QKC A;  2M6Y A;  2KSJ A;  5CBN A;  3B09 A;  3C9I A;  3CCL P;  2Y9Y A;  1SS1 A;  3A0B E;  2ZD9 A;  1L0N H;  4UCT A;  1HBW A;  3APQ A;  1OX3 A;  3M0A A;  2DN9 A;  3H1K E;  2HPC A;  2IW5 A;  5CMU A;  4F6R A;  5L8R J;  4J42 A;  2F93 B;  2V7Q H;  5LP6 C;  4DV3 B;  1XMO B;  2UUC B;  2IFN A;  3M9H A;  1VPC A;  4LLH A;  1FZF A;  3JAS B;  3GMA A;  3WG7 B;  1P84 H;  3AE1 C;  5KAF E;  3A5T A;  3H9V A;  1K5S A;  2YS8 A;  2EIM B;  1K73 W;  2JKV A;  2BE3 A;  4H33 A;  1JTH A;  1M8O B;  4O4H B;  2GUZ B;  1EN4 A;  1EQ7 A;  2EIK C;  2ZYD A;  1M1J B;  1LT9 C;  4D6T D;  1RH5 B;  1RF0 A;  3SJC C;  1T2K C;  4I6M C;  1YJN P;  4CS3 A;  1NO4 A;  5KLV G;  3AE4 C;  1HJ0 A;  1SQQ H;  1JCC A;  2XOK G;  1SQX K;  3ABV C;  1VQ4 P;  3CCM P;  1DTO A;  5KHG A;  1XBL A;  5B1B C;  3LW5 H;  3SR2 C;  1PP9 H;  3NR7 A;  1MFZ A;  1Q82 W;  2EZP A;  3C1L A;  2ZXW C;  1ZLL A;  3TJT A;  3E35 A;  4WY4 B;  1EZJ A;  2BEQ D;  2DE0 X;  1N73 C;  4LF6 O;  1AQT A;  2YKO A;  4L73 A;  5KAI H;  1R5S A;  1SQB K;  3IFM A;  1LUW A;  1TAE A;  2O01 J;  3FB8 C;  1S5J A;  3H1L G;  3H1J E;  2ITD C;  1VQ7 P;  2Q4P A;  2H3O A;  1K33 A;  1ZN5 A;  2DYR B;  4FIP C;  3A0B H;  2CUG A;  4PA4 A;  2O1K A;  1USE A;  3SWK A;  1GDT A;  4UFZ A;  2UUA O;  3CX5 H;  1X8Y A;  3O65 A;  1GL2 B;  1PV0 A;  4DR6 B;  2CDY A;  1BE3 H;  2QGN A;  2WLM A;  3CRR A;  3FB5 C;  4X64 B;  3AK2 A;  1EDL A;  3K08 A;  3K57 A;  4FLZ A;  1WP8 A;  3VMX A;  4JYC A;  2Y4T A;  3L74 G;  2P2U A;  5KA6 A;  1M4U A;  1XRE A;  1FDO A;  1SQX H;  3LDC A;  1KIL E;  1W5C E;  1SQP G;  4KUM A;  4B86 A;  1NTK E;  1SET A;  1Y76 B;  5IYB O;  1LTI C;  5CA1 B;  3G67 A;  3PJS K;  5APS A;  3L9D A;  4GX5 A;  1N7S C;  4YPC A;  3CI9 A;  1NTK K;  2YIU C;  1EDK A;  3HE5 B;  1KTM A;  3RK3 C;  4W4K A;  1OW7 A;  1YQ3 C;  1SQB H;  5JJJ B;  2Z3Y A;  3CJH A;  1QGK B;  1RSO B;  4RJT A;  1PGP A;  1IBK B;  3EFG A;  2KSE A;  1OZ0 A;  1LWU C;  2ZXX A;  1MV8 A;  1VQP V;  3H1K G;  4I1L A;  5AW1 B;  1QLE D;  2IU0 A;  4DRX A;  1ZME C;  3ASN B;  3AEA C;  4EFE A;  3HRN A;  4PJ0 E;  1P7B A;  3VMZ A;  3FB7 C;  2YKP A;  4I5S A;  1LTG C;  5APX A;  1SC5 B;  3Q1M A;  1OCR B;  3P8C D;  4WBN B;  1W59 A;  2WLK A;  4HB1 A;  4QIW F;  1AR4 A;  4X62 O;  1I94 B;  1VAR A;  5JVD B;  1D7M A;  4DR4 O;  2ODM A;  3K03 A;  2L6L A;  5GTH Z;  4FLX A;  3MUD A;  2IYP A;  4NPD A;  1R1B A;  2B1G A;  1UJW B;  5CCG A;  3H1I D;  3CRQ A;  3J81 N;  1RF1 C;  2ZKO A;  1RQU A;  1IO4 A;  4RQE A;  3SYC A;  2IBZ I;  4LCU C;  4PA9 A;  4JV5 O;  1NTK H;  5LA6 B;  2UUB B;  2OYH C;  2OYQ A;  3HKC A;  2LO1 A;  1BCC E;  5E79 E;  2E74 C;  1NT2 B;  2X6C A;  3RL0 B;  4DUY O;  4GUN A;  5H2F H;  1JPX A;  4D7T A;  2NNU A;  1JY3 P;  1YSC A;  5GON B;  4GKK O;  3WMM 0;  2WT7 A;  2N1T C;  1Y4M A;  3TGU H;  1FD9 A;  3H1J G;  4FZ0 A;  1RE4 C;  1ZOY C;  3OA7 A;  2YXL A;  3LSU A;  1MNG A;  2KKW A;  5AG2 A;  4CS4 A;  2A06 H;  4YJ3 B;  1FZC C;  4I9Q A;  5IYZ B;  2DYS B;  5GW7 A;  4K3A A;  4Y99 C;  3LSS A;  1YI2 P;  3AEF C;  4LF5 B;  2WSE J;  1L0L E;  1YTF B;  1VQO V;  2QTO A;  1EBO A;  2HJD A;  3FFQ A;  2ZQM A;  1L0L K;  3CCL V;  3AG2 C;  3OMI B;  2ZT9 B;  2E75 B;  2X7R B;  1BSN A;  3B5N B;  1KKD A;  1W0J G;  3JAS A;  3IAY A;  1FXK B;  2Q0O C;  4JI7 B;  4DV7 B;  3ETG A;  1LJ2 A;  2Q8V A;  4GX1 A;  4BXL A;  4O4H A;  1OCZ B;  2GUZ A;  4ZKU A;  1M1J A;  4UCS A;  4X1I B;  1CP9 A;  4H0L B;  1K4C C;  2KIK A;  1JMK C;  1NU1 G;  2XAS A;  1VF6 C;  4QPK A;  4JAA A;  2IBZ E;  2A79 B;  3HKB B;  2P1J A;  1TUB B;  1YJN V;  4NKG B;  3RGU A;  3K04 A;  2QR4 A;  3FB6 C;  5TIS Z;  1SQV E;  5J2U B;  2KB7 P;  2Z5H A;  1Q43 A;  4WY4 A;  2EJ7 A;  1VQM V;  3CE2 A;  3T1H O;  1VQ4 V;  4NXN O;  5M1B A;  2Y0D A;  3V2N A;  1EZV G;  5C93 A;  2NPS C;  1HNZ O;  4DV4 B;  1QU7 A;  4ZBM A;  1L0L H;  4B3S O;  4BWA A;  5LOV B;  4R6Z A;  1AI7 A;  2WLL B;  2FYN B;  4YXW G;  1XL6 A;  5DEC A;  3OTO B;  4L76 A;  1JX9 A;  2A7W A;  1XNQ B;  2RDC A;  1Z56 A;  4ZI7 A;  4MTF A;  5A2Q N;  5J9P C;  4LFB B;  1BZK A;  3D71 A;  1NHL A;  2LJ2 A;  5KLI B;  2JGD B;  4LNU B;  3OEE G;  4CH6 A;  3HD7 C;  5KAF Z;  4MVO A;  2JJ2 G;  3JSL A;  1LTJ B;  1NTM D;  1H2K A;  5H6Q A;  3C3T A;  2JS5 A;  5LHH A;  1Y74 A;  1YF2 A;  1K8A Q;  3OFN G;  3RWR D;  1WT6 A;  3LUT B;  2HKO A;  1S5L E;  3BCC D;  3KHU A;  4YY3 O;  1VF5 C;  5AW5 B;  2W6B A;  4IL6 X;  1Y76 A;  1BGY E;  3DGE A;  1RY3 A;  5CA1 A;  1M56 C;  3VQX A;  4UB6 H;  2KP8 A;  1WP7 A;  4DT0 A;  1SQV H;  1NH2 D;  1Y8A A;  1N7S D;  3HE5 A;  4CH5 A;  1H8E G;  4D6T H;  4MVU A;  3BA9 A;  2FFD C;  3RK3 D;  1RSO A;  4DYL A;  2EX3 A;  3L35 A;  2DMX A;  4PA3 A;  2POH A;  2WSS H;  1KD1 Q;  4J7Z A;  3VOU A;  1FZE A;  2EIJ C;  1NYH A;  1BQ0 A;  2A9H A;  3JSN A;  1AI5 A;  3STZ C;  1JY2 N;  1GU4 A;  4PA6 A;  1KIL C;  3LIE A;  3ABL C;  3W7U A;  4DR3 B;  2B1I A;  1J5E B;  2JEU A;  1VP7 A;  3WFV A;  4I50 B;  1ZWI C;  1HNX O;  1XNR B;  1KYO D;  3JAL B;  2XNX A;  4C7R A;  2VS0 A;  2HHH O;  4WWI A;  2JRI A;  3W7T A;  2ZM6 B;  3BRC A;  5EFW B;  1AA0 A;  4JAU A;  4WBN A;  3HB3 B;  1I08 A;  4W4L A;  1T3U A;  2P10 A;  4H13 D;  3E8B A;  5JVD A;  3L70 J;  1T6A A;  5KKZ B;  4OX9 B;  4LFC O;  1NZ6 A;  3U0Z A;  2XV5 A;  2P7T C;  2IBZ G;  2W90 A;  1DEE G;  4YJ2 B;  3V2P A;  4WFF A;  5APT A;  5AVY B;  3B8N A;  1V55 B;  5BY1 A;  2WPQ A;  2UWJ E;  1S5L H;  3E1I A;  1BGY H;  3CXH F;  3P32 A;  1VQ6 P;  1NH4 A;  4B3T B;  1R3I C;  2W6A A;  2Q67 A;  2L35 A;  2XU6 A;  4W7Z A;  2E74 D;  3HE4 B;  3H1L J;  5GON A;  3X2Q B;  3NMD A;  1L0N D;  1DIP A;  1K8A W;  2RQ6 A;  2BCC J;  1JNM A;  2D3O W;  3NTN A;  2XT9 A;  2AEJ A;  1FJP A;  2KZJ A;  3KZI Z;  4YJ3 A;  3AG7 A;  2QM4 A;  1NJI W;  5IYZ A;  3K5N A;  3UT5 A;  4LF8 B;  1P84 D;  4X66 B;  4IFM A;  1J1D B;  3FX7 A;  1JO5 A;  4LF7 B;  1K5Q A;  1URQ B;  3T1Y O;  4PJ0 Z;  1E1Q G;  3BEH A;  4HYT B;  2OYI B;  1Y67 A;  1RE3 A;  1T8Z A;  1J1E B;  4TOI A;  3AED C;  1PPJ D;  1KD1 W;  1NVP B;  2IZ0 A;  5AW8 B;  1YI2 V;  4FM1 A;  3FXD A;  3RL0 g;  3V2Q A;  1RFY A;  3Q5P A;  3FYE B;  1GD2 E;  1SQQ D;  3AG4 C;  1E79 H;  1QEX A;  5IJ0 A;  4KJM A;  4YIO A;  1GKF A;  3B5N A;  3HUS C;  3CRM A;  1FXK A;  3CC4 P;  4JGS A;  5KHK A;  4J9Y B;  2Z0A A;  1K4D C;  2VQE B;  2QG4 A;  3ZRV A;  2WLN A;  3OM3 B;  4X1I A;  2JDI G;  2CPB A;  5LL6 Y;  3JD1 A;  1ZR4 A;  1UII A;  5E79 Z;  1WPX A;  2A45 I;  3EQ2 A;  3ABM B;  2YC0 A;  3FGA D;  3HKB A;  5EBL C;  1NOH A;  3ABK C;  5AVZ B;  1X9V A;  2EIN B;  1TUB A;  3MP7 B;  5B1A C;  1PZQ A;  4Q20 A;  4OXS A;  4I0X B;  5KA5 A;  5J2U A;  1U57 A;  4OWF A;  3CX5 D;  2I8D A;  4TQF A;  3E1R A;  1WA8 B;  1AI4 A;  4UUJ C;  3JCU H;  3E86 A;  1KB9 F;  1BE3 D;  1Q8I A;  2WWW A;  4PI2 A;  3K59 A;  5EYP B;  2K9P A;  3T2M A;  2QSI A;  4JI4 O;  2FML A;  5KTB A;  3A2A A;  3M7M X;  1L4A A;  2NPS D;  1FJG O;  4LF6 B;  1PKX A;  5LOV A;  4H44 C;  2W0X A;  2Z4E A;  4D7S A;  2WLL A;  1NTZ G;  2CPS A;  3L72 J;  2EIL C;  1HR0 O;  4MVZ A;  4O4J B;  1GN2 A;  4OVN F;  3KYQ A;  5APY A;  4Y28 J;  1VQ8 P;  2RN9 A;  4O9B A;  3E89 A;  2EJR A;  3FAV B;  4CS2 A;  1N33 B;  2JGD A;  4LNU A;  2HLD G;  2P4V A;  2PY5 A;  3B77 A;  1B06 A;  2R9A A;  2UUA B;  3Q5R A;  2IPP A;  3OMA B;  3MGN A;  4OPA A;  1IXB A;  3VTP C;  1D5N A;  3HD7 D;  3ASO B;  2CTW A;  2QRX A;  2XAH A;  4XDJ A;  2P7J A;  1B3Q A;  2ZNI A;  2KSD A;  4LGD E;  2UXC O;  1BDC A;  2YXQ B;  4FFB B;  2ZR2 A;  3H1J D;  2XAF A;  4K0K O;  1VF5 D;  3PLN A;  2Q3I A;  3BHP A;  1S0V A;  3H1H G;  2X0L A;  3SWY A;  4KP4 A;  3QNE A;  3TYY A;  4J80 A;  3AG3 B;  2CH7 B;  3L71 E;  1H88 A;  3S3X A;  3SPJ A;  1NTM K;  1SA0 A;  1IFP A;  1Q3E A;  1EXJ A;  5BXZ A;  3SYP A;  1F51 A;  5KJ7 C;  2C2A A;  4U3F H;  5AVR B;  2H94 A;  1XI1 A;  3ZCC A;  1XHX A;  1M1K W;  2QE7 G;  4EI2 A;  1MAB G;  2ZVO B;  1WJZ A;  3K9S A;  4PV1 B;  5B1N A;  1KIL D;  2Y4U A;  4I50 A;  4P30 A;  3CXH I;  2L91 A;  3CCU P;  1RQV A;  3VP8 A;  5L3B A;  1KBH A;  4FLT A;  3JAL A;  1PV3 A;  2WTY A;  3V6I A;  1NTK D;  5H5N A;  5LMU O;  3L4F A;  3HPL C;  3UCS C;  1NU1 J;  4DO2 A;  3BRT B;  2JGU A;  5KMG B;  1OIP A;  1ROP A;  1KMI Z;  2KG7 B;  4PA7 A;  4IFD K;  5J2T B;  3V4Q A;  4AI8 A;  3LDD A;  1F4M A;  4QE7 A;  2F4V O;  1N32 O;  1OCO B;  1YIJ P;  1R73 A;  4K35 A;  4YJ2 A;  4X62 B;  4R4M A;  4DR4 B;  4GOE A;  1FS0 E;  2OTL P;  3R66 A;  1AV1 A;  2ITA A;  1BMF G;  4MVS A;  2A06 D;  3L75 H;  2Q9L A;  4CH4 A;  1H8H G;  1ARO P;  4R7C A;  4F4L A;  4L8J A;  3HE4 A;  4JV5 B;  1KQG B;  3M0D C;  1HWY A;  3ZMS A;  3L70 E;  3L71 H;  4X65 O;  1VMG A;  1E1R G;  4I7Z C;  2QA4 P;  3AG1 B;  3L73 J;  5KLV K;  1QLE C;  4DUY B;  1GK6 A;  3KKY A;  1S5H C;  4GCZ A;  4GKK B;  2DJV A;  5B5E Z;  3OAK A;  2JEX A;  3V4W A;  1X4T A;  3KG2 A;  3SJB C;  5AW7 B;  1A02 F;  1AFO A;  1QLN A;  3CWB J;  1OHH G;  3ZMZ A;  1URQ A;  2OYI A;  1FOS F;  4HZ3 A;  2DOS A;  2ATK C;  2JEE A;  3H1L E;  2YSU B;  3U10 A;  2FYU G;  1EC5 A;  2PTM A;  5KX5 B;  1BCC D;  4DR1 O;  5KHH A;  3CXH E;  4UB8 Z;  1A02 J;  1Q90 D;  2D2C C;  5GTH H;  1O9H A;  1ZSP A;  1N36 O;  4JF7 A;  3MHH C;  5LP6 B;  2PF4 E;  1VF7 A;  1YXB A;  4O4I B;  4UVB A;  1HW7 A;  1KU9 A;  2NRG A;  1OV9 A;  3VBB A;  1KB9 I;  1E5W A;  4WFB V;  4JI8 O;  1GN3 A;  4BIU A;  4DR7 O;  2WLJ A;  3ZRS A;  1KZU B;  2EIK B;  3AEI A;  1FE6 A;  5IWA B;  2UU9 B;  3CC4 V;  1LT9 B;  2A45 G;  3B8E B;  3ZHV A;  3L74 E;  5KUK A;  1KEC A;  1CZQ A;  3AK1 A;  1TGO A;  1Y6X A;  1WMK A;  4FM0 A;  4HAM A;  5KLV H;  1SQP E;  4U7J A;  1L0L D;  1SVF A;  1SQQ K;  3H32 A;  4BIZ A;  4RES B;  4TT3 H;  2VRZ A;  1DEB A;  3BVH A;  5B1B B;  4EFB A;  1K9M Q;  4WFG A;  1CSB A;  4NVP A;  4Z2W A;  3AE7 C;  4I0X A;  3AE2 C;  3C90 A;  4JI6 O;  1AIL A;  1FXH A;  2Y0E A;  2ZXW B;  1H0T B;  3VQW A;  3AE9 C;  1WA8 A;  1VQO P;  1VIB A;  4YIP A;  1BHA A;  5FPR A;  1N73 B;  5JJN B;  5JCO C;  4RUE A;  2ZCE A;  3QO8 A;  4CC5 A;  3ABU A;  4GOD A;  2V4H A;  3T1H B;  4NXN B;  2FXM A;  4DV1 O;  1MUU A;  1K04 A;  4X1Y B;  1H2L A;  2Q0A A;  4O4J A;  1HNZ B;  2GA1 A;  3VMA A;  4H44 D;  4GT1 A;  2HR3 A;  2PI5 A;  3CXH H;  1FDI A;  4FLU A;  1G8M A;  2IBZ D;  3FAV A;  4B7K A;  2A3Q A;  4B3S B;  4KHP O;  3CCR P;  4JTC B;  1IDS A;  1FS0 G;  1GO3 F;  2WA4 A;  3BPZ A;  3DSQ A;  2GUV A;  1VQ8 V;  1SQV D;  1Q2N A;  3CC2 V;  2QJK B;  4BR6 A;  2CK3 G;  3QTC A;  1PPJ H;  1IVS A;  4B08 A;  2P5O A;  3RYC A;  1Q7Y Q;  3GHG C;  1H2S B;  2OYO A;  3JYC A;  3ZMU A;  1LTT C;  1JUN A;  3L74 H;  1G2C B;  1KB9 E;  3QVN A;  5B66 Z;  3FD9 A;  3FX0 A;  3L70 G;  5B1O A;  3RK2 D;  4FFB A;  3UIA A;  3PP5 A;  1VQM P;  1SQP H;  4DV0 O;  2R32 A;  5L3D A;  3EWK A;  5APV A;  5TIS H;  4NB5 A;  4U7O A;  3P3P A;  5D5Q A;  2M5A B;  4GKJ O;  4LP8 A;  5CA0 A;  1NH2 B;  1N7S B;  4AYC A;  2YIU B;  4YY3 B;  3BY6 A;  4XA4 A;  3RK3 B;  2CH7 A;  1GMG A;  2HFE C;  1FKA O;  5CJ0 A;  1EN5 A;  5AW9 B;  1DF5 A;  5CCH C;  4Z1M G;  1QCE A;  4MTG A;  1WNS A;  2R44 A;  1AQ5 A;  1EZV I;  3BFR A;  1HGZ A;  5KJ7 D;  1LWU B;  4JAS A;  2BCC G;  5EBW C;  4JI5 O;  3H1K H;  4L75 A;  1K9M W;  1P49 A;  2YO2 A;  3TF5 A;  4FVM A;  5LMN O;  2RKL A;  4YTP C;  4TWK A;  4ZI7 B;  5JH7 B;  1V54 C;  2IJJ A;  3OGC C;  2YNY A;  2WAM A;  1BGY D;  1EN6 A;  1H8A A;  1GK4 A;  5KAF H;  2H43 A;  4BW9 A;  1GM9 A;  3CCU V;  1HNX B;  2LXB A;  2N9B A;  1AJN A;  5KMG A;  2HVJ C;  2HHH B;  2KG7 A;  4U3J B;  5K1P A;  5J2T A;  1Y74 B;  3I55 P;  1BS3 A;  5FNV B;  1R6K A;  4EB6 B;  3Q4H B;  4PHZ A;  2N9Y B;  1SKV A;  4LFC B;  4EOT A;  3CB2 A;  1OVV A;  4B3R O;  3K5M A;  5KHJ A;  2OYH B;  1G6U A;  2N05 A;  2B9Z A;  1YIJ V;  2E74 B;  3B4S A;  1SQG A;  2OTL V;  2LW7 A;  3N2G A;  4PDL A;  4XDK A;  1NU1 E;  3WB1 A;  3SWF A;  1RHZ B;  2R3C A;  1Q81 Q;  1Q7Y W;  1S5L X;  1OVU A;  4L87 A;  5AVX B;  2WSF J;  2N1T B;  2NR5 A;  3TDK A;  2XAG A;  1F23 A;  1NTZ J;  1BDD A;  1MOF A;  1R6T A;  1NKZ B;  5GTI E;  3H1J H;  3KZI E;  3B2E E;  1K7D A;  2F66 C;  1LGH B;  1US6 A;  3U1A A;  1U7M A;  3N2K B;  2QA4 V;  4MW3 A;  1FZC B;  3D36 C;  5CHX A;  3PHL A;  4Y99 B;  1EZV E;  3A0H E;  4MTO A;  3E7K A;  2Z5U A;  1P4R A;  5AVS B;  4AQR D;  3LNM B;  3M91 A;  2C9N Y;  4H13 C;  5KX5 A;  2ILM A;  3CPW U;  1SFC C;  3T1Y B;  3FWL A;  5CMZ A;  4RWU A;  4FZ1 A;  3AG2 B;  1XTC C;  3ETE A;  5LP6 A;  3L72 G;  4XE5 B;  2D2C D;  1YEW A;  3R4Y A;  4O4I A;  1OCC C;  3ZRX A;  1TU3 F;  1USD A;  1GL2 C;  4LWS B;  4RAI A;  2K3R A;  5K5G B;  1AI6 A;  1GM8 A;  3ZJZ A;  2H7H A;  3H1H J;  5B3S C;  2N04 A;  4DV2 O;  1LT9 A;  3EHB B;  5LXT B;  1H38 A;  2E5L O;  1URF A;  2IDB A;  4DXW A;  5ITZ B;  3ZN1 A;  4L74 A;  5FPO A;  3H1I J;  2WLI B;  2R5B A;  2YID A;  2O3J A;  5LHI A;  1FOS E;  1QVF O;  4WBA A;  3A2F A;  4N23 A;  3W7X A;  1FZB A;  1IBM O;  1H0T A;  3KZI H;  1YQ4 C;  3D3Q A;  4TQD A;  3ZIA G;  4EKW A;  3S1K A;  1M57 D;  3UT5 B;  1N73 A;  5AVU B;  5AVW B;  4DUZ O;  4PJ0 H;  4JZG A;  2NPS B;  2YKQ A;  1AR5 A;  1Q81 W;  4J9Z B;  1GW4 A;  2KQX A;  1PGJ A;  2UXD O;  2YI8 A;  2WPR A;  4X1Y A;  3P30 A;  3IN6 A;  2WQY C;  1N34 O;  3TK1 A;  1DD4 A;  4AUW A;  2KNC B;  3K79 A;  3R65 A;  5IJ0 B;  4YXW H;  1XHZ A;  5IY5 B;  4JBZ A;  3TXQ A;  3H6P A;  3ASN C;  4MTX A;  1HR0 B;  4FLV A;  1WB8 A;  2MKV A;  4DV5 O;  3MDS A;  4P2Z A;  1JMB A;  2M8R A;  1NR7 A;  4UCU A;  1NKN A;  1VQN P;  2ZFC A;  5IJ9 B;  3T1C A;  1BQZ A;  4XFJ A;  3CCR V;  1UPG A;  2Y69 C;  2E76 D;  1BCC H;  1JR9 A;  3SPC A;  5E79 H;  3AE3 C;  1S77 D;  1G2C A;  1XQ8 A;  4U3F D;  2M7W A;  1ZL8 B;  3VOP A;  2M3B A;  4CH3 A;  3D70 A;  2WSC H;  3E8F A;  4JYY A;  1JM0 A;  2C0X A;  2M5A A;  1M56 B;  2UXC B;  4R4L A;  1B04 A;  1N7S A;  3N7N A;  3DXR B;  4K0K B;  1DX7 A;  2FYZ A;  4QNH B;  3K5O A;  1GK9 A;  1AJY A;  2P06 A;  1SQV K;  3MIW A;  2FFD B;  1JJO A;  2W0F C;  2FYU J;  2HFE D;  3T4Z A;  3JAK B;  4MVQ A;  1CEZ A;  3CL3 D;  1ZP0 C;  1L4A B;  5CCH D;  1LWU A;  4DOJ A;  3OD4 A;  1W0K G;  5BR8 O;  3L73 G;  3CD6 P;  2KZI A;  3DTU B;  3WUT A;  1V9P A;  1AVM A;  1TVK B;  1MSD A;  3BRV B;  3PTZ A;  3RBX A;  1QR8 A;  3RN4 A;  5JH7 A;  1YJW P;  3RFR A;  5APU A;  3KXD A;  3CWB G;  3L75 D;  2Q9I A;  4NTX A;  3K5B A;  3EFF K;  2CTR A;  3MHS C;  4BAY A;  5BMV A;  1N0N A;  4U3J A;  4LF9 O;  1N2D C;  4O2A A;  5LMU B;  2AXT E;  1HF9 A;  3L71 D;  4CBC A;  5FNV A;  2AXC A;  4JTD B;  2OIG A;  4EB6 A;  3Q4H A;  2VQF O;  2Z5I A;  2IBZ H;  3RVY A;  1RF1 A;  4JAV A;  1A32 A;  2K9Y A;  1DGS A;  1IUR A;  2I1J A;  3I55 V;  1ZW0 A;  1FXV A;  4FFK A;  1N32 B;  2F4V B;  1YTZ T;  2OYH A;  2AGA A;  4ASW A;  5EC2 C;  1NTM J;  2RMZ A;  1X59 A;  3QH9 A;  1H2G A;  1YJ9 V;  4MS2 A;  1CPY A;  4AQY B;  3JD2 A;  2J58 A;  4DV6 O;  2NN4 A;  2K88 A;  1SA0 B;  2JK5 C;  2N1T A;  3BCC J;  4QGP A;  5DJU B;  5B5E E;  1RE4 A;  4RO0 A;  3OW2 U;  4QE9 A;  1SER A;  4X65 B;  4AHC A;  1NI8 A;  2O01 N;  3N2K A;  3BAA A;  4FMT A;  2F95 B;  3EXA A;  3K0D A;  4ASV A;  1FZC A;  4ZKI A;  4DR2 O;  4EDF A;  4O2B B;  1CXZ B;  2PFX A;  3WB0 A;  5HFM A;  2Q5Z A;  4WY4 D;  1BSH A;  2Q6A A;  1KYO F;  3E8H A;  2ZIO A;  4UB8 E;  5CBH A;  1LTB C;  1KV4 A;  2BOB C;  1PFI A;  1NTZ E;  3IC7 A;  2O01 H;  4DCK A;  1SFC D;  3AG4 B;  5KLV D;  4I55 B;  3CCJ V;  1AVO A;  1VQ9 P;  4JPR A;  2YIB A;  3CRA A;  2RMK B;  3HUS B;  2WPS A;  2GM4 A;  2C0W A;  3CCQ P;  1EDJ A;  2HLO A;  2JS3 A;  4LWS A;  1RM1 B;  1ZRT E;  1N36 B;  2JP3 A;  4WFH A;  1GL2 D;  3NFQ A;  3WB2 A;  3WU2 E;  1YZB A;  2DW3 A;  5KLI C;  4NR1 A;  1HVV A;  5LXT A;  5L3F A;  1AVY A;  2FKX A;  4JI8 B;  4I2L C;  1R3K C;  2QTS A;  1LTJ C;  1T3J A;  4PD4 F;  2JDI H;  1COW G;  1VF6 A;  4MT8 A;  2DWD C;  5ITZ A;  5IYC O;  1HWT C;  1J95 A;  2WLI A;  3H1L D;  1N4C A;  4IIJ B;  3ABK B;  2AHZ A;  1LP1 B;  4JI3 O;  3D3I A;  5B1A B;  2ZDI C;  3ZBH A;  2QSA A;  4C46 A;  5B5E H;  2P22 C;  3CXH D;  3JAM N;  2XAJ A;  5GTI Z;  5DJT B;  4GZR B;  2OCC C;  4B3M O;  3H1H E;  4LH7 A;  3UM7 A;  1XMQ O;  1ORQ C;  4JI6 B;  1FFX B;  2LR2 A;  2NPS A;  3TCU A;  2JIZ G;  1L0N J;  3VYI A;  3RGB A;  3A0H Z;  3HTK A;  1R8E A;  2XND G;  3H1I E;  3U1C A;  4H44 B;  4UB8 H;  2V7Q J;  1SS3 A;  2EIL B;  3L74 D;  2KNC A;  1GN6 A;  1IFJ A;  2Q6Q A;  3A3Y B;  4DV1 B;  1MZ9 A;  1SQP D;  2FXO A;  2QJY C;  1FZG A;  1PGO A;  4NTW A;  1AP5 A;  4A5U B;  3RVZ A;  1JMM A;  4BRY B;  3HD7 A;  5IJ9 A;  4ZHQ B;  1I94 O;  1VQK P;  4KHP B;  5A9G A;  3QWO C;  4RQF A;  3D8C A;  2CGN A;  1SQQ J;  2PI4 A;  2ZE5 A;  5L3E A;  4OGQ C;  2GSM B;  5B66 E;  3ICX A;  1I0H A;  2X6B A;  3UO2 A;  4ZIB A;  3GF7 A;  5L3C A;  1VQN V;  1ZL8 A;  3LW5 J;  2XUM A;  1PP9 J;  3H32 B;  3TSI A;  1OZH A;  2C9L Y;  4MVM A;  2UUB O;  3RW0 A;  3H1K D;  3QG5 A;  1U7J A;  3CYO A;  3ETD A;  3ML0 A;  2FBW C;  3DXR A;  1V55 C;  4DV0 B;  2UXN A;  2QM8 A;  1X0T A;  1I5X A;  1KN7 A;  3GF3 A;  1S9K E;  2FFD A;  1NAF A;  2KUB A;  3Q3D A;  4GKJ B;  4JI1 O;  3JAK A;  2VWJ A;  3K9A A;  2W6I G;  3B71 A;  2QWR B;  1OMI A;  1O9G A;  5TJH A;  2J59 M;  4KT0 J;  1X22 A;  1KIL A;  5AW3 B;  1TVK A;  2QE7 H;  1M90 Q;  2R72 A;  5DN6 G;  2OGU A;  2RN0 A;  1BE3 J;  2PGD A;  2F23 A;  3CC2 P;  1K92 A;  4F6E A;  4JI5 B;  4JYA O;  2ZR3 A;  4UXN A;  3CD6 V;  2HJF C;  1WB7 A;  2PZS A;  2LFS A;  3CPW O;  2FYU E;  5LMN B;  1FDM A;  3V5B A;  5JWP A;  1S76 D;  2ADP A;  1J1E C;  1QHT A;  1SQX J;  2E3C A;  1YTF D;  2WSE H;  1YJW V;  2XDJ A;  3RYC B;  1KQL A;  1E79 G;  3RK2 C;  2YO3 A;  5B66 H;  3A8T A;  2B87 B;  5LYJ A;  1ZV8 A;  4JI2 O;  4LF4 O;  1FPO A;  4NTY A;  4EYY Q;  2ZT9 D;  2PUS A;  2E75 D;  2Q7G A;  1K05 A;  1QVF U;  2RJZ A;  4ZOL B;  4JI0 O;  1XTG B;  5CA0 B;  3SFE C;  4WB4 A;  1SQB J;  3GLM A;  1KYO I;  3ZHU A;  4B3R B;  2KB1 A;  2LP7 A;  2W27 A;  2H89 C;  2QJP C;  3ZMT A;  4H0L D;  1R3J C;  1XDC A;  2W8Z A;  1QLE B;  3H1I G;  5AW2 B;  2N74 A;  5FL7 G;  3T4D A;  5AW4 B;  1QVG U;  2SPZ A;  2W83 C;  1OWA A;  4O2B A;  1HGV A;  3RT3 C;  3ZX6 A;  1NAY A;  3G9R A;  1IK9 A;  1MFT A;  1SZT A;  4PD4 I;  3FWN A;  2Q68 A;  3G71 P;  3BCC E;  3OTO O;  1R5L A;  4I55 A;  2O57 A;  1NU1 D;  2K9J B;  1IJD B;  3CHX A;  1Y9B A;  3HUS A;  2AXT Z;  4HYO A;  4GIF A;  5AVQ B;  1NQT A;  1NTK J;  2DQ3 A;  3RK3 E;  2AW9 A;  1VQ9 V;  1G4Y B;  2GTA A;  2QJ1 A;  4JF3 A;  3CCQ V;  4NYK A;  4JZ2 A;  3TNU A;  3GB7 C;  4ICG A;  2A45 H;  3N2G B;  1EZV D;  2P6J A;  3ASO C;  1RF0 C;  4ZKP A;  3TGU J;  4DV2 B;  2AEM A;  4IIJ A;  3M9Q A;  2IJK A;  2E5L B;  1LP1 A;  3IAO A;  1KYO E;  2V4D A;  2QWQ B;  3H01 A;  1D5A A;  1N86 A;  1GTW A;  1JY3 N;  4IFF A;  4OH8 B;  5AVV B;  3HKE B;  3ZN0 A;  2RCV A;  2KLV A;  4Q6G A;  1FFX A;  1IBM B;  4BW5 A;  1JY2 P;  1GW3 A;  3AEC C;  4PDM A;  1PNK A;  2QKA A;  3JD0 A;  4OPH A;  1L2P A;  3CRC A;  4KL1 A;  3OUF A;  2Y0P A;  4DUZ B;  2BCC E;  1ZAU A;  1Q6U A;  3B40 A;  4GYC B;  3I56 V;  1AP6 A;  1QL2 A;  3ITK A;  1ZUQ A;  3KDP B;  2UXD B;  4PD4 E;  3ZRW B;  4PV1 C;  1G1J A;  4FK5 C;  2EZO A;  2ZM6 O;  1IZ3 A;  4BRY A;  3CX5 I;  4DR5 O;  4Z1V A;  3JD4 A;  1YIT P;  4ZHQ A;  1L0N E;  2IM9 A;  1OW6 A;  3ZMV A;  3WU2 Z;  1BSM A;  3CCV P;  4DV5 B;  2CK3 H;  3GHG B;  2AZ0 A;  2FXP A;  4OGQ D;  2PRR A;  3Q5S A;  3PH0 A;  1P7G A;  1WPB A;  1VQK V;  3AEB C;  3J7A U;  3L70 H;  3VQY A;  2GHY A;  4U7N A;  1SQP K;  3I5C A;  2YDE A;  1Q82 Q;  3D6Z A;  4UCO A;  1M57 C;  1AB3 A;  4GOF A;  2G3A A;  2XKM A;  1T5E A;  2HP8 A;  3MAQ A;  1JA8 A;  1NTM G;  1XOU A;  4YHH O;  2ZE7 A;  1NGM B;  3OAA G;  1S1C X;  3R2P A;  1YHQ P;  1L0L J;  2IH1 C;  2AZ2 A;  5KJ7 A;  1KFM A;  3SYA A;  3OW2 O;  2J5U A;  3UKM A;  3OMN B;  3H1L H;  3BCC G;  1PP9 E;  4KFM A;  1FAV A;  5CJ4 A;  3U59 A;  2BCC H;  4E4E A;  3RYH B;  4IHJ B;  3O6Q A;  2HEP A;  5CBF A;  4PD4 H;  1WRG A;  2W6J G;  3G4S P;  3SDL A;  5KAI E;  3P3N A;  1LR1 A;  2RNB A;  4B7E A;  5LHG A;  2E76 C;  1URQ D;  1U96 A;  1IBL O;  5BU5 A;  3VMY A;  3IC9 A;  1DH3 A;  4X20 B;  4E2L A;  2OCH A;  2ZE6 A;  4X89 A;  1F7Y A;  1LUV A;  2B87 A;  3L72 E;  3IGA C;  1NVP D;  1Y47 A;  3CX5 E;  5K1X A;  3QO5 A;  2VQE O;  1LT1 A;  1BE3 E;  3MUD C;  4LF9 B;  4J7K A;  4LR3 A;  5CCG C;  1LTS C;  5KUM A;  4ZOL A;  1SQV J;  3C8V A;  2VQF B;  4D6T J;  1YCI A;  2XTA A;  3C3S A;  1JY2 O;  4XBF A;  2K1E A;  2UXB O;  3LSQ A;  5EIB C;  1SLQ A;  5LGT A;  2JJ1 G;  3M0D A;  2YXH A;  1SQX E;  3ZHS A;  2QM7 A;  2EUL A;  2NLJ C;  4JQ0 D;  1MSW D;  2K37 A;  3JAR A;  3LDE A;  4TT3 G;  2OTJ P;  3N4X A;  3AEE C;  1XL4 A;  4DV6 B;  5IT9 N;  2Y48 A;  3S3W A;  1IX9 A;  1WN7 A;  3HKD B;  1L1F A;  2FKW B;  3RYF B;  4DW0 A;  1JFF B;  3AE6 C;  4GDO A;  4ABM A;  2H8P C;  3F7Y C;  1SQB E;  4FJC C;  4DR2 B;  2L5G B;  1HTL C;  2I1K A;  4P9O A;  4H13 B;  1L0N G;  4LFA O;  1PL4 A;  3UO3 A;  1MMM A;  2MJZ A;  4NXM O;  1SFC B;  1QBZ A;  2CE4 A;  5BMV B;  3OR6 C;  2ZNJ A;  2K9J A;  3O8Z A;  3GWK C;  4O2A B;  1PNL A;  2PAJ A;  2YXR B;  4LH6 A;  3THO A;  5DM6 V;  4M3L A;  2V7Q G;  1N33 O;  2XAQ A;  1KB9 H;  3L72 H;  1OCC B;  3F5T A;  3G71 V;  3E8G A;  2KXP B;  1RF1 B;  2LGQ A;  2ZXE B;  1YJ9 P;  1BGY J;  1U97 A;  1S3J A;  4WF9 V;  3WG7 C;  1HJB A;  1OVR A;  2EIM C;  5B3S B;  1RP3 B;  3CP1 A;  3TET A;  1PPJ G;  2HG5 D;  2QJK C;  1M1J C;  4IL6 Z;  1FZA A;  1GH6 A;  2LGW A;  1SQQ G;  4G2K A;  3AE8 C;  3SPI A;  4X1K A;  1NU1 K;  1W2B O;  2M3E A;  1IFD A;  4WFE A;  1ZTE A;  1PP9 G;  2QIW A;  1NTZ D;  2WPV B;  3EVK A;  1K97 A;  2PYJ A;  4I9W A;  1OXZ A;  3CSX A;  4JI3 B;  4K8X A;  3HKE A;  4TV9 B;  4RO2 A;  1M5I A;  1NBM G;  4I4T B;  2KLU A;  2OQQ A;  5JCO A;  4WY4 C;  5H2F E;  1KFN A;  4B3M B;  1KKC A;  2G38 A;  2Q69 A;  3K5L A;  1ZRT D;  3CCJ P;  1XMQ B;  3JAT B;  2CGO A;  1FJK A;  4TUY A;  3F89 A;  1YYC A;  3TGU E;  4TV8 B;  1PIX A;  2UXX A;  2ZJS E;  3FYI B;  2ZYA A;  3L73 E;  1CW5 A;  3F5H A;  2BOC C;  2DYR C;  2Y0C A;  3I5D A;  1JOC A;  2LW1 A;  2A06 E;  3ZRW A;  3WUU A;  3CCE P;  1BE3 G;  4QMA A;  2HVK C;  4PV1 D;  2V1D A;  1EM1 A;  1BL8 A;  2YI9 A;  3CWB E;  5BZB A;  4CZZ A;  3F5W C;  4PDR A;  4UCR A;  3H1H D;  4FLY A;  4BWN A;  2Y69 B;  3GHG A;  1SQF A;  1SF9 A;  1VL2 A;  2OAR A;  3CEI A;  1KC8 Q;  4GX0 A;  1SQX G;  2PP6 A;  1LNQ A;  1DF4 A;  1NU1 H;  3O9O A;  1YIT V;  2R70 A;  3M99 B;  3P7K A;  3FXE A;  3CCV V;  1CI6 B;  5EZY B;  1JVM A;  4DZO A;  5GTI H;  5JQG B;  4J41 A;  3S9O A;  1BT8 A;  2YIA A;  3W7W A;  1YVW A;  5CBG A;  4WFA V;  1GU5 A;  2Q7E A;  1EXI A;  1Q5O A;  3L36 A;  1S4X A;  1IZN B;  1SQB G;  1KQF B;  3A7O A;  1M93 A;  4KXR A;  5CCH A;  4NPF X;  4N21 A;  1EZV H;  3A0H H;  5BVZ A;  1R3L C;  2HOD B;  3GVM A;  2JWA A;  2IU3 A;  3SYQ A;  3HTK B;  2BSK B;  3GWO A;  5IYD O;  1JEK A;  4JI4 B;  4JI1 B;  5CB4 B;  1QVG O;  4MSW C;  3L73 H;  5C8Y B;  3RYH A;  3ETQ A;  1YHQ V;  4IHJ A;  1FJG B;  1M7L A;  3ZDM A;  1IXM A;  1H89 A;  1HNW O;  1K34 A;  5FLX N;  3V2R A;  3HD7 B;  4N78 E;  2CAZ C;  3CWB H;  4JYA B;  1RPR A;  4X20 A;  3USS A;  1OCR C;  3G4S V;  2IX7 C;  1S9K D;  5E1A C;  4P9P A;  2KOG A;  1FFT B;  5AW0 B;  3VP9 A; 
#chains in the Genus database with same CATH homology
 3B4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...