3B4SA

Crystal structure of a luxt domain from vibrio parahaemolyticus rimd 2210633
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
ADGRIFKMFIEHLEFEKGLDAFSQSWIKALEDSEFLAILRLLFHHIVTSESAHEFAANGIDRLYKMVESQFGSGGDKELEWLIGRSLIQMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a LuxT domain from Vibrio parahaemolyticus RIMD 2210633.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Structural genomics, unknown function
molecule keywords Protein LuxT
total genus 30
structure length 92
sequence length 92
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18285 LuxT_C Tetracycline repressor LuxT C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.790 Mainly Alpha Orthogonal Bundle Helix Hairpins luxt domain from vibrio parahaemolyticus 3b4sA01
1.20.5.830 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces luxt domain from vibrio parahaemolyticus 3b4sA02
3B4SA
chains in the Genus database with same CATH superfamily
4EB6B 3D71A 3ASOB 5LHIA 4QIWF 2EIKC 1Y6XA 5ITZA 4JV5B 4X1YB 2FY8A 5IYBO 3AEIA 4EYYQ 2UXDB 1YQ3C 5KAFZ 4DR7O 3CWBJ 2YXYA 3VP9A 1JCDA 1JTHA 2RNBA 1KV4A 3OM3B 3IGAC 3L70E 1O9HA 3AE6C 4B3RO 2IPPA 4J80A 1IFIA 1SQQD 3P3PA 1FDOA 3RW0A 3CCLP 2RN0A 2MK3A 4LNUB 1VF5B 1VMGA 3B71A 1NAFA 2AGAA 4PA7A 2YXRB 3AEDC 3OUFA 3ZMVA 2XUMA 1N7LA 3LIDA 2OYIA 2CTWA 3VMYA 2WPDG 3JAKA 1PNKA 1M1JB 2YO3A 1T5EA 1YEWA 1DIPA 1S72P 3EFFK 3APQA 1MSWD 4JTAB 2Q3EA 1XEQA 3K03A 4JI7B 1H2GA 3OEHG 1VF6C 1W2BU 3BPZA 3T97B 1NKDA 5EBLC 4O2AA 4D6TH 3WU2H 4NR1A 1YITV 3DXRB 5AW2B 5KLIB 5GTIZ 4UB6H 4EFEA 4FPPA 4X66O 4GKJO 4UUJC 1EBOA 3M9HA 2W83C 5KTBA 5JJEB 2QTOA 4WCEV 3ZMZA 5GTHE 3E8BA 1BE3E 5H6RA 1JY2P 1NVOA 2ZXEB 1VQOP 1KYOF 4LC1A 1E5WA 1NTKK 5J2UA 1FKAO 1DD4A 4DCKA 1P7BA 2IDBA 5B5EZ 4PD4D 5GTHZ 3K5BA 5APWA 1M57C 3VN0A 2PY5A 2YIUB 1U57A 2UXBO 3MUDA 2QWNB 3SJCC 3OW2O 2QKCA 4DV4B 4NTXA 4OVNF 5CCHC 5B5EE 1QLEB 5TJHA 2UUBO 3E2EA 2BOBC 1XMQO 3K5OA 4PA9A 1NU1D 1QHTA 5B3SB 1BDCA 1YHQV 1I08A 2H8PD 2WPVB 3VMXA 1GMJA 3SPJA 1IO4A 3QWOC 1VQPV 2JP3A 1M90Q 1PPJE 2OCHA 2YXHA 4DV5B 2BASA 1VQ5V 1AROP 1ZWIC 3PLNA 1JR9A 1LTGC 1SFCA 1RE4A 2AEJA 2AXTH 3J81N 4R7CA 3H1IH 4J9YB 1S77D 3M0DA 4MSWC 4O4JA 4TT3H 3F5WC 1GN4A 1MA1A 4Q20A 2WSEJ 2WSSH 3BAAA 3AK2A 3B8NA 3G4SV 4FLTA 2LXCB 2VWJA 2Q4PA 4ZOLB 4FLWA 5KX5A 1QLNA 4G27B 1G1IA 1FXKA 2HR3A 3RVYA 3FXEA 3RK2D 2ADQB 3VMAA 4PV1D 5CJ0A 2QA4V 1SQXJ 1QLEC 2V7QG 2QWPB 3S1KA 3SYCA 1EXJA 5J9PC 3RWRD 4JYCA 3HUSB 2A3QA 5DEDA 3P7KA 1V55C 3MP7B 1SQVK 4FK5C 3L71E 1M57B 4UVAA 3GF3A 4DUYO 3DTUB 4B86A 1AI6A 4DV5O 1NTZH 1K73Q 1R5SA 3HKEA 5CMZA 3BA8A 2UUAO 4LF8B 2FXMA 5KJ7A 3C90A 1LR1A 3CCUV 2HLOA 4BR6A 4CH5A 2CTPA 3U1CA 2QA4P 4UV9A 3TGUE 2P7TC 3TGUD 4QPKA 4UVCA 1JY2O 5LOVB 4W4KA 1NJIQ 4DR2O 3ETQA 2WLLA 4DV4O 4H44C 5KAFE 1FJKA 5IY5C 2UXBB 1GM7A 2A45G 4AHCA 3RBZA 4DO2A 1DF5A 1KILB 1OCZC 3TSIA 4OGQD 3ABLC 1XNQB 1M8OB 5CHXA 1JY3O 4K8XA 4FIPC 1KB9I 4F4LA 3IR9A 2YICA 1XNQO 1M9NA 1X79B 3SPGA 4I0XB 5GONA 3TDKA 2VQFO 2F43G 3L71G 3GHGA 5APUA 3JATB 5IYZB 1ZN5A 2O3JA 1OCOC 3F7VC 5CBOA 5JWPA 4YTPC 1OX3A 1TAEA 2YEVA 3WG7B 4MVSA 4IL6H 1OVRA 2YSUB 4ABMA 5J2TA 2UXNA 4GX2A 1RE3C 4DXWA 3CWBE 3P8MC 3UQ8A 1Y9BA 1S5LX 5EK0A 2XV5A 5EFWB 1IBMO 2EIMC 3HD7C 4M3LA 4ZI7B 2Q73A 4EEQA 3ICXA 4P9OA 3CWBG 1J95A 1Y47A 4UXNA 4PA4A 1VIBA 1FC2C 1Z5VA 1XHXA 4PDLA 5EZYB 1AQTA 2A45H 2YMKA 4IL6E 1WRGA 1MZFA 3CRMA 2R70A 4B3SO 4JI8B 1H2LA 3N2GB 1BSMA 2H43A 5JVDA 2DYRC 2A45I 5EZYA 2PFXA 4KJMA 1OW7A 2WA3A 3CRCA 5AVTB 1VQ6P 3BCCJ 1V54B 2Q6AA 3W7UA 3JARA 1HNXB 2L91A 4YIPA 3MGNA 4Z1MH 1IZNB 1CI6A 3M0DC 4X1IA 1YYCA 1EZVE 3RYCB 4JTCB 4TQFA 1YITP 2Q7HA 2JKVA 4PD4F 2LP7A 5LYJA 1DEEG 5APYA 3L72E 1S5JA 3ABUA 3UO3A 3B5NA 4U3FE 1CZQA 4X64O 2Y9YA 3B5ND 3ZEDA 1Z2GA 1HR0B 1IBLO 4DUZO 5APXA 5M1BA 2P22C 1T8ZA 1BMFG 3WB2A 3ZHSA 1YBKA 5LL6Y 2ATKC 1W0JG 1Y74B 3KKYA 3CX5H 2Z5HA 5JH7B 1ZOYC 1YIJV 3F5HA 2Q9IA 1M90W 2F4VB 1Z56A 3EWKA 1BGYH 2N04A 1DX7A 4FJCC 3CC4V 2IH1C 3MHSC 4MVMA 1XHZA 1L0NJ 2FYNB 2WPRA 4HNAA 2UU9B 3VYIA 1SQPD 1YXBA 2JEXA 2JGDB 3JASA 2AXCA 1GU4A 1HNZB 4LBEC 4U3FD 2ZE6A 4DR3O 3RK2C 3N7NA 1MG1A 4G2KA 2IBZE 2IBZD 1NU1G 1LNQA 1SQGA 4CC5A 2WAMA 2WWWA 2ZR2A 5CN0A 1KUQA 3H1HJ 3L75J 4C7NB 3CXHI 3OMIB 1DEBA 3B09A 2ZIOA 1BS3A 3AE1C 2OGUA 2XTAA 1ORQC 1SQBJ 2C0XA 2G38A 1G1XB 1LTBC 4LF4O 2HJDA 4JYYA 5L3EA 1AP6A 5B1BB 1KC8W 2CUGA 1IJDB 1RH5B 3HUSA 3M06A 3UT5A 4GKJB 1JVMA 4DR3B 4IOIH 2E76D 3QF7A 2QVAA 5KJ7C 2K9PA 3H1HE 3L75E 4Z2WA 1NT2B 1KB9H 3AG4C 1ZW0A 2UU9O 2OARA 3CRAA 5JJNB 4LF9O 3I5DA 5KX5B 2PUSA 4Z1VA 1LP1B 1ZX3A 3V4WA 2OYIC 1EZVD 1SQVG 4GX0A 2XDJA 3E35A 3CLQA 3II6A 1B04A 1EXIA 4KL1A 1A02F 2UXCO 1X59A 5JQGB 5CBGA 4X88A 4LF7B 1NU1E 1T6AA 3H1JE 4K3AA 2P5OA 1PP9D 2W0XA 3SPCA 2P4VA 3JSNA 4X9QA 1ROPA 2BEQD 4FZ1A 1S76D 5AVZB 2Z5IA 4R50A 1P49A 5KLIC 2ITDC 2QWOB 3L36A 3OAAG 4HNAB 4DK1A 1E79H 2PYJA 2R9AA 1D2DA 5KA6A 2JDIH 1NAYA 3HKBB 1TUBA 1K05A 3C9IA 1MOFA 2NPSA 4AYCA 1NTZK 4GX5A 1KQGB 4TUYA 1GL2C 1KP3A 3W7TA 3L72G 3VQXA 2KK7A 3RK3B 1UIIA 3CPWO 1JFFB 4JI8O 4B3MO 3BABA 2BSKB 1KORA 3FB7C 1VF5C 5FLXN 2WSCH 5LP6B 4X62O 1KD1W 3FX7A 2OT5A 1VF6A 2KSEA 1JMMA 2ZD9A 1GAXA 3TGUG 1Q2NA 2GA1A 4GYCB 3H1JG 5CB4B 2IFNA 5TISZ 4CBCA 4YXDC 1XL6A 3H1KJ 4I9WA 5L3GA 4Z1MG 3LIEA 3V2RA 1Q6IA 4FLUA 4AQYB 4ICGA 1LUVA 3L71D 2EZPA 4X20A 3CCLV 1YZBA 2CDYA 4K8ZA 2H8PC 4JF3A 2FYUH 2A06E 5BR8B 3D36C 5TISE 2WLJA 4NB5A 4BAYA 4KHPB 1BGYD 1GZLA 2QIWA 2GUZB 3DC6A 3UIAA 1JQ0A 1SQXE 3STZC 2J5UA 1YHQP 2D2CD 3FYEB 2V7QH 3AE2C 2IZ1A 3P8CD 1N0NA 3L70H 1O9GA 4DV2B 3HB3B 4NXMB 5B1AC 3K58A 1QR9A 3OUSA 4U7OA 1XMOO 5LGNA 3EVKA 1R3IC 1YVWA 1VARA 3SSUA 3CCMV 1BQ0A 1GKFA 3CCEP 3OAKA 1WLEA 3RK3D 1JB0J 1SQBH 1JJOA 2BCCE 1HP8A 1XOUA 3LSUA 2KI7B 4OWFA 5LA6B 1NU1H 4MVZA 2FYUJ 2E74D 1USDA 1SF9A 2FKXA 3WUUA 1Q82Q 3VQYA 4I4TB 3T1HO 1ZRTE 3Q1MA 2X6BA 3NR7A 4MTGA 1WAZA 4FLYA 1PL4A 1FZGA 4JYAB 3OR7C 2GUVA 2WLKA 1ZLZA 3H6PA 1RE4C 1G6UA 3LSSA 4IIJA 2UUAB 2LFRA 4LF8O 2ZDIA 4WY4C 2UUCO 1XDCA 4HKZH 2BCCH 1SQBE 1W2EA 1RQUA 2V4DA 2N1TB 1PNLA 3CX5F 3K5LA 1JOYA 1ZR4A 1V9PA 3MZWB 1S9KD 1J2JB 5KMGB 3ASNB 1KYOE 1FJGB 1Q3EA 2PGGA 4JI0O 5EBWC 2NNUA 5KMGA 1FAVA 3ZHVA 2R72A 2WQYC 2LO1A 4H0LD 3AG2B 3JSVC 3CCUP 1NTKE 3F89A 2HG5D 1RSOB 1LTJC 4CC6A 1QEXA 1OFCX 3TGUH 4FM2A 2Y48A 1LT9C 1SS1A 1BCCD 2QEXP 1QQCA 4Y99B 1KC8Q 1GN3A 1FBMA 4OGQC 2R44A 3JCUE 1ENVA 4DT0A 3CJHA 4RO0A 4H13B 2YS8A 1P84F 2L6LA 2QWRB 2E3CA 1E1RG 5JJJB 1HJ0A 1JEKA 1I5YA 4X65O 1NH2B 2QSAA 2UUCB 3JSLA 3THOA 3OR6C 1A32A 2YI9A 4W4LA 4KHXA 2I1KA 1ZMEC 2XZRA 5KHJA 1YJNV 5KAFH 2XU6A 2A06H 2LQTA 2FYUE 5FNVA 4ASUG 1OXZA 3HKDA 2FFDA 3SJAC 5CA0A 3CL3D 4XFJA 3ZN0A 4I7ZC 3AEAC 4CZZA 1W2BO 1NYHA 4J42A 1K97A 4G28B 3CXHH 1SFCB 1YJ9V 3D3IA 1LTAC 2ZQMA 3R66A 1NHLA 3A5TA 4UCUA 1URQC 3GHGC 4NVPA 5DECA 1GDTA 1WP7A 3D6YA 3U0ZA 1I0HA 1XMOB 4N21A 3H1JH 1G8MA 1AJNA 3WB1A 4BW9A 1NTZG 5DJTB 3CB2A 3O6QA 5HFLA 3BRTB 1YTZI 3G6EV 1AJQA 2KG7A 4I50A 1EDIA 3ETDA 1X0TA 2LW1A 1JFFA 1AI4A 5BR8O 4MN4C 3W68A 2E43A 5AVUB 1FU1A 3PP5A 2ZYGA 3OGCC 1V54C 2CAZC 1OCCB 3QTCA 2CTQA 1WA8B 4AQYO 3CC4P 1NTZJ 4N78E 1FDMA 4LP8A 5J2UB 5AVSB 1NTKH 1M93A 4H37A 1K34A 1J1DB 1EDKA 3H1KH 1BL8A 3AEGC 4MTXA 1WT6A 3CSXA 2N9YB 1JCHA 3FX0A 3A2AA 3RYHB 5K1PA 4LFAO 3RL0D 3P32A 1X22A 4MW8A 1WNSA 5DJUB 3AE5C 5IY5B 2KB7P 3HKDB 1J1DC 4LLHA 2KLVA 3TGUJ 2ETNA 1IXMA 1EZVG 3ZRSA 1OCOB 4JV5O 1SQVD 1SQBD 2YNYA 1YCIA 1SZTA 1OZ0A 2K1AA 1P84I 1FZFA 3L70J 2W6BA 1AR1B 2Y69B 1Q82W 3CMEP 4YHHO 1UFIA 4LFAB 2P06A 3VOUA 4DR1B 3UCSC 4WY4D 2F93B 4LFCO 1K92A 3ABLB 4WFGA 1KQSU 2G3AA 1SQPH 1VQ4P 1RSOA 3HUSC 3T4DA 3UKMA 4EKWA 1SLQA 2YI8A 3H9VA 2W6AA 1JTHB 2WT7B 1PGJA 2BE3A 1RF1A 1NBMG 1GM9A 1RPOA 1URQB 4ZKPA 4J9ZB 1YJWV 1URFA 2ODMA 1SQPG 3FAVB 5KUKA 3OJAB 1HJBA 4AUWA 4F6RB 2VRZA 4LGDE 3D36A 1S5LZ 5C8YA 1S4XA 1HWYA 1FXHA 2W6JH 4U7NA 4B3TO 2FFDC 1IBKB 4I7ZB 1SQXD 4NTWA 2G8YA 2ZYDA 1U96A 1LTJA 3BEHA 1D5AA 2JO1A 1ZL8A 3CXCU 1SFCD 3KYQA 2B1GA 4D7TA 4WBNB 3H1KD 3H32A 3JCUZ 2VQEO 1FJPA 4P2ZA 1N7SA 1VQ9V 2V7QJ 3VQWA 5K1XA 1KILD 1GU5A 1NTMH 5E79H 3SDLA 1KQLA 1SQQH 1L0LK 2IH3C 2BTQB 3NFQA 3C1LA 2K3RA 1YJNP 5CBFA 2H7HA 4GKKO 3L37A 4J11A 1XI1A 2ZE5A 4X1KA 1PPJD 5B3SC 1HNZO 4JZ2A 1KYOH 3CMAP 3ABTA 2LKMA 1NTKJ 3TNUA 4L87A 1TVKB 2OYHA 3B8EB 2JS3A 5B1NA 2P4KA 1ZRTD 2K9JA 3OMNB 1GH6A 4UCRA 1L0NH 4L8JA 2QTSA 4WFBV 1Q81W 4GUNA 2ZKOA 4X65B 2GUSA 3IFXA 4GX1A 2DWEC 4DUZB 1LWUB 5JVDB 5L3BA 4GIFA 1L4AD 3HKCA 4MS2A 4YHHB 1XUQA 3BCCG 1N33B 3BATA 1UPGA 4E2LA 1OIPA 4AQRD 1FZAA 3BVOA 5H6QA 4X20B 4PELA 3CWBH 1EFRG 1FXVA 2EJ7A 4GLXA 1LGHB 1X8YA 1CPYA 3O8ZA 1OMIA 2K9JB 2DE0X 1NS1A 1QU7A 5CB4A 2KS1A 1N34O 2WSFJ 4PJ0H 2QJKC 5AVRB 3W7XA 3H1JJ 3KPEA 4FFBA 1NH4A 3TNUB 2Q5UA 2YIUC 2Z0AA 4DZOA 2GV9A 2QJYC 3A2FA 5IJ9A 2IM9A 4YIOA 4JI0B 1IK7A 3LDCA 3CC2V 4B3SB 4YY3B 1BHBA 3FXDA 4GDOA 3WFVA 2ARHA 1F23A 3E7KA 2NN4A 1WPXA 2W6IG 3JATA 3J7AU 3H01A 3HR0A 5LMNO 2E5YA 4JZGA 4PV1B 5FPRA 2QE7H 4PHZA 3TK1A 4GOFA 2E74C 1KQSO 2K9YA 4UB6E 2QJ1A 1QNMA 1U97A 3DC5A 4UFZA 1E79G 2ZXWB 1NTZD 2QSIA 2Q6QA 2W0FC 1PV3A 3M7MX 1NTMK 4FZ0A 3OGIB 5LXTB 5KUMA 5IDJA 3VOPA 2YO2A 3ABMC 1QVFU 4JI1B 5F2VO 2Q3IA 4WY4A 1S2EA 3HD7D 2RCVA 3D3QA 4OXSA 3TJTA 3G71P 1N2DC 4DYLA 1OZHA 4EI2A 1M1JC 4PD4E 3FB8C 3RK3E 3VTPC 2YMYA 3AG3C 1MNGA 3BRCA 3S4RA 1NWQA 1PZQA 5BY1A 1QBZA 4TLFA 1OV9A 3USSA 5KHIA 2ZM6O 2R9RB 2NPSC 4XE5B 1H2MA 2CK3H 2LFSA 5GW7A 3HPLC 1XQ8A 4TV9B 2KZJA 3S3XA 4DW1A 2ZVNB 3KZIE 2E5LB 2YIAA 3AEFC 2FMLA 4ZKIA 4HZ3A 4KHPO 3CCVP 3AG1C 1FOSE 4FMTA 3H1LE 4H0LB 3ZS8C 2WA4A 1KFNA 2KIKA 1NTMD 3U1AA 1GL2B 3SJBC 4RUFA 1ZV8A 4FLVA 1R3LC 4UV8A 1JNMA 1JX9A 4WFEA 4NXNO 1S5LE 2QJPC 3HE4B 1VQPP 1W5CE 1SA0A 3OA7A 5B1OA 4LF5B 4UB8H 2W8ZA 3U10A 2ZXXA 2ZE8A 3JALB 2DQ0A 5AVYB 1QCEA 4K0KO 1SFCC 3MIWA 3ABKC 3JD3A 1P84D 2CPSA 1MZ9A 2H88C 1NU1J 2Y0PA 3Q4HA 4PI0A 2JJ2G 1KMIZ 2DN9A 5BMVB 3K04A 2X7RB 1BCCJ 5AW8B 4RESB 1QL1A 3L35A 3M91A 1F4NA 2E75D 4D6TG 3LDEA 3PHLA 3EXAA 4UCVA 1JJ2U 4BWAA 1HGZA 3CMEV 4PD4I 3CHXA 2WVRA 3LSQA 4XDLA 2FB5A 4BIOA 4B08A 1Y76A 2LJ2A 3FB5C 4UCTA 2QRXA 2JIZG 4JQ0D 1BE3D 3VBBA 3SFEC 2AEMA 1COWG 3E8GA 2XAFA 2ZT9D 1HTLC 3B5NB 1GW4A 4AI8A 2EIJB 2CGOA 3ZHUA 1IURA 3ZMTA 5B1BC 4OGQB 1PP9J 1DF4A 2KG7B 3RGUA 1L0LH 1MUUA 4EDFA 4IYIA 1S3JA 1IC2A 1SQVJ 2CTRA 3I56P 1N86A 4X1IB 1ZAUA 1IFJA 4N6JA 1CI6B 1RF1C 2ZYAA 1VQOV 3D6ZA 2FTKA 1K5SA 3IC7A 4O4IA 5CA1A 1SQBK 4FFKA 4JYAO 4JI5O 5DM6V 1Q81Q 3OMAB 2C9LY 4YXWH 2OWOA 2IX7C 2FKWB 4DK0A 3HKCB 1LUWA 4KFMA 1EC5A 3H1LD 3M9BA 4LWSB 4JI6B 2M6YA 2L5GB 2GM4A 1SETA 4PDRA 5KKZB 3AE8C 1G2CB 1PL5A 2P90A 1Q5OA 4WFHA 1EDLA 3SJQC 3FFQA 2JDIG 1G4YB 1GTOA 3RL0C 3ZIAG 1JO5A 3GLMA 1M1JA 3L4FA 3A0BZ 5KLVE 4IHJA 3G6EP 1GK4A 3RYIB 2CH7A 3STLC 2RN9A 2GSMB 4TV8A 2PRRA 2JR8A 4X1KB 4B3TB 4X66B 4UB6Z 2MW2B 4DV0B 4FM1A 3A0BE 1M1KW 4LNUA 3OW2U 4DJGA 5IYDO 1DH3A 1R6KA 3E8FA 1KD1Q 1RE3A 2OCCC 4J41A 3SYAA 1HGVA 1YTZT 3AG1B 3SPHA 1Q90D 4J7ZA 3T1CA 1PPJG 1N73A 1Q86W 1JOCA 4WBNA 2BCCJ 1AP5A 4Y28J 5ITZB 1JPXA 3OTOO 4JI4O 1FAFA 2QE7G 3AEBC 4CPGA 2A9HA 1M56C 5IWAB 4EB6A 3QH9A 1K9MW 1IBLB 1OW8A 3D8CA 1HR0O 1L4AB 2X0LA 3UM7A 1I94B 5APQA 1VQKP 2H89C 2NPSD 4DV3O 5CCGC 3FAVA 2ZCEA 2DYSC 4LR3A 1TU3F 2BCCG 5L8RJ 2XAHA 4B3RB 2A79B 5EYPB 2P58A 1ZP0C 3N4XA 3KZIZ 2UXDO 2OYQA 5CCHD 5FPOA 1FPOA 1USEA 2IYPA 3B4SA 4O4HB 2Q1KA 5AW1B 3UO2A 2Q7GA 3E89A 4QPJA 2Y0IA 4I2LC 3KCXA 3S3WA 2OQQA 1H38A 1T3UA 3F7YC 4C46A 1GK9A 5EC2C 4J10A 2VS0A 4LF6B 2R3SA 3LW5J 3R2PA 1AFOA 2C0WA 3RK3C 4LF7O 2FXOA 3C3SA 3T4ZA 2UXCB 2B9ZA 1Q6HA 3L74J 1IVSA 1K04A 3I55V 2B89A 2JJ1G 2EBOA 2JVDA 1FFTB 3JAWB 4LF9B 4ZOLA 1RQVA 3SWKA 3ABMB 1AR5A 1H2KA 2IBZG 2Q67A 4LWSA 2E76B 2Q7EA 3G67A 1P84E 1U7JA 4QE7A 2HFED 1T2KD 2KZIA 2GUZA 4DV0O 4LCUC 3BASA 2HVJC 1VQ8P 2FYUG 3N2KA 4CH6A 2WSCJ 2E74B 2WPSA 2GHYA 1D5NA 4PV1C 2KYVA 3K57A 3DGEA 1GD2E 5E79Z 1KP2A 5CA1B 1QLED 2A0LA 3F5TA 3B2EE 3OD4A 2SPZA 1H89A 4QGPA 2M7WA 2ZT9C 1NTKG 4CH4A 1GK6A 2KNCA 5GTIH 3A8TA 3TETA 5JCOA 2RDCA 3CC7V 3FYIB 3VQVA 4DRXB 3MD0A 4JI6O 5LP6A 1NO4A 5KHKA 1FFXB 3S9OA 1VQ7P 2PP6A 2BSKA 4BIUA 2OYHC 3SPIA 1HW7A 4GODA 4U3FG 3CD6P 5A2QN 2W27A 3C3TA 1SQVE 2H94A 4I50B 1BGYJ 1VQ6V 4FLZA 4HAMA 2QG4A 1Y76B 3O6QB 4IYHA 3KXDA 4D6TJ 3J80N 2KNCB 3R4YA 3ZBHA 4B7EA 2QM7A 2K88A 3SGIA 4RJTA 1VL2A 2FYUK 4E4EA 2MKVA 1ZXGA 1LWUC 4DUYB 1SQPK 3CE2A 3AE9C 1J5EB 2E42A 2Q68A 1PM9A 4X64B 3RK2B 3RGBA 1DLBA 1FDIA 1OVVA 3Q4HB 4ZNCA 1SESA 4DOJA 2PF4E 3DXRA 1KFMA 1VDFA 4QNHB 4BRYA 1FZCA 2IJIA 3IC9A 4O2AB 1KECA 1FS0G 3KCYA 4U7JA 1PP9G 1CP9A 2FFDB 2OYOA 1CSBA 4UVBA 4O2BA 2L35A 2XASA 4IT5A 2VRSA 2Y0DA 2RMZA 3HTKA 3JAKB 2YKQA 3CX5I 4RAIA 1GL2A 5C93A 3MUDC 1VP7A 3HE5A 5AW7B 4JI2B 5CJ4A 5IE9A 3E1IA 3H1IE 1BT8A 2J59M 2IZ0A 1US6A 4RUEA 4A7PA 4TV9A 3AK3A 1J5EO 4O4HA 1KZUB 2ZIMA 1NVPB 1RFYA 2RQ6A 4LF5O 4KT0J 1B06A 2KP8A 1BE3J 2KUBA 3L74H 1IBMB 4I6MC 2JGUA 2AHYA 1IX9A 4C7NA 2Y4TA 5KA5A 3X2QB 5CCGD 4KXRA 2IJKA 1XL4A 3EHBB 1SQQE 4WB4A 1THZA 1PP9E 3T1HB 1NGMB 3Q3DA 3KHUA 4N3YB 3L72H 3OT7A 2PAJA 1N32B 3JASB 1SQQG 3L73E 2Z4EA 2VQFB 4Q6GA 3CXHD 5CBNA 3V2NA 3GF7A 3L74E 4HH2A 2EIMB 3HD7B 1NTMJ 1JCCA 4NXMO 1K5QA 4DV2O 3L70G 1Y66A 2I8DA 4HYOA 1WB8A 2HPCB 3Q5PA 3WB0A 3KQGA 1IDSA 4H33A 3H1HH 3L75H 1JMKC 2DQ3A 2Y4UA 3WG7C 2R5BA 3H1IG 1RY3A 2B87B 2CH7B 2HEPA 2GTAA 3RYIA 3H1LG 4XDJA 1Q8IA 3OE7G 1NTMG 4FFBB 2HFEC 1K4DC 5CBHA 2LR2A 3CCMP 2K1EA 3CD6V 1SQPJ 1VEWA 3PRJA 5EIBC 5H9CA 3K0DA 4JI3O 4U3JA 3A3YB 2GTSA 3JARB 1NTME 1D7MA 1OCZB 1SQQK 1IFMA 4L75A 5GTHH 2OIGA 1MABG 3H1LJ 3HRNA 3ML0A 2BOCC 3T2MA 4YY3O 1L0LJ 4TOIA 1S5HC 4WFFA 1XTGB 3L73J 1PL0A 4JI2O 1LWUA 2WLHA 5L3DA 2XKMA 3E22B 3CRQA 3TYYA 1KU9A 2EINC 4D6TE 1BCCE 4O4IB 4U3JB 1SQXH 3ETGA 1N34B 3L74G 1U7MA 3PJSK 3BVHA 3V2QA 1FOSF 5KJ7D 1L0LG 1KQFB 4CS4A 4I55A 3H1LH 2B87A 4LFBB 1SS3A 3L72D 4XDKA 1OCRB 2ITCC 3L71J 4J7KA 3BFRA 3G4SP 1ZSPA 3GHGB 1PNMA 4HJGH 5B66H 1RF0A 4TUYB 3OTOB 2HHHB 4JI4B 1R5LA 2JEUA 3SR2C 3IAOA 5BU8B 3BY6A 3IJ4A 1F51A 2IJHA 4R4LA 4DW0A 5KKZC 2J58A 1VQ4V 3K0GA 1LTJB 3CCSV 4MT8A 2QGNA 5APTA 1AILA 3FKSG 1N73C 2E5TA 2IYOA 2Q0OC 1TUEB 2WLLB 5E1AC 4GKKB 4XA4A 4LH7A 3ZMSA 5LOVA 1QL2A 1AJPA 3JALA 2WLIA 1M56D 2WTYA 2YKOA 3W67A 1JUNA 3RBXA 3T1YB 1F4MA 1CW5A 3M9QA 1LP1A 1Y4MA 3HKEB 4H13C 3CCJP 1P7GA 1VF5D 1PV0A 2QKAA 1JY3N 1ZLLA 1FS0E 3K9SA 1AQ5A 1N36O 5AVVB 3ITKA 4NPDA 2M0BA 5EBMC 1HWTC 1NTKD 2WITA 3UT5B 4A5UB 2O1KA 3EFGA 3QVNA 1VQNV 3AG2C 2MJZA 3NXSA 4PA3A 3ZMUA 4JI5B 4R8CA 2CK3G 1R6TA 1FZEA 4ZHQA 4QE9A 5LGTA 2K37A 2ZT9B 2ILMA 3W7WA 1N8RW 2PZSA 2P67A 4IFDK 1S1CX 4KUMA 1LTIC 1YTFB 1OWAA 5CCGA 3L73D 1S0VA 1FZCB 4TT3G 1RM1C 2FBWC 4O4JB 4LF6O 2N1TC 1L1FA 1DGSA 4WY4B 1QR8A 3RYHA 1SERA 1AI5A 1IXBA 3KZIH 4LFBO 3I55P 5KAIZ 2JGDA 4BIZA 1HNWB 3IN6A 1LTTC 2PYLA 2WZ7A 2B88A 2P10A 3CCVV 3QO8A 2EULA 2IBZI 2V1DA 1HNXO 4JF7A 4MW3A 1HF9A 3MTUE 4YJ3A 2PTMA 1WN7A 1J1EC 5CA3A 3M99B 4NYKA 1ZTEA 1I7FA 1MZEA 5LMUO 1K33A 1FYJA 2W6JG 1H2SB 1P84H 3Q5SA 2IFMA 4J7JA 1M5IA 2DJVA 5LYJB 1GN2A 4I55B 4OPAA 1YI2V 4X89A 1NVPD 4EOTA 4YXWG 1PGQA 1LJ2A 2ZAEB 4MVUA 3JCUH 1A02J 2R9IA 1SKVA 5IJ0A 2JWDA 4CS3A 3A0HE 2X6CA 2O01N 2M3EA 1Q43A 3AG3B 1AVYA 3QG5A 1VQLP 1I5XA 4DR5B 1Y8AA 1B6QA 1UIXA 2F66C 1M7LA 2F23A 3A0HZ 2P2UA 3H1ID 4JBZA 3VMZA 3LDDA 2IJJA 2N74A 2JJLA 4WWIA 1T3JA 1JA8A 2QEXV 3CXHF 4PDVA 2HVKC 4R4MA 4O4LA 1TA8A 1VQKV 3G80A 4N78D 4ZI7A 5LP6C 2IW5A 3JAWA 3NMDA 1PPJH 2LW7A 1RM1B 2NR5A 5HFMA 3IFMA 1H8AA 2KSDA 1MFTA 2YUAA 2O1JA 1J1EB 4GKGA 1UJWB 2I1JA 1NKZB 5LHGA 3C8VA 2OYIB 2Q69A 1PKXA 1VQMV 2X6AA 1WJZA 2YEVB 4JAVA 2YIBD 3A0HH 1XNRB 4DR6O 2QJYB 5L3CA 1KB9F 3FWLA 2Y0CA 2NLJC 2BTQA 1GL2D 1NQTA 3ZX6A 1MFZA 3OTFA 3RYFA 5H2FH 1N7SB 3WUVA 3HD7A 3K3WA 4R6ZA 5LHHA 1AA0A 3VP8A 4F6EA 2N9BA 4PDMA 2WPQA 4X1YA 3OEEG 4KP4A 1YDXA 2KQXA 3BCCD 5LMNB 2ZNJA 3WUTA 5B66Z 1FZCC 1IFDA 2WMMA 3IF4A 4XBFA 4PD4H 1Z5WA 1E1QG 3MDSA 3V4QA 2ZR3A 3CYOA 2OIEA 4MTOA 3I56V 2PI5A 1SQXK 2JWAA 1KB9E 1KB9D 5B66E 5C39A 5KLVG 1R1BA 1XTCC 1R8EA 4MVRA 1MV8A 2XNDH 3AG4B 3CCEV 3P30A 1URQA 3A0RA 2M5AB 1RF1B 1N73B 1GM8A 2B1IA 4FLXA 1LT1A 4IIJB 4ZMDA 1Y67A 3FD9A 3ZRWA 4TQDA 3ZRXA 2OTKE 2D2CC 2CPBA 1RP3B 2BTOA 4LH6A 1BE3G 1YSCA 3CWBD 2FYNC 2AZ0A 2KSJA 1RHZB 4WF9V 1MMMA 3BCCH 2EIJC 5APVA 3JD0A 3U59A 3V2PA 4TV8B 1M1KQ 4YPCA 3L70D 2KKWA 2IBZH 4GZRB 5LA6A 3P8CE 4OH8B 5AW9B 3CMAV 3H1JD 2HKOA 3HTKB 3LNMB 1Q86Q 4UCOA 4FM0A 1N8RQ 4WFAV 1QVGU 3QNEA 1G2CA 4D7SA 1XMQB 1SQPE 5KAIE 3QO5A 1L0LD 1P4RA 1BSNA 4BRYB 4IFMA 1K9MQ 3CXHE 1XBLA 3RVZA 1XNRO 2KB1A 4DR6B 2KXPB 2E5LO 5EIBD 3ABKB 2YC0A 3RL0g 4N23A 1R73A 5BVZA 3CCSP 2GDSA 1GO3F 3V5BA 5IJ0B 4BW5A 2KOGA 2O01J 3SFDC 2KLUA 2UWJE 1AB3A 1RPRA 1YIJP 1R3KC 1HH0A 4DR4O 1W59A 1YF2A 4U3FJ 1YJWP 2P7JA 1H88A 2YXLA 4H0LC 1K7DA 1IBKO 5CMUA 2EZOA 2JS5A 1BCCH 3CRRA 1HDJA 4IGGA 2HG5C 4HB1A 1FFXA 2HLDG 3FGAD 1FD9A 4P30A 3L73H 3P3NA 5B5EH 4JI7O 2NPSB 2R3CA 3GW6A 1BDDA 1VPCA 2DYRB 2JK5C 1XREA 3E86A 3HKBA 2N05A 3MHHC 2RKLA 3AK1A 5APSA 4H44D 1OW6A 2XAJA 1MKMA 3Q5RA 1ZUQA 1EZVI 2V4HA 4RQEA 4DV6O 3CP1A 2F1MA 1EZJA 4RQFA 1K8AW 1SQFA 3MAQA 1PGOA 1QX8A 1R6NA 4IL6Z 4X62B 2BEZF 5GTIE 1SC5B 2A06D 2YIBA 3N2KB 3ZRVA 1VQ9P 4YJ2B 3K06A 2WLNA 4B3MB 4GT1A 3K08A 4QMAA 1VQ7V 1VF7A 1KILC 1EQ7A 1PIXA 1NH2D 4IFFA 4BWNA 2BCCD 1NOHA 3A7OA 4GCZA 3T97A 4EFBA 5FNVB 4W80A 4L73A 2ZXWC 4FVMA 4JASA 3HE4A 3AEEC 2D3OW 1KBHA 4DR7B 3GG2A 4JAAA 1S72V 1OJHA 4ZHQB 3AECC 2CGNA 2W90A 2H3OA 1H8EG 1KTMA 4MVQA 1SZXA 1B3QA 1CEZA 1L0LE 2QWQB 2WSSG 3TCUA 4DV3B 3G3ZA 2LGQA 1N33O 1URQD 1KKCA 2PGDA 1M4UA 2FL4A 1GRJA 1I94O 1EDJA 5EC1C 2XOKG 4UCSA 3TF5A 1H8HG 2Z3YA 4X8AA 5IWAO 2EX3A 3JD1A 3BRVB 2QM8A 4PI2A 5AW3B 2EILB 1V55B 1H0TA 4DV6B 3CS5A 1BE3H 1VQ5P 3CCJV 3ZRWB 2QJKB 3E8HA 2Y0EA 3LUTB 2QR4A 4H44B 1OVUA 1EN5A 2LGWA 3APOA 2AXTE 2JRIA 3LW5H 4C7UA 5KLVD 3KG2A 1NR1A 2WLIB 2A7WA 2VWKA 2DWDC 2GBOA 1WPBA 2Q7CA 3X2QC 2XHBA 1BGYE 1SQQJ 3W7SA 1L4AA 1PGPA 5AVWB 4DV1B 1AJYA 3L71H 1N36B 2O01H 1YJ9P 3CC7P 4RWUA 2N1TA 2M8RA 4DR4B 2B9BA 5E79E 2N1TD 1BGYG 3GB7C 3H1KE 2VQEB 5LGUA 5AW6B 1WP8A 2R32A 5AVQB 4RKUJ 3RYFB 1N4CA 3H1HD 3L75D 2YDEA 2XT9A 2DW3A 4MTFA 1CXZB 1EN4A 1XILA 3JD2A 4D6TD 4NTYA 3H1IJ 3BA9A 1W0KG 5D5QA 4I9QA 4I4TA 1VQ8V 3FWNA 2AW9A 3CCQP 1HBWA 4Y99C 1LTSC 4JPRA 5AG2A 3OFNG 3N27A 5AVXB 3U11A 4IHJB 1RF0C 1TGOA 1FZBA 3JCZA 4GOEA 1KYOI 4W7YA 1FE6A 1K3EA 1L0ND 2KS1B 1SQVH 2ZVOB 2ZDIC 4DV7O 2F4VO 2ZFCA 2RJZA 2CE4A 1GN6A 2YIDA 2HYNA 2NZ2A 2HHHO 4NPEA 4O4LB 1AI7A 1L2PA 3E22A 3L73G 4NKGB 4LFCB 2ADPA 5H5NA 5IT9N 3ZJZA 5BZBA 5K5GB 2DMXA 2HODA 3K79A 4ZIBA 5A9GA 1JY3P 3IAYA 2JEEA 1KKDA 1L0NK 4ZKUA 1GW3A 1BZKA 1N7SC 1NI8A 2E76C 2QM4A 3ZHRA 2OYHB 4L76A 3GWKC 3PN1A 1H2NA 1LT9A 2EILC 3JC22 2OTLV 1SP4A 3AE4C 1N0JA 2ZE7A 3K59A 1ZR2A 1YQ4C 1X9VA 3O65A 1BHAA 2UXXA 2M3BA 3ABVC 1QGKB 4OX9O 4AILC 2DOSA 3O9OA 2Y69C 1NZ6A 3WU2Z 4K0KB 1NKNA 5LBQA 3E83A 3L9DA 4YJ3B 2AEFA 4JI3B 1KYOD 4JPZB 4NXNB 4WBAA 2P6JA 1TUBB 3CPWU 2C2AA 5B1AB 3WU2E 1VQMP 2RH0A 3JD4A 3KDPB 1PP9H 4PA6A 1ZL8B 1K8AQ 1YTFD 1JMBA 5DN6G 4BXLA 2Z5UA 1AV1A 1KN7A 4L74A 5BMVA 1BCCG 3SWYA 3MHVA 2ZINA 5C8YB 2Y9ZA 1Q7YW 4F6RA 3TXQA 3CEIA 2O57A 5BU5A 2WSFH 5JQGA 5KHHA 2YKPA 1MSDA 1SA0B 2ZM6B 1L0NE 3H1KG 1L4AC 4CH3A 3SYQA 1K4CC 3CX5D 2WLMA 1M56B 3ETEA 5H2FE 4ASWA 1WMKA 1H0TB 1OCCC 5JCOC 2P1JA 2Q9LA 2EJRA 5KHGA 1N32O 3Q2YA 3G9RA 1EM1A 5TISH 5D5PA 2Q0AA 4JI1O 5H2FZ 4DR2B 2FYUD 3L72J 3HE5B 2AXTZ 4DR5O 3H25A 2EIKB 1YI2P 4ZBMA 2DYSB 2ZNIA 3ASOC 2RMKB 1EZVH 2OTJV 2ZJSE 3E1RA 4ASVA 1FXKB 1WB7A 1EN6A 4JAUA 4O2BB 2NRGA 3K5MA 5KLVJ 3WMM0 1HVVA 2IU3A 3B40A 1IZ3A 2E75B 2HJFC 4W7ZA 1SRYA 3PTZA 2F95B 3ZN1A 4O9BA 1DTOA 3G71V 4OX9B 4UB8E 4YJ2A 4MVOA 1PD3A 4CS2A 3CCRV 2IU0A 3BCCE 3RFRA 5LXTA 4P9PA 2OCCB 2A06G 3QO7A 2Q8VA 1VQNP 4I5SA 3DSQA 4UB8Z 3GVMA 2ITAA 3CI9A 4TWKA 1BQZA 5AW4B 3BHPA 3V6IA 5JH7A 1WA8A 5KLVK 1Y74A 4I1LA 2R5DA 1HNWO 1VQLV 3CCRP 4WVZA 3RT3C 1FJGO 4H13D 1QVGO 1F7YA 3RL0B 4K35A 5IJ9B 1GMGA 1GTWA 4DRXA 1DK1A 2QDOA 5AW0B 1M57D 5AW5B 1PFIA 5KAIH 1LT9B 3RYCA 2D2CB 3M0AA 3EQ2A 2HP8A 2PI4A 1DD3A 4DV7B 5FL7G 1IK9A 1NR7A 2XNDG 3SYOA 1JY2N 1SQXG 3SYPA 2WT7A 1QVFO 2XNXA 2YXQB 1NU1K 1SVFA 3R65A 2HODB 2UUBB 3AE7C 3L74D 3N2GA 1L8DA 3JYCA 1N7SD 3B77A 4JTDB 2C9NY 3ASNC 3D70A 2OTLP 4JYBA 3ZDMA 3JAMN 4OPHA 1G1JA 5CA0B 1Q6UA 3LNNA 4B7KA 3GWOA 4LF4B 1L0NG 1IFNA 3ZCCA 4EIJA 3TXSA 1AVOA 3B5NC 2WSEH 2OTJP 3T1YO 1NTZE 1HUCA 1KILE 4QJFB 5CCHA 2B5UA 2DW4A 1TVKA 5L3FA 4NPFX 2FXPA 2E75C 4IL6X 5J2TB 1JM0A 2QJPB 3ZHTA 3K9AA 1BSHA 4HYTB 4DV1O 3I5CA 1AR4A 1OHHG 3CJHB 4JGSA 1OCRC 4PJ0E 1S5LH 3H1HG 3L75G 5IYZA 3FB6C 3AE3C 2HPCA 2Q5ZA 2XAQA 1SQBG 1S9KE 5IYCO 3K5NA 3A0BH 5GONB 4I0XA 1K73W 4TSFG 5BXZA 4RO2A 2XAGA 1T2KC 1AVMA 2AZ2A 1R3JC 2FYZA 1X4TA 4PJ0Z 3H32B 4HBNA 3M8AA 2M5AA 4C7RA 3CX5E 5EYPA 2EINB 5KLVH 2QKSA 3G6BA 1IFPA 1KILA 3SWFA 2AHZA 3ZHQA 3AG7A 1NJIW 3PH0A 3B8MA 3CCQV 4U3FH 4DR1O 3NTNA 2POHA 5LMUB 2LXBA 3GMAA 3CC2P 3RN4A 1Q7YQ 1FXKC
chains in the Genus database with same CATH topology
3B4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4S A; 
#chains in the Genus database with same CATH topology
 4EB6 B;  3D71 A;  3ASO B;  5LHI A;  4QIW F;  2EIK C;  1Y6X A;  5ITZ A;  4JV5 B;  4X1Y B;  2FY8 A;  5IYB O;  3AEI A;  4EYY Q;  2UXD B;  1YQ3 C;  5KAF Z;  4DR7 O;  3CWB J;  2YXY A;  3VP9 A;  1JCD A;  1JTH A;  2RNB A;  1KV4 A;  3OM3 B;  3IGA C;  3L70 E;  1O9H A;  3AE6 C;  4B3R O;  2IPP A;  4J80 A;  1IFI A;  1SQQ D;  3P3P A;  1FDO A;  3RW0 A;  3CCL P;  2RN0 A;  2MK3 A;  4LNU B;  1VF5 B;  1VMG A;  3B71 A;  1NAF A;  2AGA A;  4PA7 A;  2YXR B;  3AED C;  3OUF A;  3ZMV A;  2XUM A;  1N7L A;  3LID A;  2OYI A;  2CTW A;  3VMY A;  2WPD G;  3JAK A;  1PNK A;  1M1J B;  2YO3 A;  1T5E A;  1YEW A;  1DIP A;  1S72 P;  3EFF K;  3APQ A;  1MSW D;  4JTA B;  2Q3E A;  1XEQ A;  3K03 A;  4JI7 B;  1H2G A;  3OEH G;  1VF6 C;  1W2B U;  3BPZ A;  3T97 B;  1NKD A;  5EBL C;  4O2A A;  4D6T H;  3WU2 H;  4NR1 A;  1YIT V;  3DXR B;  5AW2 B;  5KLI B;  5GTI Z;  4UB6 H;  4EFE A;  4FPP A;  4X66 O;  4GKJ O;  4UUJ C;  1EBO A;  3M9H A;  2W83 C;  5KTB A;  5JJE B;  2QTO A;  4WCE V;  3ZMZ A;  5GTH E;  3E8B A;  1BE3 E;  5H6R A;  1JY2 P;  1NVO A;  2ZXE B;  1VQO P;  1KYO F;  4LC1 A;  1E5W A;  1NTK K;  5J2U A;  1FKA O;  1DD4 A;  4DCK A;  1P7B A;  2IDB A;  5B5E Z;  4PD4 D;  5GTH Z;  3K5B A;  5APW A;  1M57 C;  3VN0 A;  2PY5 A;  2YIU B;  1U57 A;  2UXB O;  3MUD A;  2QWN B;  3SJC C;  3OW2 O;  2QKC A;  4DV4 B;  4NTX A;  4OVN F;  5CCH C;  5B5E E;  1QLE B;  5TJH A;  2UUB O;  3E2E A;  2BOB C;  1XMQ O;  3K5O A;  4PA9 A;  1NU1 D;  1QHT A;  5B3S B;  1BDC A;  1YHQ V;  1I08 A;  2H8P D;  2WPV B;  3VMX A;  1GMJ A;  3SPJ A;  1IO4 A;  3QWO C;  1VQP V;  2JP3 A;  1M90 Q;  1PPJ E;  2OCH A;  2YXH A;  4DV5 B;  2BAS A;  1VQ5 V;  1ARO P;  1ZWI C;  3PLN A;  1JR9 A;  1LTG C;  1SFC A;  1RE4 A;  2AEJ A;  2AXT H;  3J81 N;  4R7C A;  3H1I H;  4J9Y B;  1S77 D;  3M0D A;  4MSW C;  4O4J A;  4TT3 H;  3F5W C;  1GN4 A;  1MA1 A;  4Q20 A;  2WSE J;  2WSS H;  3BAA A;  3AK2 A;  3B8N A;  3G4S V;  4FLT A;  2LXC B;  2VWJ A;  2Q4P A;  4ZOL B;  4FLW A;  5KX5 A;  1QLN A;  4G27 B;  1G1I A;  1FXK A;  2HR3 A;  3RVY A;  3FXE A;  3RK2 D;  2ADQ B;  3VMA A;  4PV1 D;  5CJ0 A;  2QA4 V;  1SQX J;  1QLE C;  2V7Q G;  2QWP B;  3S1K A;  3SYC A;  1EXJ A;  5J9P C;  3RWR D;  4JYC A;  3HUS B;  2A3Q A;  5DED A;  3P7K A;  1V55 C;  3MP7 B;  1SQV K;  4FK5 C;  3L71 E;  1M57 B;  4UVA A;  3GF3 A;  4DUY O;  3DTU B;  4B86 A;  1AI6 A;  4DV5 O;  1NTZ H;  1K73 Q;  1R5S A;  3HKE A;  5CMZ A;  3BA8 A;  2UUA O;  4LF8 B;  2FXM A;  5KJ7 A;  3C90 A;  1LR1 A;  3CCU V;  2HLO A;  4BR6 A;  4CH5 A;  2CTP A;  3U1C A;  2QA4 P;  4UV9 A;  3TGU E;  2P7T C;  3TGU D;  4QPK A;  4UVC A;  1JY2 O;  5LOV B;  4W4K A;  1NJI Q;  4DR2 O;  3ETQ A;  2WLL A;  4DV4 O;  4H44 C;  5KAF E;  1FJK A;  5IY5 C;  2UXB B;  1GM7 A;  2A45 G;  4AHC A;  3RBZ A;  4DO2 A;  1DF5 A;  1KIL B;  1OCZ C;  3TSI A;  4OGQ D;  3ABL C;  1XNQ B;  1M8O B;  5CHX A;  1JY3 O;  4K8X A;  4FIP C;  1KB9 I;  4F4L A;  3IR9 A;  2YIC A;  1XNQ O;  1M9N A;  1X79 B;  3SPG A;  4I0X B;  5GON A;  3TDK A;  2VQF O;  2F43 G;  3L71 G;  3GHG A;  5APU A;  3JAT B;  5IYZ B;  1ZN5 A;  2O3J A;  1OCO C;  3F7V C;  5CBO A;  5JWP A;  4YTP C;  1OX3 A;  1TAE A;  2YEV A;  3WG7 B;  4MVS A;  4IL6 H;  1OVR A;  2YSU B;  4ABM A;  5J2T A;  2UXN A;  4GX2 A;  1RE3 C;  4DXW A;  3CWB E;  3P8M C;  3UQ8 A;  1Y9B A;  1S5L X;  5EK0 A;  2XV5 A;  5EFW B;  1IBM O;  2EIM C;  3HD7 C;  4M3L A;  4ZI7 B;  2Q73 A;  4EEQ A;  3ICX A;  4P9O A;  3CWB G;  1J95 A;  1Y47 A;  4UXN A;  4PA4 A;  1VIB A;  1FC2 C;  1Z5V A;  1XHX A;  4PDL A;  5EZY B;  1AQT A;  2A45 H;  2YMK A;  4IL6 E;  1WRG A;  1MZF A;  3CRM A;  2R70 A;  4B3S O;  4JI8 B;  1H2L A;  3N2G B;  1BSM A;  2H43 A;  5JVD A;  2DYR C;  2A45 I;  5EZY A;  2PFX A;  4KJM A;  1OW7 A;  2WA3 A;  3CRC A;  5AVT B;  1VQ6 P;  3BCC J;  1V54 B;  2Q6A A;  3W7U A;  3JAR A;  1HNX B;  2L91 A;  4YIP A;  3MGN A;  4Z1M H;  1IZN B;  1CI6 A;  3M0D C;  4X1I A;  1YYC A;  1EZV E;  3RYC B;  4JTC B;  4TQF A;  1YIT P;  2Q7H A;  2JKV A;  4PD4 F;  2LP7 A;  5LYJ A;  1DEE G;  5APY A;  3L72 E;  1S5J A;  3ABU A;  3UO3 A;  3B5N A;  4U3F E;  1CZQ A;  4X64 O;  2Y9Y A;  3B5N D;  3ZED A;  1Z2G A;  1HR0 B;  1IBL O;  4DUZ O;  5APX A;  5M1B A;  2P22 C;  1T8Z A;  1BMF G;  3WB2 A;  3ZHS A;  1YBK A;  5LL6 Y;  2ATK C;  1W0J G;  1Y74 B;  3KKY A;  3CX5 H;  2Z5H A;  5JH7 B;  1ZOY C;  1YIJ V;  3F5H A;  2Q9I A;  1M90 W;  2F4V B;  1Z56 A;  3EWK A;  1BGY H;  2N04 A;  1DX7 A;  4FJC C;  3CC4 V;  2IH1 C;  3MHS C;  4MVM A;  1XHZ A;  1L0N J;  2FYN B;  2WPR A;  4HNA A;  2UU9 B;  3VYI A;  1SQP D;  1YXB A;  2JEX A;  2JGD B;  3JAS A;  2AXC A;  1GU4 A;  1HNZ B;  4LBE C;  4U3F D;  2ZE6 A;  4DR3 O;  3RK2 C;  3N7N A;  1MG1 A;  4G2K A;  2IBZ E;  2IBZ D;  1NU1 G;  1LNQ A;  1SQG A;  4CC5 A;  2WAM A;  2WWW A;  2ZR2 A;  5CN0 A;  1KUQ A;  3H1H J;  3L75 J;  4C7N B;  3CXH I;  3OMI B;  1DEB A;  3B09 A;  2ZIO A;  1BS3 A;  3AE1 C;  2OGU A;  2XTA A;  1ORQ C;  1SQB J;  2C0X A;  2G38 A;  1G1X B;  1LTB C;  4LF4 O;  2HJD A;  4JYY A;  5L3E A;  1AP6 A;  5B1B B;  1KC8 W;  2CUG A;  1IJD B;  1RH5 B;  3HUS A;  3M06 A;  3UT5 A;  4GKJ B;  1JVM A;  4DR3 B;  4IOI H;  2E76 D;  3QF7 A;  2QVA A;  5KJ7 C;  2K9P A;  3H1H E;  3L75 E;  4Z2W A;  1NT2 B;  1KB9 H;  3AG4 C;  1ZW0 A;  2UU9 O;  2OAR A;  3CRA A;  5JJN B;  4LF9 O;  3I5D A;  5KX5 B;  2PUS A;  4Z1V A;  1LP1 B;  1ZX3 A;  3V4W A;  2OYI C;  1EZV D;  1SQV G;  4GX0 A;  2XDJ A;  3E35 A;  3CLQ A;  3II6 A;  1B04 A;  1EXI A;  4KL1 A;  1A02 F;  2UXC O;  1X59 A;  5JQG B;  5CBG A;  4X88 A;  4LF7 B;  1NU1 E;  1T6A A;  3H1J E;  4K3A A;  2P5O A;  1PP9 D;  2W0X A;  3SPC A;  2P4V A;  3JSN A;  4X9Q A;  1ROP A;  2BEQ D;  4FZ1 A;  1S76 D;  5AVZ B;  2Z5I A;  4R50 A;  1P49 A;  5KLI C;  2ITD C;  2QWO B;  3L36 A;  3OAA G;  4HNA B;  4DK1 A;  1E79 H;  2PYJ A;  2R9A A;  1D2D A;  5KA6 A;  2JDI H;  1NAY A;  3HKB B;  1TUB A;  1K05 A;  3C9I A;  1MOF A;  2NPS A;  4AYC A;  1NTZ K;  4GX5 A;  1KQG B;  4TUY A;  1GL2 C;  1KP3 A;  3W7T A;  3L72 G;  3VQX A;  2KK7 A;  3RK3 B;  1UII A;  3CPW O;  1JFF B;  4JI8 O;  4B3M O;  3BAB A;  2BSK B;  1KOR A;  3FB7 C;  1VF5 C;  5FLX N;  2WSC H;  5LP6 B;  4X62 O;  1KD1 W;  3FX7 A;  2OT5 A;  1VF6 A;  2KSE A;  1JMM A;  2ZD9 A;  1GAX A;  3TGU G;  1Q2N A;  2GA1 A;  4GYC B;  3H1J G;  5CB4 B;  2IFN A;  5TIS Z;  4CBC A;  4YXD C;  1XL6 A;  3H1K J;  4I9W A;  5L3G A;  4Z1M G;  3LIE A;  3V2R A;  1Q6I A;  4FLU A;  4AQY B;  4ICG A;  1LUV A;  3L71 D;  2EZP A;  4X20 A;  3CCL V;  1YZB A;  2CDY A;  4K8Z A;  2H8P C;  4JF3 A;  2FYU H;  2A06 E;  5BR8 B;  3D36 C;  5TIS E;  2WLJ A;  4NB5 A;  4BAY A;  4KHP B;  1BGY D;  1GZL A;  2QIW A;  2GUZ B;  3DC6 A;  3UIA A;  1JQ0 A;  1SQX E;  3STZ C;  2J5U A;  1YHQ P;  2D2C D;  3FYE B;  2V7Q H;  3AE2 C;  2IZ1 A;  3P8C D;  1N0N A;  3L70 H;  1O9G A;  4DV2 B;  3HB3 B;  4NXM B;  5B1A C;  3K58 A;  1QR9 A;  3OUS A;  4U7O A;  1XMO O;  5LGN A;  3EVK A;  1R3I C;  1YVW A;  1VAR A;  3SSU A;  3CCM V;  1BQ0 A;  1GKF A;  3CCE P;  3OAK A;  1WLE A;  3RK3 D;  1JB0 J;  1SQB H;  1JJO A;  2BCC E;  1HP8 A;  1XOU A;  3LSU A;  2KI7 B;  4OWF A;  5LA6 B;  1NU1 H;  4MVZ A;  2FYU J;  2E74 D;  1USD A;  1SF9 A;  2FKX A;  3WUU A;  1Q82 Q;  3VQY A;  4I4T B;  3T1H O;  1ZRT E;  3Q1M A;  2X6B A;  3NR7 A;  4MTG A;  1WAZ A;  4FLY A;  1PL4 A;  1FZG A;  4JYA B;  3OR7 C;  2GUV A;  2WLK A;  1ZLZ A;  3H6P A;  1RE4 C;  1G6U A;  3LSS A;  4IIJ A;  2UUA B;  2LFR A;  4LF8 O;  2ZDI A;  4WY4 C;  2UUC O;  1XDC A;  4HKZ H;  2BCC H;  1SQB E;  1W2E A;  1RQU A;  2V4D A;  2N1T B;  1PNL A;  3CX5 F;  3K5L A;  1JOY A;  1ZR4 A;  1V9P A;  3MZW B;  1S9K D;  1J2J B;  5KMG B;  3ASN B;  1KYO E;  1FJG B;  1Q3E A;  2PGG A;  4JI0 O;  5EBW C;  2NNU A;  5KMG A;  1FAV A;  3ZHV A;  2R72 A;  2WQY C;  2LO1 A;  4H0L D;  3AG2 B;  3JSV C;  3CCU P;  1NTK E;  3F89 A;  2HG5 D;  1RSO B;  1LTJ C;  4CC6 A;  1QEX A;  1OFC X;  3TGU H;  4FM2 A;  2Y48 A;  1LT9 C;  1SS1 A;  1BCC D;  2QEX P;  1QQC A;  4Y99 B;  1KC8 Q;  1GN3 A;  1FBM A;  4OGQ C;  2R44 A;  3JCU E;  1ENV A;  4DT0 A;  3CJH A;  4RO0 A;  4H13 B;  2YS8 A;  1P84 F;  2L6L A;  2QWR B;  2E3C A;  1E1R G;  5JJJ B;  1HJ0 A;  1JEK A;  1I5Y A;  4X65 O;  1NH2 B;  2QSA A;  2UUC B;  3JSL A;  3THO A;  3OR6 C;  1A32 A;  2YI9 A;  4W4L A;  4KHX A;  2I1K A;  1ZME C;  2XZR A;  5KHJ A;  1YJN V;  5KAF H;  2XU6 A;  2A06 H;  2LQT A;  2FYU E;  5FNV A;  4ASU G;  1OXZ A;  3HKD A;  2FFD A;  3SJA C;  5CA0 A;  3CL3 D;  4XFJ A;  3ZN0 A;  4I7Z C;  3AEA C;  4CZZ A;  1W2B O;  1NYH A;  4J42 A;  1K97 A;  4G28 B;  3CXH H;  1SFC B;  1YJ9 V;  3D3I A;  1LTA C;  2ZQM A;  3R66 A;  1NHL A;  3A5T A;  4UCU A;  1URQ C;  3GHG C;  4NVP A;  5DEC A;  1GDT A;  1WP7 A;  3D6Y A;  3U0Z A;  1I0H A;  1XMO B;  4N21 A;  3H1J H;  1G8M A;  1AJN A;  3WB1 A;  4BW9 A;  1NTZ G;  5DJT B;  3CB2 A;  3O6Q A;  5HFL A;  3BRT B;  1YTZ I;  3G6E V;  1AJQ A;  2KG7 A;  4I50 A;  1EDI A;  3ETD A;  1X0T A;  2LW1 A;  1JFF A;  1AI4 A;  5BR8 O;  4MN4 C;  3W68 A;  2E43 A;  5AVU B;  1FU1 A;  3PP5 A;  2ZYG A;  3OGC C;  1V54 C;  2CAZ C;  1OCC B;  3QTC A;  2CTQ A;  1WA8 B;  4AQY O;  3CC4 P;  1NTZ J;  4N78 E;  1FDM A;  4LP8 A;  5J2U B;  5AVS B;  1NTK H;  1M93 A;  4H37 A;  1K34 A;  1J1D B;  1EDK A;  3H1K H;  1BL8 A;  3AEG C;  4MTX A;  1WT6 A;  3CSX A;  2N9Y B;  1JCH A;  3FX0 A;  3A2A A;  3RYH B;  5K1P A;  4LFA O;  3RL0 D;  3P32 A;  1X22 A;  4MW8 A;  1WNS A;  5DJU B;  3AE5 C;  5IY5 B;  2KB7 P;  3HKD B;  1J1D C;  4LLH A;  2KLV A;  3TGU J;  2ETN A;  1IXM A;  1EZV G;  3ZRS A;  1OCO B;  4JV5 O;  1SQV D;  1SQB D;  2YNY A;  1YCI A;  1SZT A;  1OZ0 A;  2K1A A;  1P84 I;  1FZF A;  3L70 J;  2W6B A;  1AR1 B;  2Y69 B;  1Q82 W;  3CME P;  4YHH O;  1UFI A;  4LFA B;  2P06 A;  3VOU A;  4DR1 B;  3UCS C;  4WY4 D;  2F93 B;  4LFC O;  1K92 A;  3ABL B;  4WFG A;  1KQS U;  2G3A A;  1SQP H;  1VQ4 P;  1RSO A;  3HUS C;  3T4D A;  3UKM A;  4EKW A;  1SLQ A;  2YI8 A;  3H9V A;  2W6A A;  1JTH B;  2WT7 B;  1PGJ A;  2BE3 A;  1RF1 A;  1NBM G;  1GM9 A;  1RPO A;  1URQ B;  4ZKP A;  4J9Z B;  1YJW V;  1URF A;  2ODM A;  1SQP G;  3FAV B;  5KUK A;  3OJA B;  1HJB A;  4AUW A;  4F6R B;  2VRZ A;  4LGD E;  3D36 A;  1S5L Z;  5C8Y A;  1S4X A;  1HWY A;  1FXH A;  2W6J H;  4U7N A;  4B3T O;  2FFD C;  1IBK B;  4I7Z B;  1SQX D;  4NTW A;  2G8Y A;  2ZYD A;  1U96 A;  1LTJ A;  3BEH A;  1D5A A;  2JO1 A;  1ZL8 A;  3CXC U;  1SFC D;  3KYQ A;  2B1G A;  4D7T A;  4WBN B;  3H1K D;  3H32 A;  3JCU Z;  2VQE O;  1FJP A;  4P2Z A;  1N7S A;  1VQ9 V;  2V7Q J;  3VQW A;  5K1X A;  1KIL D;  1GU5 A;  1NTM H;  5E79 H;  3SDL A;  1KQL A;  1SQQ H;  1L0L K;  2IH3 C;  2BTQ B;  3NFQ A;  3C1L A;  2K3R A;  1YJN P;  5CBF A;  2H7H A;  4GKK O;  3L37 A;  4J11 A;  1XI1 A;  2ZE5 A;  4X1K A;  1PPJ D;  5B3S C;  1HNZ O;  4JZ2 A;  1KYO H;  3CMA P;  3ABT A;  2LKM A;  1NTK J;  3TNU A;  4L87 A;  1TVK B;  2OYH A;  3B8E B;  2JS3 A;  5B1N A;  2P4K A;  1ZRT D;  2K9J A;  3OMN B;  1GH6 A;  4UCR A;  1L0N H;  4L8J A;  2QTS A;  4WFB V;  1Q81 W;  4GUN A;  2ZKO A;  4X65 B;  2GUS A;  3IFX A;  4GX1 A;  2DWE C;  4DUZ B;  1LWU B;  5JVD B;  5L3B A;  4GIF A;  1L4A D;  3HKC A;  4MS2 A;  4YHH B;  1XUQ A;  3BCC G;  1N33 B;  3BAT A;  1UPG A;  4E2L A;  1OIP A;  4AQR D;  1FZA A;  3BVO A;  5H6Q A;  4X20 B;  4PEL A;  3CWB H;  1EFR G;  1FXV A;  2EJ7 A;  4GLX A;  1LGH B;  1X8Y A;  1CPY A;  3O8Z A;  1OMI A;  2K9J B;  2DE0 X;  1NS1 A;  1QU7 A;  5CB4 A;  2KS1 A;  1N34 O;  2WSF J;  4PJ0 H;  2QJK C;  5AVR B;  3W7X A;  3H1J J;  3KPE A;  4FFB A;  1NH4 A;  3TNU B;  2Q5U A;  2YIU C;  2Z0A A;  4DZO A;  2GV9 A;  2QJY C;  3A2F A;  5IJ9 A;  2IM9 A;  4YIO A;  4JI0 B;  1IK7 A;  3LDC A;  3CC2 V;  4B3S B;  4YY3 B;  1BHB A;  3FXD A;  4GDO A;  3WFV A;  2ARH A;  1F23 A;  3E7K A;  2NN4 A;  1WPX A;  2W6I G;  3JAT A;  3J7A U;  3H01 A;  3HR0 A;  5LMN O;  2E5Y A;  4JZG A;  4PV1 B;  5FPR A;  2QE7 H;  4PHZ A;  3TK1 A;  4GOF A;  2E74 C;  1KQS O;  2K9Y A;  4UB6 E;  2QJ1 A;  1QNM A;  1U97 A;  3DC5 A;  4UFZ A;  1E79 G;  2ZXW B;  1NTZ D;  2QSI A;  2Q6Q A;  2W0F C;  1PV3 A;  3M7M X;  1NTM K;  4FZ0 A;  3OGI B;  5LXT B;  5KUM A;  5IDJ A;  3VOP A;  2YO2 A;  3ABM C;  1QVF U;  4JI1 B;  5F2V O;  2Q3I A;  4WY4 A;  1S2E A;  3HD7 D;  2RCV A;  3D3Q A;  4OXS A;  3TJT A;  3G71 P;  1N2D C;  4DYL A;  1OZH A;  4EI2 A;  1M1J C;  4PD4 E;  3FB8 C;  3RK3 E;  3VTP C;  2YMY A;  3AG3 C;  1MNG A;  3BRC A;  3S4R A;  1NWQ A;  1PZQ A;  5BY1 A;  1QBZ A;  4TLF A;  1OV9 A;  3USS A;  5KHI A;  2ZM6 O;  2R9R B;  2NPS C;  4XE5 B;  1H2M A;  2CK3 H;  2LFS A;  5GW7 A;  3HPL C;  1XQ8 A;  4TV9 B;  2KZJ A;  3S3X A;  4DW1 A;  2ZVN B;  3KZI E;  2E5L B;  2YIA A;  3AEF C;  2FML A;  4ZKI A;  4HZ3 A;  4KHP O;  3CCV P;  3AG1 C;  1FOS E;  4FMT A;  3H1L E;  4H0L B;  3ZS8 C;  2WA4 A;  1KFN A;  2KIK A;  1NTM D;  3U1A A;  1GL2 B;  3SJB C;  4RUF A;  1ZV8 A;  4FLV A;  1R3L C;  4UV8 A;  1JNM A;  1JX9 A;  4WFE A;  4NXN O;  1S5L E;  2QJP C;  3HE4 B;  1VQP P;  1W5C E;  1SA0 A;  3OA7 A;  5B1O A;  4LF5 B;  4UB8 H;  2W8Z A;  3U10 A;  2ZXX A;  2ZE8 A;  3JAL B;  2DQ0 A;  5AVY B;  1QCE A;  4K0K O;  1SFC C;  3MIW A;  3ABK C;  3JD3 A;  1P84 D;  2CPS A;  1MZ9 A;  2H88 C;  1NU1 J;  2Y0P A;  3Q4H A;  4PI0 A;  2JJ2 G;  1KMI Z;  2DN9 A;  5BMV B;  3K04 A;  2X7R B;  1BCC J;  5AW8 B;  4RES B;  1QL1 A;  3L35 A;  3M91 A;  1F4N A;  2E75 D;  4D6T G;  3LDE A;  3PHL A;  3EXA A;  4UCV A;  1JJ2 U;  4BWA A;  1HGZ A;  3CME V;  4PD4 I;  3CHX A;  2WVR A;  3LSQ A;  4XDL A;  2FB5 A;  4BIO A;  4B08 A;  1Y76 A;  2LJ2 A;  3FB5 C;  4UCT A;  2QRX A;  2JIZ G;  4JQ0 D;  1BE3 D;  3VBB A;  3SFE C;  2AEM A;  1COW G;  3E8G A;  2XAF A;  2ZT9 D;  1HTL C;  3B5N B;  1GW4 A;  4AI8 A;  2EIJ B;  2CGO A;  3ZHU A;  1IUR A;  3ZMT A;  5B1B C;  4OGQ B;  1PP9 J;  1DF4 A;  2KG7 B;  3RGU A;  1L0L H;  1MUU A;  4EDF A;  4IYI A;  1S3J A;  1IC2 A;  1SQV J;  2CTR A;  3I56 P;  1N86 A;  4X1I B;  1ZAU A;  1IFJ A;  4N6J A;  1CI6 B;  1RF1 C;  2ZYA A;  1VQO V;  3D6Z A;  2FTK A;  1K5S A;  3IC7 A;  4O4I A;  5CA1 A;  1SQB K;  4FFK A;  4JYA O;  4JI5 O;  5DM6 V;  1Q81 Q;  3OMA B;  2C9L Y;  4YXW H;  2OWO A;  2IX7 C;  2FKW B;  4DK0 A;  3HKC B;  1LUW A;  4KFM A;  1EC5 A;  3H1L D;  3M9B A;  4LWS B;  4JI6 B;  2M6Y A;  2L5G B;  2GM4 A;  1SET A;  4PDR A;  5KKZ B;  3AE8 C;  1G2C B;  1PL5 A;  2P90 A;  1Q5O A;  4WFH A;  1EDL A;  3SJQ C;  3FFQ A;  2JDI G;  1G4Y B;  1GTO A;  3RL0 C;  3ZIA G;  1JO5 A;  3GLM A;  1M1J A;  3L4F A;  3A0B Z;  5KLV E;  4IHJ A;  3G6E P;  1GK4 A;  3RYI B;  2CH7 A;  3STL C;  2RN9 A;  2GSM B;  4TV8 A;  2PRR A;  2JR8 A;  4X1K B;  4B3T B;  4X66 B;  4UB6 Z;  2MW2 B;  4DV0 B;  4FM1 A;  3A0B E;  1M1K W;  4LNU A;  3OW2 U;  4DJG A;  5IYD O;  1DH3 A;  1R6K A;  3E8F A;  1KD1 Q;  1RE3 A;  2OCC C;  4J41 A;  3SYA A;  1HGV A;  1YTZ T;  3AG1 B;  3SPH A;  1Q90 D;  4J7Z A;  3T1C A;  1PPJ G;  1N73 A;  1Q86 W;  1JOC A;  4WBN A;  2BCC J;  1AP5 A;  4Y28 J;  5ITZ B;  1JPX A;  3OTO O;  4JI4 O;  1FAF A;  2QE7 G;  3AEB C;  4CPG A;  2A9H A;  1M56 C;  5IWA B;  4EB6 A;  3QH9 A;  1K9M W;  1IBL B;  1OW8 A;  3D8C A;  1HR0 O;  1L4A B;  2X0L A;  3UM7 A;  1I94 B;  5APQ A;  1VQK P;  2H89 C;  2NPS D;  4DV3 O;  5CCG C;  3FAV A;  2ZCE A;  2DYS C;  4LR3 A;  1TU3 F;  2BCC G;  5L8R J;  2XAH A;  4B3R B;  2A79 B;  5EYP B;  2P58 A;  1ZP0 C;  3N4X A;  3KZI Z;  2UXD O;  2OYQ A;  5CCH D;  5FPO A;  1FPO A;  1USE A;  2IYP A;  3B4S A;  4O4H B;  2Q1K A;  5AW1 B;  3UO2 A;  2Q7G A;  3E89 A;  4QPJ A;  2Y0I A;  4I2L C;  3KCX A;  3S3W A;  2OQQ A;  1H38 A;  1T3U A;  3F7Y C;  4C46 A;  1GK9 A;  5EC2 C;  4J10 A;  2VS0 A;  4LF6 B;  2R3S A;  3LW5 J;  3R2P A;  1AFO A;  2C0W A;  3RK3 C;  4LF7 O;  2FXO A;  3C3S A;  3T4Z A;  2UXC B;  2B9Z A;  1Q6H A;  3L74 J;  1IVS A;  1K04 A;  3I55 V;  2B89 A;  2JJ1 G;  2EBO A;  2JVD A;  1FFT B;  3JAW B;  4LF9 B;  4ZOL A;  1RQV A;  3SWK A;  3ABM B;  1AR5 A;  1H2K A;  2IBZ G;  2Q67 A;  4LWS A;  2E76 B;  2Q7E A;  3G67 A;  1P84 E;  1U7J A;  4QE7 A;  2HFE D;  1T2K D;  2KZI A;  2GUZ A;  4DV0 O;  4LCU C;  3BAS A;  2HVJ C;  1VQ8 P;  2FYU G;  3N2K A;  4CH6 A;  2WSC J;  2E74 B;  2WPS A;  2GHY A;  1D5N A;  4PV1 C;  2KYV A;  3K57 A;  3DGE A;  1GD2 E;  5E79 Z;  1KP2 A;  5CA1 B;  1QLE D;  2A0L A;  3F5T A;  3B2E E;  3OD4 A;  2SPZ A;  1H89 A;  4QGP A;  2M7W A;  2ZT9 C;  1NTK G;  4CH4 A;  1GK6 A;  2KNC A;  5GTI H;  3A8T A;  3TET A;  5JCO A;  2RDC A;  3CC7 V;  3FYI B;  3VQV A;  4DRX B;  3MD0 A;  4JI6 O;  5LP6 A;  1NO4 A;  5KHK A;  1FFX B;  3S9O A;  1VQ7 P;  2PP6 A;  2BSK A;  4BIU A;  2OYH C;  3SPI A;  1HW7 A;  4GOD A;  4U3F G;  3CD6 P;  5A2Q N;  2W27 A;  3C3T A;  1SQV E;  2H94 A;  4I50 B;  1BGY J;  1VQ6 V;  4FLZ A;  4HAM A;  2QG4 A;  1Y76 B;  3O6Q B;  4IYH A;  3KXD A;  4D6T J;  3J80 N;  2KNC B;  3R4Y A;  3ZBH A;  4B7E A;  2QM7 A;  2K88 A;  3SGI A;  4RJT A;  1VL2 A;  2FYU K;  4E4E A;  2MKV A;  1ZXG A;  1LWU C;  4DUY B;  1SQP K;  3CE2 A;  3AE9 C;  1J5E B;  2E42 A;  2Q68 A;  1PM9 A;  4X64 B;  3RK2 B;  3RGB A;  1DLB A;  1FDI A;  1OVV A;  3Q4H B;  4ZNC A;  1SES A;  4DOJ A;  2PF4 E;  3DXR A;  1KFM A;  1VDF A;  4QNH B;  4BRY A;  1FZC A;  2IJI A;  3IC9 A;  4O2A B;  1KEC A;  1FS0 G;  3KCY A;  4U7J A;  1PP9 G;  1CP9 A;  2FFD B;  2OYO A;  1CSB A;  4UVB A;  4O2B A;  2L35 A;  2XAS A;  4IT5 A;  2VRS A;  2Y0D A;  2RMZ A;  3HTK A;  3JAK B;  2YKQ A;  3CX5 I;  4RAI A;  1GL2 A;  5C93 A;  3MUD C;  1VP7 A;  3HE5 A;  5AW7 B;  4JI2 B;  5CJ4 A;  5IE9 A;  3E1I A;  3H1I E;  1BT8 A;  2J59 M;  2IZ0 A;  1US6 A;  4RUE A;  4A7P A;  4TV9 A;  3AK3 A;  1J5E O;  4O4H A;  1KZU B;  2ZIM A;  1NVP B;  1RFY A;  2RQ6 A;  4LF5 O;  4KT0 J;  1B06 A;  2KP8 A;  1BE3 J;  2KUB A;  3L74 H;  1IBM B;  4I6M C;  2JGU A;  2AHY A;  1IX9 A;  4C7N A;  2Y4T A;  5KA5 A;  3X2Q B;  5CCG D;  4KXR A;  2IJK A;  1XL4 A;  3EHB B;  1SQQ E;  4WB4 A;  1THZ A;  1PP9 E;  3T1H B;  1NGM B;  3Q3D A;  3KHU A;  4N3Y B;  3L72 H;  3OT7 A;  2PAJ A;  1N32 B;  3JAS B;  1SQQ G;  3L73 E;  2Z4E A;  2VQF B;  4Q6G A;  3CXH D;  5CBN A;  3V2N A;  3GF7 A;  3L74 E;  4HH2 A;  2EIM B;  3HD7 B;  1NTM J;  1JCC A;  4NXM O;  1K5Q A;  4DV2 O;  3L70 G;  1Y66 A;  2I8D A;  4HYO A;  1WB8 A;  2HPC B;  3Q5P A;  3WB0 A;  3KQG A;  1IDS A;  4H33 A;  3H1H H;  3L75 H;  1JMK C;  2DQ3 A;  2Y4U A;  3WG7 C;  2R5B A;  3H1I G;  1RY3 A;  2B87 B;  2CH7 B;  2HEP A;  2GTA A;  3RYI A;  3H1L G;  4XDJ A;  1Q8I A;  3OE7 G;  1NTM G;  4FFB B;  2HFE C;  1K4D C;  5CBH A;  2LR2 A;  3CCM P;  2K1E A;  3CD6 V;  1SQP J;  1VEW A;  3PRJ A;  5EIB C;  5H9C A;  3K0D A;  4JI3 O;  4U3J A;  3A3Y B;  2GTS A;  3JAR B;  1NTM E;  1D7M A;  1OCZ B;  1SQQ K;  1IFM A;  4L75 A;  5GTH H;  2OIG A;  1MAB G;  3H1L J;  3HRN A;  3ML0 A;  2BOC C;  3T2M A;  4YY3 O;  1L0L J;  4TOI A;  1S5H C;  4WFF A;  1XTG B;  3L73 J;  1PL0 A;  4JI2 O;  1LWU A;  2WLH A;  5L3D A;  2XKM A;  3E22 B;  3CRQ A;  3TYY A;  1KU9 A;  2EIN C;  4D6T E;  1BCC E;  4O4I B;  4U3J B;  1SQX H;  3ETG A;  1N34 B;  3L74 G;  1U7M A;  3PJS K;  3BVH A;  3V2Q A;  1FOS F;  5KJ7 D;  1L0L G;  1KQF B;  4CS4 A;  4I55 A;  3H1L H;  2B87 A;  4LFB B;  1SS3 A;  3L72 D;  4XDK A;  1OCR B;  2ITC C;  3L71 J;  4J7K A;  3BFR A;  3G4S P;  1ZSP A;  3GHG B;  1PNM A;  4HJG H;  5B66 H;  1RF0 A;  4TUY B;  3OTO B;  2HHH B;  4JI4 B;  1R5L A;  2JEU A;  3SR2 C;  3IAO A;  5BU8 B;  3BY6 A;  3IJ4 A;  1F51 A;  2IJH A;  4R4L A;  4DW0 A;  5KKZ C;  2J58 A;  1VQ4 V;  3K0G A;  1LTJ B;  3CCS V;  4MT8 A;  2QGN A;  5APT A;  1AIL A;  3FKS G;  1N73 C;  2E5T A;  2IYO A;  2Q0O C;  1TUE B;  2WLL B;  5E1A C;  4GKK B;  4XA4 A;  4LH7 A;  3ZMS A;  5LOV A;  1QL2 A;  1AJP A;  3JAL A;  2WLI A;  1M56 D;  2WTY A;  2YKO A;  3W67 A;  1JUN A;  3RBX A;  3T1Y B;  1F4M A;  1CW5 A;  3M9Q A;  1LP1 A;  1Y4M A;  3HKE B;  4H13 C;  3CCJ P;  1P7G A;  1VF5 D;  1PV0 A;  2QKA A;  1JY3 N;  1ZLL A;  1FS0 E;  3K9S A;  1AQ5 A;  1N36 O;  5AVV B;  3ITK A;  4NPD A;  2M0B A;  5EBM C;  1HWT C;  1NTK D;  2WIT A;  3UT5 B;  4A5U B;  2O1K A;  3EFG A;  3QVN A;  1VQN V;  3AG2 C;  2MJZ A;  3NXS A;  4PA3 A;  3ZMU A;  4JI5 B;  4R8C A;  2CK3 G;  1R6T A;  1FZE A;  4ZHQ A;  4QE9 A;  5LGT A;  2K37 A;  2ZT9 B;  2ILM A;  3W7W A;  1N8R W;  2PZS A;  2P67 A;  4IFD K;  1S1C X;  4KUM A;  1LTI C;  1YTF B;  1OWA A;  5CCG A;  3L73 D;  1S0V A;  1FZC B;  4TT3 G;  1RM1 C;  2FBW C;  4O4J B;  4LF6 O;  2N1T C;  1L1F A;  1DGS A;  4WY4 B;  1QR8 A;  3RYH A;  1SER A;  1AI5 A;  1IXB A;  3KZI H;  4LFB O;  3I55 P;  5KAI Z;  2JGD A;  4BIZ A;  1HNW B;  3IN6 A;  1LTT C;  2PYL A;  2WZ7 A;  2B88 A;  2P10 A;  3CCV V;  3QO8 A;  2EUL A;  2IBZ I;  2V1D A;  1HNX O;  4JF7 A;  4MW3 A;  1HF9 A;  3MTU E;  4YJ3 A;  2PTM A;  1WN7 A;  1J1E C;  5CA3 A;  3M99 B;  4NYK A;  1ZTE A;  1I7F A;  1MZE A;  5LMU O;  1K33 A;  1FYJ A;  2W6J G;  1H2S B;  1P84 H;  3Q5S A;  2IFM A;  4J7J A;  1M5I A;  2DJV A;  5LYJ B;  1GN2 A;  4I55 B;  4OPA A;  1YI2 V;  4X89 A;  1NVP D;  4EOT A;  4YXW G;  1PGQ A;  1LJ2 A;  2ZAE B;  4MVU A;  3JCU H;  1A02 J;  2R9I A;  1SKV A;  5IJ0 A;  2JWD A;  4CS3 A;  3A0H E;  2X6C A;  2O01 N;  2M3E A;  1Q43 A;  3AG3 B;  1AVY A;  3QG5 A;  1VQL P;  1I5X A;  4DR5 B;  1Y8A A;  1B6Q A;  1UIX A;  2F66 C;  1M7L A;  2F23 A;  3A0H Z;  2P2U A;  3H1I D;  4JBZ A;  3VMZ A;  3LDD A;  2IJJ A;  2N74 A;  2JJL A;  4WWI A;  1T3J A;  1JA8 A;  2QEX V;  3CXH F;  4PDV A;  2HVK C;  4R4M A;  4O4L A;  1TA8 A;  1VQK V;  3G80 A;  4N78 D;  4ZI7 A;  5LP6 C;  2IW5 A;  3JAW A;  3NMD A;  1PPJ H;  2LW7 A;  1RM1 B;  2NR5 A;  5HFM A;  3IFM A;  1H8A A;  2KSD A;  1MFT A;  2YUA A;  2O1J A;  1J1E B;  4GKG A;  1UJW B;  2I1J A;  1NKZ B;  5LHG A;  3C8V A;  2OYI B;  2Q69 A;  1PKX A;  1VQM V;  2X6A A;  1WJZ A;  2YEV B;  4JAV A;  2YIB D;  3A0H H;  1XNR B;  4DR6 O;  2QJY B;  5L3C A;  1KB9 F;  3FWL A;  2Y0C A;  2NLJ C;  2BTQ A;  1GL2 D;  1NQT A;  3ZX6 A;  1MFZ A;  3OTF A;  3RYF A;  5H2F H;  1N7S B;  3WUV A;  3HD7 A;  3K3W A;  4R6Z A;  5LHH A;  1AA0 A;  3VP8 A;  4F6E A;  2N9B A;  4PDM A;  2WPQ A;  4X1Y A;  3OEE G;  4KP4 A;  1YDX A;  2KQX A;  3BCC D;  5LMN B;  2ZNJ A;  3WUT A;  5B66 Z;  1FZC C;  1IFD A;  2WMM A;  3IF4 A;  4XBF A;  4PD4 H;  1Z5W A;  1E1Q G;  3MDS A;  3V4Q A;  2ZR3 A;  3CYO A;  2OIE A;  4MTO A;  3I56 V;  2PI5 A;  1SQX K;  2JWA A;  1KB9 E;  1KB9 D;  5B66 E;  5C39 A;  5KLV G;  1R1B A;  1XTC C;  1R8E A;  4MVR A;  1MV8 A;  2XND H;  3AG4 B;  3CCE V;  3P30 A;  1URQ A;  3A0R A;  2M5A B;  1RF1 B;  1N73 B;  1GM8 A;  2B1I A;  4FLX A;  1LT1 A;  4IIJ B;  4ZMD A;  1Y67 A;  3FD9 A;  3ZRW A;  4TQD A;  3ZRX A;  2OTK E;  2D2C C;  2CPB A;  1RP3 B;  2BTO A;  4LH6 A;  1BE3 G;  1YSC A;  3CWB D;  2FYN C;  2AZ0 A;  2KSJ A;  1RHZ B;  4WF9 V;  1MMM A;  3BCC H;  2EIJ C;  5APV A;  3JD0 A;  3U59 A;  3V2P A;  4TV8 B;  1M1K Q;  4YPC A;  3L70 D;  2KKW A;  2IBZ H;  4GZR B;  5LA6 A;  3P8C E;  4OH8 B;  5AW9 B;  3CMA V;  3H1J D;  2HKO A;  3HTK B;  3LNM B;  1Q86 Q;  4UCO A;  4FM0 A;  1N8R Q;  4WFA V;  1QVG U;  3QNE A;  1G2C A;  4D7S A;  1XMQ B;  1SQP E;  5KAI E;  3QO5 A;  1L0L D;  1P4R A;  1BSN A;  4BRY B;  4IFM A;  1K9M Q;  3CXH E;  1XBL A;  3RVZ A;  1XNR O;  2KB1 A;  4DR6 B;  2KXP B;  2E5L O;  5EIB D;  3ABK B;  2YC0 A;  3RL0 g;  4N23 A;  1R73 A;  5BVZ A;  3CCS P;  2GDS A;  1GO3 F;  3V5B A;  5IJ0 B;  4BW5 A;  2KOG A;  2O01 J;  3SFD C;  2KLU A;  2UWJ E;  1AB3 A;  1RPR A;  1YIJ P;  1R3K C;  1HH0 A;  4DR4 O;  1W59 A;  1YF2 A;  4U3F J;  1YJW P;  2P7J A;  1H88 A;  2YXL A;  4H0L C;  1K7D A;  1IBK O;  5CMU A;  2EZO A;  2JS5 A;  1BCC H;  3CRR A;  1HDJ A;  4IGG A;  2HG5 C;  4HB1 A;  1FFX A;  2HLD G;  3FGA D;  1FD9 A;  4P30 A;  3L73 H;  3P3N A;  5B5E H;  4JI7 O;  2NPS B;  2R3C A;  3GW6 A;  1BDD A;  1VPC A;  2DYR B;  2JK5 C;  1XRE A;  3E86 A;  3HKB A;  2N05 A;  3MHH C;  2RKL A;  3AK1 A;  5APS A;  4H44 D;  1OW6 A;  2XAJ A;  1MKM A;  3Q5R A;  1ZUQ A;  1EZV I;  2V4H A;  4RQE A;  4DV6 O;  3CP1 A;  2F1M A;  1EZJ A;  4RQF A;  1K8A W;  1SQF A;  3MAQ A;  1PGO A;  1QX8 A;  1R6N A;  4IL6 Z;  4X62 B;  2BEZ F;  5GTI E;  1SC5 B;  2A06 D;  2YIB A;  3N2K B;  3ZRV A;  1VQ9 P;  4YJ2 B;  3K06 A;  2WLN A;  4B3M B;  4GT1 A;  3K08 A;  4QMA A;  1VQ7 V;  1VF7 A;  1KIL C;  1EQ7 A;  1PIX A;  1NH2 D;  4IFF A;  4BWN A;  2BCC D;  1NOH A;  3A7O A;  4GCZ A;  3T97 A;  4EFB A;  5FNV B;  4W80 A;  4L73 A;  2ZXW C;  4FVM A;  4JAS A;  3HE4 A;  3AEE C;  2D3O W;  1KBH A;  4DR7 B;  3GG2 A;  4JAA A;  1S72 V;  1OJH A;  4ZHQ B;  3AEC C;  2CGN A;  2W90 A;  2H3O A;  1H8E G;  1KTM A;  4MVQ A;  1SZX A;  1B3Q A;  1CEZ A;  1L0L E;  2QWQ B;  2WSS G;  3TCU A;  4DV3 B;  3G3Z A;  2LGQ A;  1N33 O;  1URQ D;  1KKC A;  2PGD A;  1M4U A;  2FL4 A;  1GRJ A;  1I94 O;  1EDJ A;  5EC1 C;  2XOK G;  4UCS A;  3TF5 A;  1H8H G;  2Z3Y A;  4X8A A;  5IWA O;  2EX3 A;  3JD1 A;  3BRV B;  2QM8 A;  4PI2 A;  5AW3 B;  2EIL B;  1V55 B;  1H0T A;  4DV6 B;  3CS5 A;  1BE3 H;  1VQ5 P;  3CCJ V;  3ZRW B;  2QJK B;  3E8H A;  2Y0E A;  3LUT B;  2QR4 A;  4H44 B;  1OVU A;  1EN5 A;  2LGW A;  3APO A;  2AXT E;  2JRI A;  3LW5 H;  4C7U A;  5KLV D;  3KG2 A;  1NR1 A;  2WLI B;  2A7W A;  2VWK A;  2DWD C;  2GBO A;  1WPB A;  2Q7C A;  3X2Q C;  2XHB A;  1BGY E;  1SQQ J;  3W7S A;  1L4A A;  1PGP A;  5AVW B;  4DV1 B;  1AJY A;  3L71 H;  1N36 B;  2O01 H;  1YJ9 P;  3CC7 P;  4RWU A;  2N1T A;  2M8R A;  4DR4 B;  2B9B A;  5E79 E;  2N1T D;  1BGY G;  3GB7 C;  3H1K E;  2VQE B;  5LGU A;  5AW6 B;  1WP8 A;  2R32 A;  5AVQ B;  4RKU J;  3RYF B;  1N4C A;  3H1H D;  3L75 D;  2YDE A;  2XT9 A;  2DW3 A;  4MTF A;  1CXZ B;  1EN4 A;  1XIL A;  3JD2 A;  4D6T D;  4NTY A;  3H1I J;  3BA9 A;  1W0K G;  5D5Q A;  4I9Q A;  4I4T A;  1VQ8 V;  3FWN A;  2AW9 A;  3CCQ P;  1HBW A;  4Y99 C;  1LTS C;  4JPR A;  5AG2 A;  3OFN G;  3N27 A;  5AVX B;  3U11 A;  4IHJ B;  1RF0 C;  1TGO A;  1FZB A;  3JCZ A;  4GOE A;  1KYO I;  4W7Y A;  1FE6 A;  1K3E A;  1L0N D;  2KS1 B;  1SQV H;  2ZVO B;  2ZDI C;  4DV7 O;  2F4V O;  2ZFC A;  2RJZ A;  2CE4 A;  1GN6 A;  2YID A;  2HYN A;  2NZ2 A;  2HHH O;  4NPE A;  4O4L B;  1AI7 A;  1L2P A;  3E22 A;  3L73 G;  4NKG B;  4LFC B;  2ADP A;  5H5N A;  5IT9 N;  3ZJZ A;  5BZB A;  5K5G B;  2DMX A;  2HOD A;  3K79 A;  4ZIB A;  5A9G A;  1JY3 P;  3IAY A;  2JEE A;  1KKD A;  1L0N K;  4ZKU A;  1GW3 A;  1BZK A;  1N7S C;  1NI8 A;  2E76 C;  2QM4 A;  3ZHR A;  2OYH B;  4L76 A;  3GWK C;  3PN1 A;  1H2N A;  1LT9 A;  2EIL C;  3JC2 2;  2OTL V;  1SP4 A;  3AE4 C;  1N0J A;  2ZE7 A;  3K59 A;  1ZR2 A;  1YQ4 C;  1X9V A;  3O65 A;  1BHA A;  2UXX A;  2M3B A;  3ABV C;  1QGK B;  4OX9 O;  4AIL C;  2DOS A;  3O9O A;  2Y69 C;  1NZ6 A;  3WU2 Z;  4K0K B;  1NKN A;  5LBQ A;  3E83 A;  3L9D A;  4YJ3 B;  2AEF A;  4JI3 B;  1KYO D;  4JPZ B;  4NXN B;  4WBA A;  2P6J A;  1TUB B;  3CPW U;  2C2A A;  5B1A B;  3WU2 E;  1VQM P;  2RH0 A;  3JD4 A;  3KDP B;  1PP9 H;  4PA6 A;  1ZL8 B;  1K8A Q;  1YTF D;  1JMB A;  5DN6 G;  4BXL A;  2Z5U A;  1AV1 A;  1KN7 A;  4L74 A;  5BMV A;  1BCC G;  3SWY A;  3MHV A;  2ZIN A;  5C8Y B;  2Y9Z A;  1Q7Y W;  4F6R A;  3TXQ A;  3CEI A;  2O57 A;  5BU5 A;  2WSF H;  5JQG A;  5KHH A;  2YKP A;  1MSD A;  1SA0 B;  2ZM6 B;  1L0N E;  3H1K G;  1L4A C;  4CH3 A;  3SYQ A;  1K4C C;  3CX5 D;  2WLM A;  1M56 B;  3ETE A;  5H2F E;  4ASW A;  1WMK A;  1H0T B;  1OCC C;  5JCO C;  2P1J A;  2Q9L A;  2EJR A;  5KHG A;  1N32 O;  3Q2Y A;  3G9R A;  1EM1 A;  5TIS H;  5D5P A;  2Q0A A;  4JI1 O;  5H2F Z;  4DR2 B;  2FYU D;  3L72 J;  3HE5 B;  2AXT Z;  4DR5 O;  3H25 A;  2EIK B;  1YI2 P;  4ZBM A;  2DYS B;  2ZNI A;  3ASO C;  2RMK B;  1EZV H;  2OTJ V;  2ZJS E;  3E1R A;  4ASV A;  1FXK B;  1WB7 A;  1EN6 A;  4JAU A;  4O2B B;  2NRG A;  3K5M A;  5KLV J;  3WMM 0;  1HVV A;  2IU3 A;  3B40 A;  1IZ3 A;  2E75 B;  2HJF C;  4W7Z A;  1SRY A;  3PTZ A;  2F95 B;  3ZN1 A;  4O9B A;  1DTO A;  3G71 V;  4OX9 B;  4UB8 E;  4YJ2 A;  4MVO A;  1PD3 A;  4CS2 A;  3CCR V;  2IU0 A;  3BCC E;  3RFR A;  5LXT A;  4P9P A;  2OCC B;  2A06 G;  3QO7 A;  2Q8V A;  1VQN P;  4I5S A;  3DSQ A;  4UB8 Z;  3GVM A;  2ITA A;  3CI9 A;  4TWK A;  1BQZ A;  5AW4 B;  3BHP A;  3V6I A;  5JH7 A;  1WA8 A;  5KLV K;  1Y74 A;  4I1L A;  2R5D A;  1HNW O;  1VQL V;  3CCR P;  4WVZ A;  3RT3 C;  1FJG O;  4H13 D;  1QVG O;  1F7Y A;  3RL0 B;  4K35 A;  5IJ9 B;  1GMG A;  1GTW A;  4DRX A;  1DK1 A;  2QDO A;  5AW0 B;  1M57 D;  5AW5 B;  1PFI A;  5KAI H;  1LT9 B;  3RYC A;  2D2C B;  3M0A A;  3EQ2 A;  2HP8 A;  2PI4 A;  1DD3 A;  4DV7 B;  5FL7 G;  1IK9 A;  1NR7 A;  2XND G;  3SYO A;  1JY2 N;  1SQX G;  3SYP A;  2WT7 A;  1QVF O;  2XNX A;  2YXQ B;  1NU1 K;  1SVF A;  3R65 A;  2HOD B;  2UUB B;  3AE7 C;  3L74 D;  3N2G A;  1L8D A;  3JYC A;  1N7S D;  3B77 A;  4JTD B;  2C9N Y;  3ASN C;  3D70 A;  2OTL P;  4JYB A;  3ZDM A;  3JAM N;  4OPH A;  1G1J A;  5CA0 B;  1Q6U A;  3LNN A;  4B7K A;  3GWO A;  4LF4 B;  1L0N G;  1IFN A;  3ZCC A;  4EIJ A;  3TXS A;  1AVO A;  3B5N C;  2WSE H;  2OTJ P;  3T1Y O;  1NTZ E;  1HUC A;  1KIL E;  4QJF B;  5CCH A;  2B5U A;  2DW4 A;  1TVK A;  5L3F A;  4NPF X;  2FXP A;  2E75 C;  4IL6 X;  5J2T B;  1JM0 A;  2QJP B;  3ZHT A;  3K9A A;  1BSH A;  4HYT B;  4DV1 O;  3I5C A;  1AR4 A;  1OHH G;  3CJH B;  4JGS A;  1OCR C;  4PJ0 E;  1S5L H;  3H1H G;  3L75 G;  5IYZ A;  3FB6 C;  3AE3 C;  2HPC A;  2Q5Z A;  2XAQ A;  1SQB G;  1S9K E;  5IYC O;  3K5N A;  3A0B H;  5GON B;  4I0X A;  1K73 W;  4TSF G;  5BXZ A;  4RO2 A;  2XAG A;  1T2K C;  1AVM A;  2AZ2 A;  1R3J C;  2FYZ A;  1X4T A;  4PJ0 Z;  3H32 B;  4HBN A;  3M8A A;  2M5A A;  4C7R A;  3CX5 E;  5EYP A;  2EIN B;  5KLV H;  2QKS A;  3G6B A;  1IFP A;  1KIL A;  3SWF A;  2AHZ A;  3ZHQ A;  3AG7 A;  1NJI W;  3PH0 A;  3B8M A;  3CCQ V;  4U3F H;  4DR1 O;  3NTN A;  2POH A;  5LMU B;  2LXB A;  3GMA A;  3CC2 P;  3RN4 A;  1Q7Y Q;  1FXK C; 
#chains in the Genus database with same CATH homology
 3B4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...