3B4SA

Crystal structure of a luxt domain from vibrio parahaemolyticus rimd 2210633
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
ADGRIFKMFIEHLEFEKGLDAFSQSWIKALEDSEFLAILRLLFHHIVTSESAHEFAANGIDRLYKMVESQFGSGGDKELEWLIGRSLIQMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a LuxT domain from Vibrio parahaemolyticus RIMD 2210633.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Structural genomics, unknown function
molecule keywords Protein LuxT
total genus 30
structure length 92
sequence length 92
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18285 LuxT_C Tetracycline repressor LuxT C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.790 Mainly Alpha Orthogonal Bundle Helix Hairpins luxt domain from vibrio parahaemolyticus 3b4sA01
1.20.5.830 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces luxt domain from vibrio parahaemolyticus 3b4sA02
3B4SA
chains in the Genus database with same CATH superfamily
4RO0A 1Q81Q 3A2FA 3L71J 4I55A 4DO2A 4G28B 2E75C 5EZYA 1VF5D 1KP3A 1NU1E 5BY1A 1FAVA 3T97A 4KHPO 5CA0A 3K0DA 4ZHQB 4DR1B 3BHPA 3MHSC 3RK2B 1EDLA 1J2JB 1PGPA 3L75E 2CH7B 2PGGA 2YIDA 2WSCH 1HNZO 1S72P 1CSBA 1M56C 4JI8B 2QE7H 1FZEA 1FKAO 2Q5UA 1GKFA 5M1BA 2O01J 4LCUC 4CC5A 1T3JA 5A2QN 1UPGA 4E4EA 1TUBA 4DXWA 3CLQA 5L8RJ 4N21A 5CMUA 1ZP0C 2FYUK 4JI0O 1RFYA 4PD4D 5GTHE 3I55P 1FXHA 1LNQA 5AW5B 2AXTZ 5LHHA 2VS0A 5B1BC 1E5WA 5CCGA 3PTZA 1ZUQA 1AJYA 2YIUB 1NTKE 3HKBB 5CBGA 2OARA 3G6EP 5JCOA 2L6LA 1SRYA 5EYPA 3STZC 1OZHA 1R6TA 1VPCA 4X20A 4GX2A 3J80N 1M90W 3QO7A 1X79B 1DGSA 3H1HJ 4L8JA 1IURA 4MVOA 1LUWA 4CH5A 2P5OA 4I50A 1DK1A 1L0LJ 1SQBE 1W2EA 4FM0A 3K59A 4NB5A 1N33B 2RMZA 2ZIOA 1YI2P 2Q1KA 2QWPB 2X7RB 4DR4B 4O2BA 3SPJA 2KYVA 3VP8A 1SQPH 3AE1C 2R72A 2XTAA 3A0HE 2Y9ZA 3E8FA 3BVHA 3SWKA 4L74A 4J7JA 4RESB 5LMNO 3CC4P 1CI6B 2IYPA 3TCUA 2CGNA 2W83C 2UXCO 5B5EH 2ILMA 2YKQA 1S9KE 2WSSG 5LMUO 3LUTB 1RF0A 5H5NA 4D6TE 2QJPB 5AVYB 1ZV8A 3N7NA 2N1TB 2QM7A 3X2QC 2Z4EA 2C2AA 4G27B 4H13D 5AVXB 5BXZA 3P32A 3HE4A 3CXHD 2OYIB 1R3IC 4O4LB 1L4AB 2SPZA 1NU1H 3CCQP 4YXWH 2FFDB 4HJGH 1G8MA 1JM0A 1ZMEC 1R6KA 1OCRB 3T97B 1DH3A 1BSHA 2RMKB 3E7KA 3H1HH 4JPZB 3QWOC 4U3FH 1FXKC 3G4SP 2Q7EA 3L4FA 3JASA 1RM1C 4RWUA 1FXVA 3N2KB 2RCVA 3ABMB 3KCYA 1SLQA 4HNAA 1KC8Q 1E1QG 1SQVH 2Y0CA 3HE5B 4JQ0D 1WRGA 3OAKA 4Z1MH 4MTOA 2QEXP 1NWQA 3NTNA 3V2QA 4N6JA 5GTIZ 3ASOB 4DR2B 1EN6A 4JZGA 4BW5A 2Q9IA 4IFFA 2G38A 3VQWA 1V54B 3UT5A 5KLVD 3CCEP 1X0TA 3AE3C 1Z5WA 3B09A 2P2UA 3QG5A 2YKOA 5LBQA 1N34B 3N27A 2ZDIA 1FZCB 2XDJA 2YNYA 1XTCC 3M0DC 2C0WA 3F5TA 3ZRVA 1U7MA 1BE3J 3Q1MA 3ETDA 3AG2B 1KQFB 1QL2A 1PL5A 1XL4A 4PA7A 4I0XA 2R3CA 3F7YC 2FYUD 2QKCA 2HVJC 3CX5I 4YJ2A 4LF8B 1TU3F 2Z5HA 5JVDA 3IAYA 2RH0A 3OA7A 4O4HA 1LWUA 3CCJP 4ZNCA 2CTWA 5DJUB 1OXZA 3QH9A 4W7ZA 2DYRB 5JWPA 4CH6A 1L1FA 1K8AW 1AP5A 4E2LA 3AG3B 1CPYA 3Q4HA 4JYAO 2R3SA 3A0BE 3Q5SA 2E5YA 1JPXA 5E1AC 3JD3A 1H2KA 4UVBA 2XHBA 2KS1A 4U7OA 3BATA 3TXSA 1UJWB 1ZW0A 5L3BA 1JNMA 1IFJA 3OTOO 1L0NE 2CTRA 3B5NC 5IYZA 3JCUH 1PZQA 2GUVA 5L3CA 5B5EZ 5CBFA 3CHXA 1MZFA 3AG4C 4C7RA 4WBNB 2BEZF 2A06E 3L73E 5AVSB 2HLOA 3RW0A 2FXPA 4DV2B 2XNDG 4DUYB 1KC8W 4U7NA 1WA8A 3AG7A 1JCHA 3C90A 4DR4O 3CCVV 2YEVB 3VTPC 1ZX3A 2YXHA 3D6ZA 2Q7HA 1SQPD 3CWBE 1VQMV 5J2TA 1H2MA 1BS3A 2PRRA 2A0LA 5AW1B 1K9MQ 1Y76A 2CPBA 1M5IA 1HNXO 2A45H 5E79E 1QU7A 4KJMA 1VIBA 1QVGO 3CEIA 5EIBC 1FZCA 2BTQB 4DK1A 3F89A 2OTKE 4P2ZA 3CRQA 4ABMA 4X1IB 1S5LH 2HLDG 2DWEC 3H9VA 1HNWB 3HD7D 4GKKO 2W90A 2E75D 2YUAA 1N0JA 3S3XA 1RQVA 4IFDK 4BW9A 1M56D 2QRXA 3P3NA 4JASA 1K34A 4DR2O 1NU1D 3WUUA 1S1CX 3ZCCA 3CJHB 4DJGA 1Q3EA 5CCGD 1FS0G 5AW8B 2E3CA 4TV8A 4F6RB 2Q73A 1GW3A 3WG7C 4U3FD 1Q86W 1W0JG 1Q8IA 1YQ3C 2R44A 4RKUJ 3OW2U 1QVFO 4JI8O 4NTWA 1DF5A 4FLWA 4KHPB 1HGZA 4DR6B 1SQVD 1QNMA 4DR5B 2ZQMA 1NO4A 1JUNA 3ZRWB 2JEXA 1XMQB 4PD4E 5DECA 4KL1A 5ITZB 1GU4A 5LGNA 3B8MA 1AI5A 4HAMA 5KLVH 4RJTA 1NTZE 2NPSA 4WY4B 4PDLA 2Z5UA 4DRXB 1NJIW 3M7MX 2V7QG 1PD3A 2R32A 2YO2A 4DUZB 2UUBB 3FB5C 2YMKA 2JGUA 1ENVA 4RUEA 3A8TA 2ITAA 4TLFA 2IPPA 2N9BA 1RH5B 2V4HA 3L71D 2XV5A 1IBKB 3ZRWA 1S5JA 2ZT9B 3JALB 5GTIE 2DYSC 4B3MO 1JY2N 2FYUH 2W0FC 1OIPA 1NR1A 4OWFA 2PZSA 3L35A 3CX5F 1QBZA 3SPCA 1GDTA 5KAIH 2UUCB 2BSKB 3AE4C 5A9GA 2EIJC 2ZINA 4O4HB 4WFAV 1AR5A 3G6BA 1KQLA 2LR2A 2LXCB 2IH3C 1SQQJ 3D36C 4EYYQ 3R65A 4H13B 4DV1O 2JVDA 4WY4C 1KD1Q 1W59A 4X20B 3AEDC 1D5NA 1SQGA 1QHTA 3E2EA 4DR3O 2IBZE 5K1PA 1NU1J 4IYIA 5AVVB 1S5LE 2ADPA 3FD9A 4B7EA 1JY3P 4RQFA 3LSQA 3E8BA 2LW1A 1YJWV 1I08A 3IGAC 4A7PA 3V4QA 1UIIA 2F4VB 1G1IA 2I1KA 2DYSB 3GF7A 2UXBO 5DN6G 3EFGA 1VQ5P 3AEEC 1QEXA 1KILA 1QCEA 4TUYB 2RJZA 5B3SC 1TUBB 1VQ7V 2KSEA 1BGYG 3L72J 3LW5J 3RL0g 1VQLP 3J7AU 4GOFA 1DEEG 3V2PA 5APYA 1B04A 4EKWA 3H1IH 1AVMA 5H6RA 5H6QA 1MZ9A 1T6AA 3ABUA 2FYNB 3GHGB 2EIJB 4Z1VA 4TSFG 1MUUA 1JJ2U 2IDBA 3OW2O 2E43A 1ZLLA 1R6NA 3MUDA 5BMVB 2H88C 3A3YB 2VWJA 5CA0B 4YY3B 2W8ZA 5AVTB 3VQYA 3ZHTA 3FB8C 1OHHG 3ZN0A 3AG2C 1SFCA 3KQGA 1X4TA 3H1JD 1VQ7P 1KN7A 2GA1A 1MOFA 4L76A 4C7NA 2BCCJ 3ZHRA 4MW3A 5EBLC 1Y74A 4GUNA 3OAAG 1Q82W 4CS4A 5APTA 3JD2A 1I5YA 2EIMB 3ZMTA 3T1CA 2P6JA 3BPZA 1NU1G 5CBOA 5K5GB 5LOVB 3RYFB 2ZXXA 1I0HA 5J2UB 2UUBO 4EB6B 3TSIA 1FYJA 1R5LA 1OX3A 4L73A 4JI4O 1NTME 2GDSA 3FX7A 2ZNIA 3A0BH 1S5LZ 1H8AA 5JJJB 2NRGA 3F5HA 2HPCB 2GV9A 3CD6P 2ZE6A 2QTOA 4LFAO 2IU0A 2N9YB 5JJNB 3HD7A 2QJPC 3GVMA 3D3IA 5AVQB 1NS1A 1N7LA 1SQBD 2KLUA 3K03A 4DV2O 1V55C 1GO3F 4GZRB 4JI6B 2IBZG 4PA3A 1ZN5A 3CL3D 2EIMC 2V7QJ 3L71H 1NAFA 1EFRG 1NGMB 2DQ3A 3O8ZA 3RBXA 4WB4A 1SA0B 1Y66A 2JEEA 1YZBA 1ZL8B 1OVUA 5KJ7C 1VQPP 1O9HA 5FPRA 1KFNA 4B3SO 1Q6HA 1Q6UA 4JYAB 3ZX6A 4KT0J 3HUSA 5LYJB 4I4TB 3VMXA 2IJIA 4UVAA 1OV9A 3MUDC 3SYPA 3RGBA 2QG4A 5LXTB 3ABVC 1N86A 1PNMA 4ZMDA 1K33A 1Q82Q 3IJ4A 1JOYA 3JCUE 2A79B 4ASWA 1D5AA 2ZYAA 2ZYGA 4U3FJ 1IBLB 1KUQA 5KUKA 1J5EB 4DV6O 1IVSA 2GTAA 1N2DC 1KILC 3ZDMA 1CW5A 2I8DA 3UQ8A 2XAJA 3UO3A 4DYLA 5B3SB 4X64O 1FBMA 5KKZB 2J5UA 2QA4P 5GTIH 2P06A 1XMOB 1FZBA 1Y47A 1S0VA 1JFFB 1NHLA 5DJTB 1VF7A 1GN4A 1USEA 2K9JB 2MK3A 4X62B 2FXOA 3C3TA 1QLNA 2E5TA 1Z2GA 3H1LJ 2Q0AA 3H1ID 4WY4A 1RE3A 1MMMA 5L3GA 4U3FE 1URFA 1R3JC 1N0NA 1S3JA 2P67A 1GN3A 1SQPG 5FPOA 1LUVA 1TGOA 1WPBA 1XTGB 1F4NA 4DV4B 2YKPA 3BVOA 4PV1B 1SETA 2XAGA 3H32B 1MABG 3JSVC 1ZR2A 3SJAC 5KX5B 1VQMP 1L0LG 4JF7A 4J7ZA 4TQDA 2PFXA 2BCCE 2GHYA 1AI6A 3PRJA 1YQ4C 2Q0OC 5AW4B 3OE7G 3CCVP 4DV7B 1VP7A 3H1JH 1DTOA 3BABA 3LDEA 2Q67A 1KZUB 1NTMK 1PPJD 2OYIC 1SQXK 3B2EE 3M8AA 3K57A 2O57A 1XDCA 4UV9A 3W7XA 3AG1B 2K9YA 3PLNA 3NR7A 1OZ0A 4IHJA 1LP1B 2WZ7A 3P8CD 3T4ZA 2F1MA 1VF5B 1FJKA 1WPXA 2JJ1G 3OEEG 1OCZC 2IJHA 3BRCA 1SQXE 5LL6Y 3T1YO 1N34O 2GBOA 3IFXA 1OMIA 3CCMV 2MJZA 2B87B 4D7TA 2G8YA 3N4XA 1PM9A 3ABMC 2K9JA 3E1IA 3CSXA 2Y9YA 4B86A 2W6AA 2Y0DA 1VARA 2OTLP 4UCUA 1N7SB 4O4LA 2ZD9A 3RBZA 3NMDA 2W27A 3ZHVA 3K5NA 2HJDA 1Q5OA 3SJBC 2Z3YA 3RL0B 2UXDO 1GL2D 4QPKA 5APQA 3QO8A 3CXCU 2AEJA 2ZIMA 3ETGA 1Y74B 1BE3G 4X1YB 1SS1A 4MTFA 1Y4MA 4B7KA 1SQBH 1GL2B 2YEVA 5KTBA 3KZIH 1SQVK 5AVUB 4I6MC 3TYYA 3H1JG 2QWNB 4YJ2B 4N78E 5IT9N 5BVZA 3BAAA 3LW5H 3TGUG 3P3PA 2D2CD 1BQZA 3AE7C 4FZ1A 2JR8A 2UWJE 3BA9A 2F43G 4O4JA 1NYHA 1ZTEA 1W5CE 4DK0A 1OW8A 1JR9A 1S76D 1XBLA 1GW4A 1BMFG 3WUTA 2N1TC 2AZ0A 4JI4B 4X65B 1O9GA 1WJZA 1OW7A 2QGNA 1NH4A 4OGQB 3H6PA 5LXTA 4NPFX 3GF3A 3G4SV 1SQVJ 3RVYA 4KP4A 4O2AA 2ZVNB 3ZS8C 3M9QA 1YJNV 1LWUB 4R7CA 2DMXA 1G4YB 1X9VA 5KHKA 2NPSD 5E79Z 3A7OA 3JSNA 1NH2B 3TNUA 2EULA 2WSFJ 5D5PA 4NXNB 1VQ6P 4U7JA 2KNCA 5BR8O 2ZAEB 2EZPA 2PAJA 1FXKB 4GX5A 5KJ7D 4LF7O 3M99B 4WFFA 1K5QA 2FB5A 1EZVI 1PP9D 1RP3B 2N04A 1K97A 3L75G 2A7WA 4X88A 4FLUA 1NKDA 4I5SA 2O3JA 3MTUE 1AP6A 3F7VC 3R66A 1I94O 2KSDA 2YXRB 4K0KB 4OGQC 1PGQA 5C8YB 1KYOE 4DOJA 2EIKB 2PTMA 3TETA 4GDOA 2OYIA 5JQGA 1JQ0A 2FKWB 2UUCO 1WB7A 2Y0IA 4ICGA 2XKMA 1LWUC 3HE5A 1IFMA 4LFCO 4GCZA 1K92A 4BR6A 3T4DA 2QJYC 4OX9B 1GM7A 5IWAB 3VQVA 3HKEB 3CRCA 1CEZA 1JEKA 1PPJH 4DV5B 3L72D 3SDLA 5KA5A 2F66C 4I2LC 3DC6A 1VQ5V 3RYFA 4J80A 1NVPD 4FMTA 3SJCC 3CCLV 1DEBA 2R9AA 1FZAA 2UUAB 2XAQA 3C3SA 1K8AQ 2ZE5A 1WN7A 3G6EV 1NTZJ 1YTZT 4PDVA 2KUBA 2WT7B 5KLVE 1Y9BA 3G9RA 2KSJA 1GU5A 3TF5A 3LIDA 4DV3O 4LF7B 4X8AA 1NQTA 2FYNC 3ZN1A 4W4KA 1JCDA 1V9PA 2ZE7A 4OXSA 3CE2A 3U1AA 3D70A 3I55V 1LTIC 2QDOA 3A0BZ 4NTYA 2F23A 4JI1O 4RO2A 4TUYA 1ZRTD 4F6RA 1NTZD 2POHA 2BCCH 2QWRB 3ZMZA 4QMAA 1NKZB 1M1KW 5LGTA 1IK9A 1ZL8A 2OIEA 2J59M 4JAAA 1LTSC 2IYOA 1U57A 1M57C 3KPEA 5APVA 4O2BB 5B66E 1GH6A 1XL6A 1M1KQ 2YO3A 2OYHB 4DR5O 1KQSO 1AR1B 4JI7B 5KAFE 3M06A 4CBCA 2CE4A 4X1IA 3L71G 1Y8AA 3VQXA 1SQBJ 3MDSA 3UT5B 1Q81W 2YIBA 1BCCG 3JSLA 2HVKC 1OCOB 2FYUG 3Q3DA 1ZXGA 1NVOA 1VQ9P 2LKMA 3LDCA 2QM8A 4ZIBA 4W80A 3L37A 1H8HG 2ZM6B 3ABLC 4KXRA 5KHIA 4C7NB 1NTMG 3KZIZ 2IU3A 2V4DA 4FLYA 3WU2H 2LW7A 2VQFO 2JO1A 3WU2Z 4FLVA 1GM8A 3D3QA 3FXDA 3LIEA 1M57B 2QIWA 1GTOA 4ZKIA 4NXMB 2M8RA 3FWNA 4KHXA 5BMVA 4TT3G 1AQTA 1PPJE 3W67A 3E22A 3JAKB 1HNZB 3DXRB 1DF4A 4GODA 1A02F 3P7KA 1DIPA 4ZI7B 2OGUA 3AG3C 1PP9H 3FAVB 1J1DB 2HHHO 4J10A 5K1XA 3K5MA 1L4AD 1GN2A 5JJEB 4FFBA 1R1BA 1QLEB 2V1DA 2PYLA 1SF9A 4I4TA 1FDOA 1USDA 1RE3C 5KX5A 1B3QA 2AEFA 1GN6A 1GL2C 5CJ4A 3WB0A 3K5OA 3SPIA 1VQ8V 1HTLC 1ROPA 2WLIA 3CC7V 4I0XB 1KYOD 4LF5O 2Q8VA 5J9PC 4LH6A 3I56V 1IXBA 2WLJA 3APQA 1S5LX 3VMYA 5B1AC 2WLLB 3L72H 3RYIA 5LMNB 2F95B 5CA1B 4FJCC 1IBMO 2WPVB 1SQVE 1KB9I 2KI7B 3GLMA 4OPHA 1SC5B 2FKXA 4HBNA 3DTUB 1SZTA 2CUGA 3PJSK 2X6BA 3WB2A 2UU9B 1VQ6V 5KAFH 3O65A 2D2CC 1NTZK 3RK3C 2M3EA 1MFTA 2Q69A 3II6A 5IDJA 3F5WC 1BHAA 1QLEC 4L75A 2AHYA 3OMIB 5EBMC 2IFMA 1K4DC 3K9AA 1YJNP 3HUSC 2E76B 1JMKC 3CRRA 4Y99C 3CI9A 3JAWA 4LF8O 1SQQD 1BZKA 2JKVA 3VMAA 5KJ7A 1JO5A 4X1KA 1FZGA 3THOA 1NTZH 1NTMJ 3CCJV 3APOA 1U7JA 3GG2A 2H94A 1GL2A 1F7YA 4K8ZA 4Z2WA 2BCCD 4U3FG 3K08A 4X1YA 3L70E 3CC2P 5KLVK 5B1AB 3RK2D 3PHLA 2CPSA 3RT3C 1IBKO 4H37A 1ZSPA 4XDKA 3AEIA 1YBKA 1PV0A 2JS3A 3H1KE 1FU1A 5KLIC 1P49A 2R5DA 2EILC 1R8EA 3MAQA 2DOSA 3A2AA 1YIJV 3CXHI 3A0HH 4EFEA 5JH7B 2P90A 4GKJO 4XFJA 1BCCD 2WSEJ 1M9NA 4DV1B 1K4CC 4MN4C 2Q68A 3CX5E 3T1YB 3EWKA 3ASNC 1GK9A 4D6TJ 1GAXA 4YJ3B 5AW6B 4DR3B 4CC6A 3Q5PA 2Y4UA 1MA1A 2BEQD 3JCZA 5CJ0A 2OTLV 3SYOA 1AJNA 2IJKA 3MGNA 4X89A 3KYQA 3O9OA 1E79H 1FDIA 2HPCA 2IM9A 1N8RQ 4FFBB 2RQ6A 4HKZH 2JDIH 2M5AA 1QVFU 2UXXA 3G67A 1HH0A 2ATKC 3BRVB 1EDJA 3NFQA 4TV8B 3P8CE 1W2BU 4GKGA 2ZR2A 4TV9B 2ITCC 4UCRA 3FYEB 3CCMP 1N36B 4LNUA 2EILB 3OGIB 5E79H 2W6IG 1SFCD 3CCQV 4K3AA 4JAUA 5D5QA 4CH3A 3OR7C 1FC2C 2YC0A 3CPWO 1YHQP 3A5TA 4AUWA 5KMGA 3V2RA 2BOCC 2NZ2A 4Q6GA 2WVRA 3AE9C 5LGUA 2H8PD 2KKWA 1IZNB 2WAMA 1L0NK 4WFGA 2WSCJ 1KB9F 2P10A 2RDCA 2JEUA 1H0TA 1LT9A 5EK0A 2BOBC 2WLKA 3L75D 1Q2NA 1K9MW 3WB1A 1GZLA 1JCCA 2H43A 4DRXA 2JGDB 3CC7P 4ZOLA 3AE8C 1VQ8P 3GWOA 4YXDC 1QVGU 1N33O 3CMAP 1EN4A 1LT1A 1KYOH 1R5SA 3M9HA 1K3EA 5H9CA 2HP8A 4DV7O 2KS1B 3OGCC 4YPCA 2LFSA 2Y69C 1LTAC 1P84E 3L74E 1AJQA 1LTTC 2VWKA 1SZXA 4KFMA 1XNRO 3AEAC 2B9BA 1Y67A 3OT7A 1SQXD 1URQD 4UB8E 2QWOB 2NPSB 3WFVA 4JI0B 1LTJC 1H88A 3LNMB 1EZVG 4RAIA 4OH8B 3D36A 2OYOA 3BFRA 2OWOA 3HD7B 5KHGA 4WY4D 4JI5O 3TNUB 2HEPA 4CH4A 3T1HO 1KV4A 3Q4HB 1HW7A 2ZM6O 4H0LC 3B5NA 1PGJA 1GMJA 4WBAA 4JI1B 1SQQH 1UIXA 3ABKB 1NH2D 4QGPA 3K04A 1LTBC 2XZRA 3MIWA 1JVMA 1H2GA 3UM7A 1KD1W 2FFDC 2DW4A 2WPRA 3WMM0 1FFXB 2B1GA 5EYPB 2HKOA 4PJ0E 1LR1A 4JI3B 2ZFCA 3V4WA 4C7UA 4OGQD 3L36A 1NVPB 4CPGA 4FLXA 2NLJC 3ML0A 4D6TG 2ZE8A 1BCCJ 2NPSC 3OJAB 2CDYA 1SQBG 1NBMG 4LFAB 1A32A 2DE0X 4LFBO 4XDLA 5GONB 1XNRB 5B66H 3L73J 1XREA 3EFFK 5L3EA 5B66Z 3OUFA 3FGAD 1AJPA 1SFCB 3W7TA 2AZ2A 3H1IJ 2YIUC 5LP6B 1BCCH 3TGUH 2ZDIC 4JI6O 2AEMA 1X59A 2P4KA 1Q90D 4RQEA 2M7WA 3C8VA 1YTFB 4MS2A 2ZNJA 1HNXB 1W0KG 4LFBB 3S3WA 4FIPC 2KP8A 3BEHA 1JTHB 3CD6V 3L72E 4DW0A 1L0NG 2A9HA 4I9QA 2N1TA 4ZOLB 4DV0B 3A0HZ 3UCSC 4PD4F 4KUMA 4NTXA 1PPJG 1JY2P 4I7ZC 4C46A 2Q6AA 1OCZB 1LTGC 5FNVB 1SQBK 4MSWC 2VQEB 1VQKV 1PP9E 3K5LA 4BIZA 3FB7C 3BCCG 3HE4B 3CP1A 4OPAA 2IW5A 2IH1C 5LHIA 5KMGB 1KFMA 3TDKA 3CCLP 2W6JH 3GB7C 3Q2YA 1YEWA 2YS8A 4D6TH 3KXDA 2R70A 5AVWB 3HKCB 3EXAA 4JYBA 2W6BA 4DV4O 2EZOA 3VBBA 1NTKG 3L74J 1I94B 1D7MA 5DEDA 2V7QH 2FY8A 3L75H 5AVZB 2KB1A 3GWKC 5CA1A 2IBZD 1N32O 1JMMA 4WCEV 4DUZO 3U10A 1Q7YQ 1L0LK 2L91A 4YIOA 4JTAB 1J95A 2FYUE 1FOSE 1MKMA 1M56B 1P7GA 3CJHA 1JY3N 2BCCG 2OCCC 3H1HE 4NVPA 2EJ7A 3SGIA 2C0XA 3AG4B 4CS3A 1HUCA 3TK1A 2QTSA 3NXSA 4J9ZB 2E76D 2XNXA 2QE7G 1IO4A 1OCCC 2ZT9C 1BQ0A 1IXMA 3RWRD 1VQLV 2ODMA 1OFCX 4AYCA 5H2FH 1ORQC 4UV8A 3H1LE 1SQXH 1XNQB 3FKSG 1AB3A 5APUA 4MVRA 1KP2A 1XHZA 3ZIAG 1EXIA 5EIBD 5KLIB 5F2VO 1YJWP 5KAFZ 1EZVD 4FM2A 1YVWA 4UB6Z 4JYCA 1IJDB 2N1TD 4ZI7A 4EIJA 1HR0O 3B5ND 4TQFA 1P4RA 4DR7B 3E22B 3JAKA 4EEQA 3L70H 3IC7A 1BCCE 1T3UA 5APSA 1L0NJ 5AW3B 2WPDG 5JCOC 2YI9A 3CX5D 1YITP 2FTKA 1EDKA 1K7DA 4YHHO 5CCGC 2YMYA 1DX7A 1T2KD 3JAWB 3OTFA 1N36O 1KILE 2IFNA 3R2PA 5LYJA 3RK3D 1IFPA 3H1KG 1COWG 5BU8B 1NJIQ 2E42A 3H1IG 1XILA 1F4MA 1QLED 2NN4A 1WP7A 5BZBA 4O4IA 2AXCA 2A3QA 2DYRC 4EFBA 1LP1A 4PELA 2NR5A 2A06G 2WSEH 3L73G 3DC5A 4ZHQA 4HH2A 3UO2A 1KB9H 1K73W 3W7WA 1VF6A 3M0AA 4AILC 1N73B 2KG7B 1HP8A 1M4UA 2UXDB 2H89C 4TOIA 5FLXN 1ZLZA 3U59A 4H0LD 3PN1A 2IJJA 4PA9A 4X9QA 5JVDB 3UKMA 2Q3EA 1N32B 2BTQA 3TGUD 2LJ2A 5B5EE 2E76C 1SQQE 3JYCA 4TWKA 1VL2A 2FL4A 3AEFC 4R6ZA 3L70J 1CP9A 1UFIA 2KNCB 3AECC 3EQ2A 2KXPB 2BE3A 1FFXA 4LR3A 4LNUB 1BHBA 2KZJA 1E79G 3RYHA 4PHZA 2C9LY 1NTMH 3I5DA 1RPRA 2K88A 4F6EA 3IR9A 4MVQA 1PKXA 2XAFA 1BSNA 2BASA 3M9BA 3VYIA 4BWAA 4MVUA 2RN0A 4FK5C 4IFMA 3K9SA 4XBFA 4IGGA 1SQXJ 1HF9A 4L87A 5KAIE 2M6YA 1T8ZA 2GSMB 2ADQB 1S9KD 1Y76B 3STLC 1JB0J 1RF0C 4TT3H 1H2NA 1PNKA 1PV3A 5EC2C 4QJFB 3MP7B 1AFOA 4D6TD 3KKYA 1LTJB 1AI7A 5B1OA 4MTXA 1EXJA 3CCUV 1BE3D 1H8EG 1S4XA 1JX9A 1AVYA 3HD7C 3V6IA 1EQ7A 2IBZH 2AHZA 3L72G 1OVRA 3MD0A 5DM6V 4X1KB 2D3OW 5L3DA 1Y6XA 1GD2E 1RF1A 4QNHB 2H3OA 5KLVJ 2WLHA 1WLEA 3L74H 1D2DA 1AA0A 1P84H 2YI8A 5B1NA 5TISE 3HTKA 4UB8Z 3SPGA 4DR6O 4JF3A 4U3JA 1SQPJ 3CMEP 1DD3A 1SQFA 2AGAA 4UFZA 3V5BA 2RN9A 1U97A 1CZQA 3AG1C 2GTSA 1SESA 1Z5VA 1YXBA 1L0LH 2EBOA 1FPOA 1LJ2A 1ZRTE 3CCRV 5AVRB 2M0BA 2UU9O 4BRYA 5GONA 2QA4V 4IOIH 4PI2A 3RL0C 3D8CA 1EZVH 2K1EA 4WWIA 1EBOA 4JI2B 4DV5O 4Y99B 1G1XB 5CBNA 4LBEC 1SFCC 4YJ3A 1NZ6A 3W7UA 3L70D 1K05A 3P30A 4G2KA 2P7JA 4Y28J 3KZIE 1Q43A 1QQCA 1RE4A 4B08A 4IIJB 3CX5H 4J42A 3X2QB 2QSIA 4PDMA 1SQQG 3WUVA 4JPRA 3ZJZA 2QM4A 4B3TO 3JAMN 4IL6H 4DV3B 4UB6E 1IFIA 4IL6Z 1THZA 1YJ9V 2GM4A 3O6QA 1J1DC 1VQPV 1I5XA 2ZKOA 3ABTA 4LF9O 2O01N 1KILD 4FM1A 2KIKA 5HFLA 5KHJA 3KDPB 2QR4A 4O4IB 3HKDA 2HG5D 1X22A 3ZBHA 1KB9D 1KTMA 4LWSA 4IYHA 1MG1A 4X66O 4PDRA 2R9RB 2YXLA 2Y48A 1WMKA 4DUYO 3K5BA 1Q86Q 1XEQA 5IYBO 2QKAA 3LDDA 2VQEO 4X64B 2KQXA 3RFRA 3OD4A 4WBNA 4JZ2A 1PGOA 2WSSH 3ASNB 3CCEV 3K79A 1S5HC 4K35A 3S1KA 3HKEA 3W7SA 5IYZB 1H0TB 4GX0A 5IJ9A 2Y0EA 1L4AA 4MW8A 4X66B 1V55B 4R4LA 1YDXA 1AVOA 2OYHC 1KMIZ 1JJOA 3H1JE 4K0KO 1ZR4A 2HR3A 3SPHA 1NTMD 1YF2A 5C8YA 1S77D 2LO1A 1VQNV 4N78D 2YICA 3JD4A 1VQOP 3K0GA 3E86A 2MW2B 1SERA 1VEWA 4UCTA 2EIKC 2WA3A 3OUSA 1LT9B 1MNGA 3VOUA 4NPDA 3N2GB 2EJRA 3QTCA 3A0RA 1OJHA 2D2CB 1BDDA 1SQQK 2J58A 3Q5RA 2DN9A 3ZHQA 4M3LA 3CCRP 2OYQA 4EI2A 1NU1K 3USSA 4LWSB 1WP8A 2Y4TA 1FOSF 4B3RO 4HYOA 2A45G 3GHGA 5LP6C 1HVVA 1BE3H 1EZVE 3CRAA 3CMEV 3PH0A 2XASA 5KLVG 4AQRD 1FJPA 4BRYB 1NTKD 1KKDA 4WF9V 1GRJA 2K1AA 3SJQC 1QR9A 2YIBD 5JH7A 4B3TB 1KYOI 1L8DA 1X8YA 1MZEA 4LGDE 3AK2A 1YTFD 2Q6QA 1P84D 3L74D 2WWWA 2A45I 1LGHB 1N7SD 2RNBA 1EZJA 3I5CA 4IIJA 3H1LH 3L75J 3KG2A 3C1LA 4R8CA 3FB6C 4ASUG 2P7TC 2YIAA 3E8HA 1IC2A 3CCUP 2UXBB 2KK7A 4NPEA 3SFDC 4LC1A 1RM1B 3HPLC 4DR7O 2AW9A 3D6YA 3CWBJ 1L0LD 1PL0A 5CB4A 1RQUA 4ASVA 4WFHA 2LP7A 3FWLA 1VMGA 1G1JA 1SQXG 3IFMA 4JYYA 3B8NA 5HFMA 2WLNA 5B1BB 3G80A 2UXNA 1SVFA 4PJ0Z 2LXBA 2F93B 4JI2O 1QR8A 2QVAA 2FMLA 4R50A 2H7HA 1A02J 4UUJC 1JTHA 4GT1A 1BL8A 5C39A 2WT7A 4AHCA 3H1KD 1T5EA 1DLBA 2WSFH 2E74B 2HODA 4B3RB 2UUAO 1RY3A 5EC1C 2O1JA 2ZJSE 2OIGA 3WG7B 3HB3B 1KORA 3L70G 3T2MA 1FZCC 1W2BO 5JQGB 2X0LA 5BR8B 1H89A 5CCHD 1L2PA 1QGKB 3K06A 2OCCB 3AE2C 2DW3A 2XAHA 4HYTB 4PD4I 2WLMA 4UXNA 1KBHA 5TJHA 4PV1D 1H2SB 1PFIA 3FYIB 1HJ0A 4DZOA 1HWYA 1CI6A 3ZMSA 1GMGA 3B8EB 4X62O 2KOGA 2WPQA 1BGYD 4MVMA 4DW1A 5CB4B 1Z56A 1RPOA 3FFQA 1S72V 1URQB 1YSCA 2F4VO 1GTWA 2DWDC 2E75B 1B6QA 1H38A 5IYCO 2Q5ZA 3HKDB 1AV1A 4I1LA 2Q3IA 3QNEA 1TA8A 1IX9A 3JATB 4J9YB 1SP4A 2LGQA 4NYKA 4JTDB 4J7KA 1KYOF 1XMOO 1F23A 1N7SC 4LF4B 1HDJA 1GK6A 4LF6B 2KG7A 4FLZA 3FX0A 3CCSP 1IFNA 2E5LO 5TISH 2QJYB 1F51A 4UCSA 3K3WA 4FLTA 3FAVA 1BDCA 1RF1C 3W68A 3JD1A 3V2NA 1YITV 2I1JA 5KHHA 1NI8A 1AI4A 5CHXA 2EX3A 2W6JG 2IBZI 5IWAO 5FNVA 2DJVA 1WA8B 1URQC 2YXYA 1HBWA 1KECA 2ZXEB 1WT6A 3RL0D 3QO5A 4LFCB 3VN0A 3ZMUA 2IX7C 3IN6A 1NTZG 1FDMA 2KB7P 3ASOC 4OX9O 2O01H 4B3MB 2K9PA 1R3KC 2VQFB 3M0DA 3MHHC 4EB6A 1MFZA 1NTKK 3JARB 5BU5A 4JAVA 4H0LB 4ZKUA 4MVSA 5IJ0B 3CYOA 5CCHC 4O4JB 1QX8A 1XOUA 1SKVA 1XNQO 4H13C 1JY3O 1GK4A 4ZKPA 3SR2C 1Q6IA 2CK3H 2CAZC 2ZYDA 1ZAUA 1NTKH 2ZVOB 3L9DA 3VP9A 3GMAA 1PP9G 2HJFC 1VF5C 4UVCA 2AXTE 4H44C 1I7FA 5LA6A 1IFDA 3SYQA 1R3LC 4P9OA 2GUZB 3RK3B 4ZBMA 2WA4A 1NTKJ 2B87A 1RHZB 2LQTA 3L74G 3U1CA 1CXZB 3H1LD 2HYNA 4UB8H 1FXKA 3KHUA 5LMUB 1YTZI 2HFED 3ZRXA 5AW2B 4J11A 1WNSA 2JIZG 1PNLA 4JGSA 2P1JA 2XU6A 2B89A 4FZ0A 4YXWG 3T1HB 1VF6C 3AEBC 4I50B 5IY5C 1EC5A 2C9NY 2JDIG 1OW6A 2QJKB 2P22C 1Q7YW 1KB9E 1VQKP 3H1HG 1R73A 3RN4A 3ZEDA 1M1JB 1VQOV 3E89A 1VQNP 2JK5C 1DD4A 2DQ0A 2E5LB 3H1KH 3B40A 1FZFA 4XE5B 3RYHB 1YCIA 2Y69B 2Z0AA 3H01A 1SA0A 1SQPK 1SQVG 1SS3A 4R4MA 4YIPA 3RK3E 1AQ5A 3JASB 3E83A 1URQA 2G3AA 3CWBH 1HWTC 4LF4O 1M1JA 4LP8A 2R9IA 4GOEA 3OEHG 5IYDO 2CTPA 4JI5B 2N05A 2XT9A 1IBLO 2YDEA 2WQYC 2LFRA 4J41A 2K37A 3LSSA 1BGYH 4BWNA 3J81N 2FYUJ 3HRNA 1HJBA 5IY5B 5CA3A 1N73C 2JRIA 3H32A 1V54C 5GW7A 4F4LA 2QJKC 3TGUJ 1N73A 1OWAA 3DXRA 3CPWU 3HKCA 1KQGB 4RUFA 2YSUB 4GKKB 1BGYE 2KLVA 2JP3A 2IZ1A 1EN5A 4LLHA 4W7YA 2W0XA 1M1JC 4EOTA 1FAFA 3CXHE 2GUZA 3JCUZ 3ITKA 1VQ4V 4GIFA 5KUMA 1YJ9P 1HNWO 1KQSU 3LNNA 1E1RG 4O9BA 4I55B 4WFBV 1JFFA 2FBWC 2O1KA 5GTHH 2KZIA 4QPJA 4CS2A 1EDIA 2Q7CA 3BA8A 1J1EB 3UIAA 2QEXV 1FFTB 1OCCB 2P4VA 2QWQB 1JA8A 2X6AA 2P58A 2QSAA 4MT8A 4Z1MG 5IE9A 2PI5A 4AQYB 4Q20A 2EINC 4JTCB 4IHJB 1G2CB 3H1KJ 1NKNA 1OCOC 3RGUA 1GM9A 3CWBG 4XDJA 1FE6A 2B5UA 4O2AB 2JWDA 3B5NB 3P8MC 4IL6X 1N4CA 2M3BA 4UCOA 1HR0B 5LHGA 1M93A 3HUSB 3SWFA 4P9PA 3HKBA 4B3SB 2HFEC 5AG2A 1FD9A 3CS5A 1U96A 3JATA 1M57D 3S4RA 4NXMO 1OCRC 3AE5C 3G71P 2YXQB 2N74A 2CTQA 2WMMA 3IF4A 3SFEC 2A06D 4WFEA 3L73D 2Q4PA 3JC22 3TJTA 4JI3O 4YTPC 3ZHUA 2HG5C 2WPSA 3VOPA 3AE6C 3ETQA 3CMAV 1T2KC 2K3RA 4N23A 5APXA 3SYAA 2WTYA 2JJ2G 1NOHA 3CC4V 2XNDH 1IZ3A 2XOKG 5CCHA 2ETNA 3CRMA 1MSDA 4P30A 4DV6B 3BRTB 3FXEA 5H2FE 4PV1C 3BY6A 2E74D 4GKJB 1HGVA 2MKVA 1BGYJ 1VDFA 3H1LG 3H25A 1BSMA 1PL4A 3BASA 3R4YA 4JV5B 1AR4A 3EHBB 1YI2V 4QE7A 3ABKC 3G71V 2FYZA 1PP9J 1P84I 4PA4A 3BCCJ 3DSQA 5J2TB 3HTKB 2JGDA 3N2KA 1WAZA 1WB8A 2PY5A 1YHQV 5FL7G 5IJ9B 3JARA 1L0ND 4IL6E 3B77A 5LA6B 5EBWC 4FFKA 4LF9B 2XUMA 3PP5A 1NAYA 4UCVA 4PJ0H 3BCCE 4FPPA 2PP6A 2NNUA 3D71A 2GUSA 4YHHB 1XMQO 1IBMB 5CN0A 2Y0PA 2PYJA 2VRZA 2H8PC 2ZXWC 2UXCB 4X65O 2FFDA 3BCCH 1IK7A 5ITZA 4JBZA 1P84F 2PUSA 3G3ZA 4W4LA 1N7SA 2CH7A 3ZHSA 1SQPE 3CWBD 4PI0A 4AQYO 4MVZA 3OFNG 4I9WA 1FJGO 2JS5A 3O6QB 4GLXA 4BAYA 3TGUE 5AW0B 3SSUA 3RYIB 5GTHZ 1L0LE 5EZYB 2OQQA 4QE9A 4BXLA 2OYHA 1VQ4P 4LF6O 4DV0O 1L4AC 3ABLB 5CMZA 1YIJP 5AW7B 4HZ3A 4DT0A 1XI1A 1LTJA 4DCKA 2WLIB 1JOCA 5CBHA 1YYCA 3WU2E 3E35A 1FJGB 4H44B 4WVZA 1KKCA 3ZRSA 3ZMVA 3E8GA 1XQ8A 2ZXWB 2L5GB 1K5SA 4H44D 5H2FZ 3OM3B 4GX1A 3ETEA 2E74C 3L71E 3CC2V 5APWA 2BTOA 2OTJV 3OMNB 3SYCA 1JY2O 2FXMA 2ZT9D 4AI8A 5TISZ 2X6CA 1K73Q 1AILA 1RSOB 2OT5A 4QIWF 3SWYA 4BIOA 1M8OB 2EINB 4UB6H 3ICXA 3IC9A 2Q9LA 2CGOA 4PD4H 3GW6A 4BIUA 1BE3E 1S2EA 3HR0A 1TUEB 1TVKA 1LT9C 3C9IA 1JMBA 2HODB 4HNAB 3DGEA 3RVZA 3CXHF 1J5EO 2JWAA 1RE4C 3RYCA 3B71A 2ZR3A 1IDSA 4FVMA 4GYCB 2R5BA 1M7LA 1FS0E 4H33A 4OVNF 5LOVA 3OTOB 4DR1O 1ZWIC 3EVKA 3JD0A 2AXTH 2A06H 3L73H 3I56P 5IJ0A 4K8XA 1XUQA 3K58A 1K04A 2CK3G 3IAOA 1RSOA 3OMAB 1H2LA 1RF1B 1QL1A 5LP6A 2PGDA 3GHGC 2LGWA 3OR6C 1B06A 1NT2B 2B9ZA 2IZ0A 1TAEA 2QJ1A 2WLLA 4NR1A 1BT8A 2Z5IA 3QVNA 2VRSA 1MSWD 1P7BA 2Q7GA 2B88A 4YY3O 1XHXA 4HB1A 4NXNO 3RYCB 4JV5O 1KU9A 1NR7A 1EM1A 1TVKB 3KCXA 3TXQA 4JI7O 3H1IE 5KAIZ 2JJLA 4EDFA 3CXHH 5EFWB 1G6UA 4A5UB 1N8RW 3AK1A 1L0NH 1OVVA 3CB2A 4D7SA 3M91A 5AW9B 4IT5A 4N3YB 2PI4A 4TV9A 1KILB 3U0ZA 3RK2C 2QKSA 4PA6A 3N2GA 3H1HD 2HHHB 1M90Q 3AEGC 4XA4A 4LH7A 4CZZA 4NKGB 2M5AB 2PF4E 1G2CA 5KKZC 2B1IA 3BCCD 5J2UA 2BSKA 1PIXA 2L35A 2ZCEA 1AROP 2ARHA 4MTGA 5L3FA 3QF7A 4I7ZB 5KA6A 3LSUA 1ZOYC 3MZWB 1J1EC 2ITDC 4U3JB 2RKLA 1US6A 5C93A 3E1RA 3B4SA 3AK3A 3JALA 1VQ9V 3MHVA 3VMZA 2OTJP 3S9OA 1MV8A 2OCHA 4LF5B 3H1JJ 3U11A 2WITA 3CCSV
chains in the Genus database with same CATH topology
3B4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4S A; 
#chains in the Genus database with same CATH topology
 4RO0 A;  1Q81 Q;  3A2F A;  3L71 J;  4I55 A;  4DO2 A;  4G28 B;  2E75 C;  5EZY A;  1VF5 D;  1KP3 A;  1NU1 E;  5BY1 A;  1FAV A;  3T97 A;  4KHP O;  5CA0 A;  3K0D A;  4ZHQ B;  4DR1 B;  3BHP A;  3MHS C;  3RK2 B;  1EDL A;  1J2J B;  1PGP A;  3L75 E;  2CH7 B;  2PGG A;  2YID A;  2WSC H;  1HNZ O;  1S72 P;  1CSB A;  1M56 C;  4JI8 B;  2QE7 H;  1FZE A;  1FKA O;  2Q5U A;  1GKF A;  5M1B A;  2O01 J;  4LCU C;  4CC5 A;  1T3J A;  5A2Q N;  1UPG A;  4E4E A;  1TUB A;  4DXW A;  3CLQ A;  5L8R J;  4N21 A;  5CMU A;  1ZP0 C;  2FYU K;  4JI0 O;  1RFY A;  4PD4 D;  5GTH E;  3I55 P;  1FXH A;  1LNQ A;  5AW5 B;  2AXT Z;  5LHH A;  2VS0 A;  5B1B C;  1E5W A;  5CCG A;  3PTZ A;  1ZUQ A;  1AJY A;  2YIU B;  1NTK E;  3HKB B;  5CBG A;  2OAR A;  3G6E P;  5JCO A;  2L6L A;  1SRY A;  5EYP A;  3STZ C;  1OZH A;  1R6T A;  1VPC A;  4X20 A;  4GX2 A;  3J80 N;  1M90 W;  3QO7 A;  1X79 B;  1DGS A;  3H1H J;  4L8J A;  1IUR A;  4MVO A;  1LUW A;  4CH5 A;  2P5O A;  4I50 A;  1DK1 A;  1L0L J;  1SQB E;  1W2E A;  4FM0 A;  3K59 A;  4NB5 A;  1N33 B;  2RMZ A;  2ZIO A;  1YI2 P;  2Q1K A;  2QWP B;  2X7R B;  4DR4 B;  4O2B A;  3SPJ A;  2KYV A;  3VP8 A;  1SQP H;  3AE1 C;  2R72 A;  2XTA A;  3A0H E;  2Y9Z A;  3E8F A;  3BVH A;  3SWK A;  4L74 A;  4J7J A;  4RES B;  5LMN O;  3CC4 P;  1CI6 B;  2IYP A;  3TCU A;  2CGN A;  2W83 C;  2UXC O;  5B5E H;  2ILM A;  2YKQ A;  1S9K E;  2WSS G;  5LMU O;  3LUT B;  1RF0 A;  5H5N A;  4D6T E;  2QJP B;  5AVY B;  1ZV8 A;  3N7N A;  2N1T B;  2QM7 A;  3X2Q C;  2Z4E A;  2C2A A;  4G27 B;  4H13 D;  5AVX B;  5BXZ A;  3P32 A;  3HE4 A;  3CXH D;  2OYI B;  1R3I C;  4O4L B;  1L4A B;  2SPZ A;  1NU1 H;  3CCQ P;  4YXW H;  2FFD B;  4HJG H;  1G8M A;  1JM0 A;  1ZME C;  1R6K A;  1OCR B;  3T97 B;  1DH3 A;  1BSH A;  2RMK B;  3E7K A;  3H1H H;  4JPZ B;  3QWO C;  4U3F H;  1FXK C;  3G4S P;  2Q7E A;  3L4F A;  3JAS A;  1RM1 C;  4RWU A;  1FXV A;  3N2K B;  2RCV A;  3ABM B;  3KCY A;  1SLQ A;  4HNA A;  1KC8 Q;  1E1Q G;  1SQV H;  2Y0C A;  3HE5 B;  4JQ0 D;  1WRG A;  3OAK A;  4Z1M H;  4MTO A;  2QEX P;  1NWQ A;  3NTN A;  3V2Q A;  4N6J A;  5GTI Z;  3ASO B;  4DR2 B;  1EN6 A;  4JZG A;  4BW5 A;  2Q9I A;  4IFF A;  2G38 A;  3VQW A;  1V54 B;  3UT5 A;  5KLV D;  3CCE P;  1X0T A;  3AE3 C;  1Z5W A;  3B09 A;  2P2U A;  3QG5 A;  2YKO A;  5LBQ A;  1N34 B;  3N27 A;  2ZDI A;  1FZC B;  2XDJ A;  2YNY A;  1XTC C;  3M0D C;  2C0W A;  3F5T A;  3ZRV A;  1U7M A;  1BE3 J;  3Q1M A;  3ETD A;  3AG2 B;  1KQF B;  1QL2 A;  1PL5 A;  1XL4 A;  4PA7 A;  4I0X A;  2R3C A;  3F7Y C;  2FYU D;  2QKC A;  2HVJ C;  3CX5 I;  4YJ2 A;  4LF8 B;  1TU3 F;  2Z5H A;  5JVD A;  3IAY A;  2RH0 A;  3OA7 A;  4O4H A;  1LWU A;  3CCJ P;  4ZNC A;  2CTW A;  5DJU B;  1OXZ A;  3QH9 A;  4W7Z A;  2DYR B;  5JWP A;  4CH6 A;  1L1F A;  1K8A W;  1AP5 A;  4E2L A;  3AG3 B;  1CPY A;  3Q4H A;  4JYA O;  2R3S A;  3A0B E;  3Q5S A;  2E5Y A;  1JPX A;  5E1A C;  3JD3 A;  1H2K A;  4UVB A;  2XHB A;  2KS1 A;  4U7O A;  3BAT A;  3TXS A;  1UJW B;  1ZW0 A;  5L3B A;  1JNM A;  1IFJ A;  3OTO O;  1L0N E;  2CTR A;  3B5N C;  5IYZ A;  3JCU H;  1PZQ A;  2GUV A;  5L3C A;  5B5E Z;  5CBF A;  3CHX A;  1MZF A;  3AG4 C;  4C7R A;  4WBN B;  2BEZ F;  2A06 E;  3L73 E;  5AVS B;  2HLO A;  3RW0 A;  2FXP A;  4DV2 B;  2XND G;  4DUY B;  1KC8 W;  4U7N A;  1WA8 A;  3AG7 A;  1JCH A;  3C90 A;  4DR4 O;  3CCV V;  2YEV B;  3VTP C;  1ZX3 A;  2YXH A;  3D6Z A;  2Q7H A;  1SQP D;  3CWB E;  1VQM V;  5J2T A;  1H2M A;  1BS3 A;  2PRR A;  2A0L A;  5AW1 B;  1K9M Q;  1Y76 A;  2CPB A;  1M5I A;  1HNX O;  2A45 H;  5E79 E;  1QU7 A;  4KJM A;  1VIB A;  1QVG O;  3CEI A;  5EIB C;  1FZC A;  2BTQ B;  4DK1 A;  3F89 A;  2OTK E;  4P2Z A;  3CRQ A;  4ABM A;  4X1I B;  1S5L H;  2HLD G;  2DWE C;  3H9V A;  1HNW B;  3HD7 D;  4GKK O;  2W90 A;  2E75 D;  2YUA A;  1N0J A;  3S3X A;  1RQV A;  4IFD K;  4BW9 A;  1M56 D;  2QRX A;  3P3N A;  4JAS A;  1K34 A;  4DR2 O;  1NU1 D;  3WUU A;  1S1C X;  3ZCC A;  3CJH B;  4DJG A;  1Q3E A;  5CCG D;  1FS0 G;  5AW8 B;  2E3C A;  4TV8 A;  4F6R B;  2Q73 A;  1GW3 A;  3WG7 C;  4U3F D;  1Q86 W;  1W0J G;  1Q8I A;  1YQ3 C;  2R44 A;  4RKU J;  3OW2 U;  1QVF O;  4JI8 O;  4NTW A;  1DF5 A;  4FLW A;  4KHP B;  1HGZ A;  4DR6 B;  1SQV D;  1QNM A;  4DR5 B;  2ZQM A;  1NO4 A;  1JUN A;  3ZRW B;  2JEX A;  1XMQ B;  4PD4 E;  5DEC A;  4KL1 A;  5ITZ B;  1GU4 A;  5LGN A;  3B8M A;  1AI5 A;  4HAM A;  5KLV H;  4RJT A;  1NTZ E;  2NPS A;  4WY4 B;  4PDL A;  2Z5U A;  4DRX B;  1NJI W;  3M7M X;  2V7Q G;  1PD3 A;  2R32 A;  2YO2 A;  4DUZ B;  2UUB B;  3FB5 C;  2YMK A;  2JGU A;  1ENV A;  4RUE A;  3A8T A;  2ITA A;  4TLF A;  2IPP A;  2N9B A;  1RH5 B;  2V4H A;  3L71 D;  2XV5 A;  1IBK B;  3ZRW A;  1S5J A;  2ZT9 B;  3JAL B;  5GTI E;  2DYS C;  4B3M O;  1JY2 N;  2FYU H;  2W0F C;  1OIP A;  1NR1 A;  4OWF A;  2PZS A;  3L35 A;  3CX5 F;  1QBZ A;  3SPC A;  1GDT A;  5KAI H;  2UUC B;  2BSK B;  3AE4 C;  5A9G A;  2EIJ C;  2ZIN A;  4O4H B;  4WFA V;  1AR5 A;  3G6B A;  1KQL A;  2LR2 A;  2LXC B;  2IH3 C;  1SQQ J;  3D36 C;  4EYY Q;  3R65 A;  4H13 B;  4DV1 O;  2JVD A;  4WY4 C;  1KD1 Q;  1W59 A;  4X20 B;  3AED C;  1D5N A;  1SQG A;  1QHT A;  3E2E A;  4DR3 O;  2IBZ E;  5K1P A;  1NU1 J;  4IYI A;  5AVV B;  1S5L E;  2ADP A;  3FD9 A;  4B7E A;  1JY3 P;  4RQF A;  3LSQ A;  3E8B A;  2LW1 A;  1YJW V;  1I08 A;  3IGA C;  4A7P A;  3V4Q A;  1UII A;  2F4V B;  1G1I A;  2I1K A;  2DYS B;  3GF7 A;  2UXB O;  5DN6 G;  3EFG A;  1VQ5 P;  3AEE C;  1QEX A;  1KIL A;  1QCE A;  4TUY B;  2RJZ A;  5B3S C;  1TUB B;  1VQ7 V;  2KSE A;  1BGY G;  3L72 J;  3LW5 J;  3RL0 g;  1VQL P;  3J7A U;  4GOF A;  1DEE G;  3V2P A;  5APY A;  1B04 A;  4EKW A;  3H1I H;  1AVM A;  5H6R A;  5H6Q A;  1MZ9 A;  1T6A A;  3ABU A;  2FYN B;  3GHG B;  2EIJ B;  4Z1V A;  4TSF G;  1MUU A;  1JJ2 U;  2IDB A;  3OW2 O;  2E43 A;  1ZLL A;  1R6N A;  3MUD A;  5BMV B;  2H88 C;  3A3Y B;  2VWJ A;  5CA0 B;  4YY3 B;  2W8Z A;  5AVT B;  3VQY A;  3ZHT A;  3FB8 C;  1OHH G;  3ZN0 A;  3AG2 C;  1SFC A;  3KQG A;  1X4T A;  3H1J D;  1VQ7 P;  1KN7 A;  2GA1 A;  1MOF A;  4L76 A;  4C7N A;  2BCC J;  3ZHR A;  4MW3 A;  5EBL C;  1Y74 A;  4GUN A;  3OAA G;  1Q82 W;  4CS4 A;  5APT A;  3JD2 A;  1I5Y A;  2EIM B;  3ZMT A;  3T1C A;  2P6J A;  3BPZ A;  1NU1 G;  5CBO A;  5K5G B;  5LOV B;  3RYF B;  2ZXX A;  1I0H A;  5J2U B;  2UUB O;  4EB6 B;  3TSI A;  1FYJ A;  1R5L A;  1OX3 A;  4L73 A;  4JI4 O;  1NTM E;  2GDS A;  3FX7 A;  2ZNI A;  3A0B H;  1S5L Z;  1H8A A;  5JJJ B;  2NRG A;  3F5H A;  2HPC B;  2GV9 A;  3CD6 P;  2ZE6 A;  2QTO A;  4LFA O;  2IU0 A;  2N9Y B;  5JJN B;  3HD7 A;  2QJP C;  3GVM A;  3D3I A;  5AVQ B;  1NS1 A;  1N7L A;  1SQB D;  2KLU A;  3K03 A;  4DV2 O;  1V55 C;  1GO3 F;  4GZR B;  4JI6 B;  2IBZ G;  4PA3 A;  1ZN5 A;  3CL3 D;  2EIM C;  2V7Q J;  3L71 H;  1NAF A;  1EFR G;  1NGM B;  2DQ3 A;  3O8Z A;  3RBX A;  4WB4 A;  1SA0 B;  1Y66 A;  2JEE A;  1YZB A;  1ZL8 B;  1OVU A;  5KJ7 C;  1VQP P;  1O9H A;  5FPR A;  1KFN A;  4B3S O;  1Q6H A;  1Q6U A;  4JYA B;  3ZX6 A;  4KT0 J;  3HUS A;  5LYJ B;  4I4T B;  3VMX A;  2IJI A;  4UVA A;  1OV9 A;  3MUD C;  3SYP A;  3RGB A;  2QG4 A;  5LXT B;  3ABV C;  1N86 A;  1PNM A;  4ZMD A;  1K33 A;  1Q82 Q;  3IJ4 A;  1JOY A;  3JCU E;  2A79 B;  4ASW A;  1D5A A;  2ZYA A;  2ZYG A;  4U3F J;  1IBL B;  1KUQ A;  5KUK A;  1J5E B;  4DV6 O;  1IVS A;  2GTA A;  1N2D C;  1KIL C;  3ZDM A;  1CW5 A;  2I8D A;  3UQ8 A;  2XAJ A;  3UO3 A;  4DYL A;  5B3S B;  4X64 O;  1FBM A;  5KKZ B;  2J5U A;  2QA4 P;  5GTI H;  2P06 A;  1XMO B;  1FZB A;  1Y47 A;  1S0V A;  1JFF B;  1NHL A;  5DJT B;  1VF7 A;  1GN4 A;  1USE A;  2K9J B;  2MK3 A;  4X62 B;  2FXO A;  3C3T A;  1QLN A;  2E5T A;  1Z2G A;  3H1L J;  2Q0A A;  3H1I D;  4WY4 A;  1RE3 A;  1MMM A;  5L3G A;  4U3F E;  1URF A;  1R3J C;  1N0N A;  1S3J A;  2P67 A;  1GN3 A;  1SQP G;  5FPO A;  1LUV A;  1TGO A;  1WPB A;  1XTG B;  1F4N A;  4DV4 B;  2YKP A;  3BVO A;  4PV1 B;  1SET A;  2XAG A;  3H32 B;  1MAB G;  3JSV C;  1ZR2 A;  3SJA C;  5KX5 B;  1VQM P;  1L0L G;  4JF7 A;  4J7Z A;  4TQD A;  2PFX A;  2BCC E;  2GHY A;  1AI6 A;  3PRJ A;  1YQ4 C;  2Q0O C;  5AW4 B;  3OE7 G;  3CCV P;  4DV7 B;  1VP7 A;  3H1J H;  1DTO A;  3BAB A;  3LDE A;  2Q67 A;  1KZU B;  1NTM K;  1PPJ D;  2OYI C;  1SQX K;  3B2E E;  3M8A A;  3K57 A;  2O57 A;  1XDC A;  4UV9 A;  3W7X A;  3AG1 B;  2K9Y A;  3PLN A;  3NR7 A;  1OZ0 A;  4IHJ A;  1LP1 B;  2WZ7 A;  3P8C D;  3T4Z A;  2F1M A;  1VF5 B;  1FJK A;  1WPX A;  2JJ1 G;  3OEE G;  1OCZ C;  2IJH A;  3BRC A;  1SQX E;  5LL6 Y;  3T1Y O;  1N34 O;  2GBO A;  3IFX A;  1OMI A;  3CCM V;  2MJZ A;  2B87 B;  4D7T A;  2G8Y A;  3N4X A;  1PM9 A;  3ABM C;  2K9J A;  3E1I A;  3CSX A;  2Y9Y A;  4B86 A;  2W6A A;  2Y0D A;  1VAR A;  2OTL P;  4UCU A;  1N7S B;  4O4L A;  2ZD9 A;  3RBZ A;  3NMD A;  2W27 A;  3ZHV A;  3K5N A;  2HJD A;  1Q5O A;  3SJB C;  2Z3Y A;  3RL0 B;  2UXD O;  1GL2 D;  4QPK A;  5APQ A;  3QO8 A;  3CXC U;  2AEJ A;  2ZIM A;  3ETG A;  1Y74 B;  1BE3 G;  4X1Y B;  1SS1 A;  4MTF A;  1Y4M A;  4B7K A;  1SQB H;  1GL2 B;  2YEV A;  5KTB A;  3KZI H;  1SQV K;  5AVU B;  4I6M C;  3TYY A;  3H1J G;  2QWN B;  4YJ2 B;  4N78 E;  5IT9 N;  5BVZ A;  3BAA A;  3LW5 H;  3TGU G;  3P3P A;  2D2C D;  1BQZ A;  3AE7 C;  4FZ1 A;  2JR8 A;  2UWJ E;  3BA9 A;  2F43 G;  4O4J A;  1NYH A;  1ZTE A;  1W5C E;  4DK0 A;  1OW8 A;  1JR9 A;  1S76 D;  1XBL A;  1GW4 A;  1BMF G;  3WUT A;  2N1T C;  2AZ0 A;  4JI4 B;  4X65 B;  1O9G A;  1WJZ A;  1OW7 A;  2QGN A;  1NH4 A;  4OGQ B;  3H6P A;  5LXT A;  4NPF X;  3GF3 A;  3G4S V;  1SQV J;  3RVY A;  4KP4 A;  4O2A A;  2ZVN B;  3ZS8 C;  3M9Q A;  1YJN V;  1LWU B;  4R7C A;  2DMX A;  1G4Y B;  1X9V A;  5KHK A;  2NPS D;  5E79 Z;  3A7O A;  3JSN A;  1NH2 B;  3TNU A;  2EUL A;  2WSF J;  5D5P A;  4NXN B;  1VQ6 P;  4U7J A;  2KNC A;  5BR8 O;  2ZAE B;  2EZP A;  2PAJ A;  1FXK B;  4GX5 A;  5KJ7 D;  4LF7 O;  3M99 B;  4WFF A;  1K5Q A;  2FB5 A;  1EZV I;  1PP9 D;  1RP3 B;  2N04 A;  1K97 A;  3L75 G;  2A7W A;  4X88 A;  4FLU A;  1NKD A;  4I5S A;  2O3J A;  3MTU E;  1AP6 A;  3F7V C;  3R66 A;  1I94 O;  2KSD A;  2YXR B;  4K0K B;  4OGQ C;  1PGQ A;  5C8Y B;  1KYO E;  4DOJ A;  2EIK B;  2PTM A;  3TET A;  4GDO A;  2OYI A;  5JQG A;  1JQ0 A;  2FKW B;  2UUC O;  1WB7 A;  2Y0I A;  4ICG A;  2XKM A;  1LWU C;  3HE5 A;  1IFM A;  4LFC O;  4GCZ A;  1K92 A;  4BR6 A;  3T4D A;  2QJY C;  4OX9 B;  1GM7 A;  5IWA B;  3VQV A;  3HKE B;  3CRC A;  1CEZ A;  1JEK A;  1PPJ H;  4DV5 B;  3L72 D;  3SDL A;  5KA5 A;  2F66 C;  4I2L C;  3DC6 A;  1VQ5 V;  3RYF A;  4J80 A;  1NVP D;  4FMT A;  3SJC C;  3CCL V;  1DEB A;  2R9A A;  1FZA A;  2UUA B;  2XAQ A;  3C3S A;  1K8A Q;  2ZE5 A;  1WN7 A;  3G6E V;  1NTZ J;  1YTZ T;  4PDV A;  2KUB A;  2WT7 B;  5KLV E;  1Y9B A;  3G9R A;  2KSJ A;  1GU5 A;  3TF5 A;  3LID A;  4DV3 O;  4LF7 B;  4X8A A;  1NQT A;  2FYN C;  3ZN1 A;  4W4K A;  1JCD A;  1V9P A;  2ZE7 A;  4OXS A;  3CE2 A;  3U1A A;  3D70 A;  3I55 V;  1LTI C;  2QDO A;  3A0B Z;  4NTY A;  2F23 A;  4JI1 O;  4RO2 A;  4TUY A;  1ZRT D;  4F6R A;  1NTZ D;  2POH A;  2BCC H;  2QWR B;  3ZMZ A;  4QMA A;  1NKZ B;  1M1K W;  5LGT A;  1IK9 A;  1ZL8 A;  2OIE A;  2J59 M;  4JAA A;  1LTS C;  2IYO A;  1U57 A;  1M57 C;  3KPE A;  5APV A;  4O2B B;  5B66 E;  1GH6 A;  1XL6 A;  1M1K Q;  2YO3 A;  2OYH B;  4DR5 O;  1KQS O;  1AR1 B;  4JI7 B;  5KAF E;  3M06 A;  4CBC A;  2CE4 A;  4X1I A;  3L71 G;  1Y8A A;  3VQX A;  1SQB J;  3MDS A;  3UT5 B;  1Q81 W;  2YIB A;  1BCC G;  3JSL A;  2HVK C;  1OCO B;  2FYU G;  3Q3D A;  1ZXG A;  1NVO A;  1VQ9 P;  2LKM A;  3LDC A;  2QM8 A;  4ZIB A;  4W80 A;  3L37 A;  1H8H G;  2ZM6 B;  3ABL C;  4KXR A;  5KHI A;  4C7N B;  1NTM G;  3KZI Z;  2IU3 A;  2V4D A;  4FLY A;  3WU2 H;  2LW7 A;  2VQF O;  2JO1 A;  3WU2 Z;  4FLV A;  1GM8 A;  3D3Q A;  3FXD A;  3LIE A;  1M57 B;  2QIW A;  1GTO A;  4ZKI A;  4NXM B;  2M8R A;  3FWN A;  4KHX A;  5BMV A;  4TT3 G;  1AQT A;  1PPJ E;  3W67 A;  3E22 A;  3JAK B;  1HNZ B;  3DXR B;  1DF4 A;  4GOD A;  1A02 F;  3P7K A;  1DIP A;  4ZI7 B;  2OGU A;  3AG3 C;  1PP9 H;  3FAV B;  1J1D B;  2HHH O;  4J10 A;  5K1X A;  3K5M A;  1L4A D;  1GN2 A;  5JJE B;  4FFB A;  1R1B A;  1QLE B;  2V1D A;  2PYL A;  1SF9 A;  4I4T A;  1FDO A;  1USD A;  1RE3 C;  5KX5 A;  1B3Q A;  2AEF A;  1GN6 A;  1GL2 C;  5CJ4 A;  3WB0 A;  3K5O A;  3SPI A;  1VQ8 V;  1HTL C;  1ROP A;  2WLI A;  3CC7 V;  4I0X B;  1KYO D;  4LF5 O;  2Q8V A;  5J9P C;  4LH6 A;  3I56 V;  1IXB A;  2WLJ A;  3APQ A;  1S5L X;  3VMY A;  5B1A C;  2WLL B;  3L72 H;  3RYI A;  5LMN B;  2F95 B;  5CA1 B;  4FJC C;  1IBM O;  2WPV B;  1SQV E;  1KB9 I;  2KI7 B;  3GLM A;  4OPH A;  1SC5 B;  2FKX A;  4HBN A;  3DTU B;  1SZT A;  2CUG A;  3PJS K;  2X6B A;  3WB2 A;  2UU9 B;  1VQ6 V;  5KAF H;  3O65 A;  2D2C C;  1NTZ K;  3RK3 C;  2M3E A;  1MFT A;  2Q69 A;  3II6 A;  5IDJ A;  3F5W C;  1BHA A;  1QLE C;  4L75 A;  2AHY A;  3OMI B;  5EBM C;  2IFM A;  1K4D C;  3K9A A;  1YJN P;  3HUS C;  2E76 B;  1JMK C;  3CRR A;  4Y99 C;  3CI9 A;  3JAW A;  4LF8 O;  1SQQ D;  1BZK A;  2JKV A;  3VMA A;  5KJ7 A;  1JO5 A;  4X1K A;  1FZG A;  3THO A;  1NTZ H;  1NTM J;  3CCJ V;  3APO A;  1U7J A;  3GG2 A;  2H94 A;  1GL2 A;  1F7Y A;  4K8Z A;  4Z2W A;  2BCC D;  4U3F G;  3K08 A;  4X1Y A;  3L70 E;  3CC2 P;  5KLV K;  5B1A B;  3RK2 D;  3PHL A;  2CPS A;  3RT3 C;  1IBK O;  4H37 A;  1ZSP A;  4XDK A;  3AEI A;  1YBK A;  1PV0 A;  2JS3 A;  3H1K E;  1FU1 A;  5KLI C;  1P49 A;  2R5D A;  2EIL C;  1R8E A;  3MAQ A;  2DOS A;  3A2A A;  1YIJ V;  3CXH I;  3A0H H;  4EFE A;  5JH7 B;  2P90 A;  4GKJ O;  4XFJ A;  1BCC D;  2WSE J;  1M9N A;  4DV1 B;  1K4C C;  4MN4 C;  2Q68 A;  3CX5 E;  3T1Y B;  3EWK A;  3ASN C;  1GK9 A;  4D6T J;  1GAX A;  4YJ3 B;  5AW6 B;  4DR3 B;  4CC6 A;  3Q5P A;  2Y4U A;  1MA1 A;  2BEQ D;  3JCZ A;  5CJ0 A;  2OTL V;  3SYO A;  1AJN A;  2IJK A;  3MGN A;  4X89 A;  3KYQ A;  3O9O A;  1E79 H;  1FDI A;  2HPC A;  2IM9 A;  1N8R Q;  4FFB B;  2RQ6 A;  4HKZ H;  2JDI H;  2M5A A;  1QVF U;  2UXX A;  3G67 A;  1HH0 A;  2ATK C;  3BRV B;  1EDJ A;  3NFQ A;  4TV8 B;  3P8C E;  1W2B U;  4GKG A;  2ZR2 A;  4TV9 B;  2ITC C;  4UCR A;  3FYE B;  3CCM P;  1N36 B;  4LNU A;  2EIL B;  3OGI B;  5E79 H;  2W6I G;  1SFC D;  3CCQ V;  4K3A A;  4JAU A;  5D5Q A;  4CH3 A;  3OR7 C;  1FC2 C;  2YC0 A;  3CPW O;  1YHQ P;  3A5T A;  4AUW A;  5KMG A;  3V2R A;  2BOC C;  2NZ2 A;  4Q6G A;  2WVR A;  3AE9 C;  5LGU A;  2H8P D;  2KKW A;  1IZN B;  2WAM A;  1L0N K;  4WFG A;  2WSC J;  1KB9 F;  2P10 A;  2RDC A;  2JEU A;  1H0T A;  1LT9 A;  5EK0 A;  2BOB C;  2WLK A;  3L75 D;  1Q2N A;  1K9M W;  3WB1 A;  1GZL A;  1JCC A;  2H43 A;  4DRX A;  2JGD B;  3CC7 P;  4ZOL A;  3AE8 C;  1VQ8 P;  3GWO A;  4YXD C;  1QVG U;  1N33 O;  3CMA P;  1EN4 A;  1LT1 A;  1KYO H;  1R5S A;  3M9H A;  1K3E A;  5H9C A;  2HP8 A;  4DV7 O;  2KS1 B;  3OGC C;  4YPC A;  2LFS A;  2Y69 C;  1LTA C;  1P84 E;  3L74 E;  1AJQ A;  1LTT C;  2VWK A;  1SZX A;  4KFM A;  1XNR O;  3AEA C;  2B9B A;  1Y67 A;  3OT7 A;  1SQX D;  1URQ D;  4UB8 E;  2QWO B;  2NPS B;  3WFV A;  4JI0 B;  1LTJ C;  1H88 A;  3LNM B;  1EZV G;  4RAI A;  4OH8 B;  3D36 A;  2OYO A;  3BFR A;  2OWO A;  3HD7 B;  5KHG A;  4WY4 D;  4JI5 O;  3TNU B;  2HEP A;  4CH4 A;  3T1H O;  1KV4 A;  3Q4H B;  1HW7 A;  2ZM6 O;  4H0L C;  3B5N A;  1PGJ A;  1GMJ A;  4WBA A;  4JI1 B;  1SQQ H;  1UIX A;  3ABK B;  1NH2 D;  4QGP A;  3K04 A;  1LTB C;  2XZR A;  3MIW A;  1JVM A;  1H2G A;  3UM7 A;  1KD1 W;  2FFD C;  2DW4 A;  2WPR A;  3WMM 0;  1FFX B;  2B1G A;  5EYP B;  2HKO A;  4PJ0 E;  1LR1 A;  4JI3 B;  2ZFC A;  3V4W A;  4C7U A;  4OGQ D;  3L36 A;  1NVP B;  4CPG A;  4FLX A;  2NLJ C;  3ML0 A;  4D6T G;  2ZE8 A;  1BCC J;  2NPS C;  3OJA B;  2CDY A;  1SQB G;  1NBM G;  4LFA B;  1A32 A;  2DE0 X;  4LFB O;  4XDL A;  5GON B;  1XNR B;  5B66 H;  3L73 J;  1XRE A;  3EFF K;  5L3E A;  5B66 Z;  3OUF A;  3FGA D;  1AJP A;  1SFC B;  3W7T A;  2AZ2 A;  3H1I J;  2YIU C;  5LP6 B;  1BCC H;  3TGU H;  2ZDI C;  4JI6 O;  2AEM A;  1X59 A;  2P4K A;  1Q90 D;  4RQE A;  2M7W A;  3C8V A;  1YTF B;  4MS2 A;  2ZNJ A;  1HNX B;  1W0K G;  4LFB B;  3S3W A;  4FIP C;  2KP8 A;  3BEH A;  1JTH B;  3CD6 V;  3L72 E;  4DW0 A;  1L0N G;  2A9H A;  4I9Q A;  2N1T A;  4ZOL B;  4DV0 B;  3A0H Z;  3UCS C;  4PD4 F;  4KUM A;  4NTX A;  1PPJ G;  1JY2 P;  4I7Z C;  4C46 A;  2Q6A A;  1OCZ B;  1LTG C;  5FNV B;  1SQB K;  4MSW C;  2VQE B;  1VQK V;  1PP9 E;  3K5L A;  4BIZ A;  3FB7 C;  3BCC G;  3HE4 B;  3CP1 A;  4OPA A;  2IW5 A;  2IH1 C;  5LHI A;  5KMG B;  1KFM A;  3TDK A;  3CCL P;  2W6J H;  3GB7 C;  3Q2Y A;  1YEW A;  2YS8 A;  4D6T H;  3KXD A;  2R70 A;  5AVW B;  3HKC B;  3EXA A;  4JYB A;  2W6B A;  4DV4 O;  2EZO A;  3VBB A;  1NTK G;  3L74 J;  1I94 B;  1D7M A;  5DED A;  2V7Q H;  2FY8 A;  3L75 H;  5AVZ B;  2KB1 A;  3GWK C;  5CA1 A;  2IBZ D;  1N32 O;  1JMM A;  4WCE V;  4DUZ O;  3U10 A;  1Q7Y Q;  1L0L K;  2L91 A;  4YIO A;  4JTA B;  1J95 A;  2FYU E;  1FOS E;  1MKM A;  1M56 B;  1P7G A;  3CJH A;  1JY3 N;  2BCC G;  2OCC C;  3H1H E;  4NVP A;  2EJ7 A;  3SGI A;  2C0X A;  3AG4 B;  4CS3 A;  1HUC A;  3TK1 A;  2QTS A;  3NXS A;  4J9Z B;  2E76 D;  2XNX A;  2QE7 G;  1IO4 A;  1OCC C;  2ZT9 C;  1BQ0 A;  1IXM A;  3RWR D;  1VQL V;  2ODM A;  1OFC X;  4AYC A;  5H2F H;  1ORQ C;  4UV8 A;  3H1L E;  1SQX H;  1XNQ B;  3FKS G;  1AB3 A;  5APU A;  4MVR A;  1KP2 A;  1XHZ A;  3ZIA G;  1EXI A;  5EIB D;  5KLI B;  5F2V O;  1YJW P;  5KAF Z;  1EZV D;  4FM2 A;  1YVW A;  4UB6 Z;  4JYC A;  1IJD B;  2N1T D;  4ZI7 A;  4EIJ A;  1HR0 O;  3B5N D;  4TQF A;  1P4R A;  4DR7 B;  3E22 B;  3JAK A;  4EEQ A;  3L70 H;  3IC7 A;  1BCC E;  1T3U A;  5APS A;  1L0N J;  5AW3 B;  2WPD G;  5JCO C;  2YI9 A;  3CX5 D;  1YIT P;  2FTK A;  1EDK A;  1K7D A;  4YHH O;  5CCG C;  2YMY A;  1DX7 A;  1T2K D;  3JAW B;  3OTF A;  1N36 O;  1KIL E;  2IFN A;  3R2P A;  5LYJ A;  3RK3 D;  1IFP A;  3H1K G;  1COW G;  5BU8 B;  1NJI Q;  2E42 A;  3H1I G;  1XIL A;  1F4M A;  1QLE D;  2NN4 A;  1WP7 A;  5BZB A;  4O4I A;  2AXC A;  2A3Q A;  2DYR C;  4EFB A;  1LP1 A;  4PEL A;  2NR5 A;  2A06 G;  2WSE H;  3L73 G;  3DC5 A;  4ZHQ A;  4HH2 A;  3UO2 A;  1KB9 H;  1K73 W;  3W7W A;  1VF6 A;  3M0A A;  4AIL C;  1N73 B;  2KG7 B;  1HP8 A;  1M4U A;  2UXD B;  2H89 C;  4TOI A;  5FLX N;  1ZLZ A;  3U59 A;  4H0L D;  3PN1 A;  2IJJ A;  4PA9 A;  4X9Q A;  5JVD B;  3UKM A;  2Q3E A;  1N32 B;  2BTQ A;  3TGU D;  2LJ2 A;  5B5E E;  2E76 C;  1SQQ E;  3JYC A;  4TWK A;  1VL2 A;  2FL4 A;  3AEF C;  4R6Z A;  3L70 J;  1CP9 A;  1UFI A;  2KNC B;  3AEC C;  3EQ2 A;  2KXP B;  2BE3 A;  1FFX A;  4LR3 A;  4LNU B;  1BHB A;  2KZJ A;  1E79 G;  3RYH A;  4PHZ A;  2C9L Y;  1NTM H;  3I5D A;  1RPR A;  2K88 A;  4F6E A;  3IR9 A;  4MVQ A;  1PKX A;  2XAF A;  1BSN A;  2BAS A;  3M9B A;  3VYI A;  4BWA A;  4MVU A;  2RN0 A;  4FK5 C;  4IFM A;  3K9S A;  4XBF A;  4IGG A;  1SQX J;  1HF9 A;  4L87 A;  5KAI E;  2M6Y A;  1T8Z A;  2GSM B;  2ADQ B;  1S9K D;  1Y76 B;  3STL C;  1JB0 J;  1RF0 C;  4TT3 H;  1H2N A;  1PNK A;  1PV3 A;  5EC2 C;  4QJF B;  3MP7 B;  1AFO A;  4D6T D;  3KKY A;  1LTJ B;  1AI7 A;  5B1O A;  4MTX A;  1EXJ A;  3CCU V;  1BE3 D;  1H8E G;  1S4X A;  1JX9 A;  1AVY A;  3HD7 C;  3V6I A;  1EQ7 A;  2IBZ H;  2AHZ A;  3L72 G;  1OVR A;  3MD0 A;  5DM6 V;  4X1K B;  2D3O W;  5L3D A;  1Y6X A;  1GD2 E;  1RF1 A;  4QNH B;  2H3O A;  5KLV J;  2WLH A;  1WLE A;  3L74 H;  1D2D A;  1AA0 A;  1P84 H;  2YI8 A;  5B1N A;  5TIS E;  3HTK A;  4UB8 Z;  3SPG A;  4DR6 O;  4JF3 A;  4U3J A;  1SQP J;  3CME P;  1DD3 A;  1SQF A;  2AGA A;  4UFZ A;  3V5B A;  2RN9 A;  1U97 A;  1CZQ A;  3AG1 C;  2GTS A;  1SES A;  1Z5V A;  1YXB A;  1L0L H;  2EBO A;  1FPO A;  1LJ2 A;  1ZRT E;  3CCR V;  5AVR B;  2M0B A;  2UU9 O;  4BRY A;  5GON A;  2QA4 V;  4IOI H;  4PI2 A;  3RL0 C;  3D8C A;  1EZV H;  2K1E A;  4WWI A;  1EBO A;  4JI2 B;  4DV5 O;  4Y99 B;  1G1X B;  5CBN A;  4LBE C;  1SFC C;  4YJ3 A;  1NZ6 A;  3W7U A;  3L70 D;  1K05 A;  3P30 A;  4G2K A;  2P7J A;  4Y28 J;  3KZI E;  1Q43 A;  1QQC A;  1RE4 A;  4B08 A;  4IIJ B;  3CX5 H;  4J42 A;  3X2Q B;  2QSI A;  4PDM A;  1SQQ G;  3WUV A;  4JPR A;  3ZJZ A;  2QM4 A;  4B3T O;  3JAM N;  4IL6 H;  4DV3 B;  4UB6 E;  1IFI A;  4IL6 Z;  1THZ A;  1YJ9 V;  2GM4 A;  3O6Q A;  1J1D C;  1VQP V;  1I5X A;  2ZKO A;  3ABT A;  4LF9 O;  2O01 N;  1KIL D;  4FM1 A;  2KIK A;  5HFL A;  5KHJ A;  3KDP B;  2QR4 A;  4O4I B;  3HKD A;  2HG5 D;  1X22 A;  3ZBH A;  1KB9 D;  1KTM A;  4LWS A;  4IYH A;  1MG1 A;  4X66 O;  4PDR A;  2R9R B;  2YXL A;  2Y48 A;  1WMK A;  4DUY O;  3K5B A;  1Q86 Q;  1XEQ A;  5IYB O;  2QKA A;  3LDD A;  2VQE O;  4X64 B;  2KQX A;  3RFR A;  3OD4 A;  4WBN A;  4JZ2 A;  1PGO A;  2WSS H;  3ASN B;  3CCE V;  3K79 A;  1S5H C;  4K35 A;  3S1K A;  3HKE A;  3W7S A;  5IYZ B;  1H0T B;  4GX0 A;  5IJ9 A;  2Y0E A;  1L4A A;  4MW8 A;  4X66 B;  1V55 B;  4R4L A;  1YDX A;  1AVO A;  2OYH C;  1KMI Z;  1JJO A;  3H1J E;  4K0K O;  1ZR4 A;  2HR3 A;  3SPH A;  1NTM D;  1YF2 A;  5C8Y A;  1S77 D;  2LO1 A;  1VQN V;  4N78 D;  2YIC A;  3JD4 A;  1VQO P;  3K0G A;  3E86 A;  2MW2 B;  1SER A;  1VEW A;  4UCT A;  2EIK C;  2WA3 A;  3OUS A;  1LT9 B;  1MNG A;  3VOU A;  4NPD A;  3N2G B;  2EJR A;  3QTC A;  3A0R A;  1OJH A;  2D2C B;  1BDD A;  1SQQ K;  2J58 A;  3Q5R A;  2DN9 A;  3ZHQ A;  4M3L A;  3CCR P;  2OYQ A;  4EI2 A;  1NU1 K;  3USS A;  4LWS B;  1WP8 A;  2Y4T A;  1FOS F;  4B3R O;  4HYO A;  2A45 G;  3GHG A;  5LP6 C;  1HVV A;  1BE3 H;  1EZV E;  3CRA A;  3CME V;  3PH0 A;  2XAS A;  5KLV G;  4AQR D;  1FJP A;  4BRY B;  1NTK D;  1KKD A;  4WF9 V;  1GRJ A;  2K1A A;  3SJQ C;  1QR9 A;  2YIB D;  5JH7 A;  4B3T B;  1KYO I;  1L8D A;  1X8Y A;  1MZE A;  4LGD E;  3AK2 A;  1YTF D;  2Q6Q A;  1P84 D;  3L74 D;  2WWW A;  2A45 I;  1LGH B;  1N7S D;  2RNB A;  1EZJ A;  3I5C A;  4IIJ A;  3H1L H;  3L75 J;  3KG2 A;  3C1L A;  4R8C A;  3FB6 C;  4ASU G;  2P7T C;  2YIA A;  3E8H A;  1IC2 A;  3CCU P;  2UXB B;  2KK7 A;  4NPE A;  3SFD C;  4LC1 A;  1RM1 B;  3HPL C;  4DR7 O;  2AW9 A;  3D6Y A;  3CWB J;  1L0L D;  1PL0 A;  5CB4 A;  1RQU A;  4ASV A;  4WFH A;  2LP7 A;  3FWL A;  1VMG A;  1G1J A;  1SQX G;  3IFM A;  4JYY A;  3B8N A;  5HFM A;  2WLN A;  5B1B B;  3G80 A;  2UXN A;  1SVF A;  4PJ0 Z;  2LXB A;  2F93 B;  4JI2 O;  1QR8 A;  2QVA A;  2FML A;  4R50 A;  2H7H A;  1A02 J;  4UUJ C;  1JTH A;  4GT1 A;  1BL8 A;  5C39 A;  2WT7 A;  4AHC A;  3H1K D;  1T5E A;  1DLB A;  2WSF H;  2E74 B;  2HOD A;  4B3R B;  2UUA O;  1RY3 A;  5EC1 C;  2O1J A;  2ZJS E;  2OIG A;  3WG7 B;  3HB3 B;  1KOR A;  3L70 G;  3T2M A;  1FZC C;  1W2B O;  5JQG B;  2X0L A;  5BR8 B;  1H89 A;  5CCH D;  1L2P A;  1QGK B;  3K06 A;  2OCC B;  3AE2 C;  2DW3 A;  2XAH A;  4HYT B;  4PD4 I;  2WLM A;  4UXN A;  1KBH A;  5TJH A;  4PV1 D;  1H2S B;  1PFI A;  3FYI B;  1HJ0 A;  4DZO A;  1HWY A;  1CI6 A;  3ZMS A;  1GMG A;  3B8E B;  4X62 O;  2KOG A;  2WPQ A;  1BGY D;  4MVM A;  4DW1 A;  5CB4 B;  1Z56 A;  1RPO A;  3FFQ A;  1S72 V;  1URQ B;  1YSC A;  2F4V O;  1GTW A;  2DWD C;  2E75 B;  1B6Q A;  1H38 A;  5IYC O;  2Q5Z A;  3HKD B;  1AV1 A;  4I1L A;  2Q3I A;  3QNE A;  1TA8 A;  1IX9 A;  3JAT B;  4J9Y B;  1SP4 A;  2LGQ A;  4NYK A;  4JTD B;  4J7K A;  1KYO F;  1XMO O;  1F23 A;  1N7S C;  4LF4 B;  1HDJ A;  1GK6 A;  4LF6 B;  2KG7 A;  4FLZ A;  3FX0 A;  3CCS P;  1IFN A;  2E5L O;  5TIS H;  2QJY B;  1F51 A;  4UCS A;  3K3W A;  4FLT A;  3FAV A;  1BDC A;  1RF1 C;  3W68 A;  3JD1 A;  3V2N A;  1YIT V;  2I1J A;  5KHH A;  1NI8 A;  1AI4 A;  5CHX A;  2EX3 A;  2W6J G;  2IBZ I;  5IWA O;  5FNV A;  2DJV A;  1WA8 B;  1URQ C;  2YXY A;  1HBW A;  1KEC A;  2ZXE B;  1WT6 A;  3RL0 D;  3QO5 A;  4LFC B;  3VN0 A;  3ZMU A;  2IX7 C;  3IN6 A;  1NTZ G;  1FDM A;  2KB7 P;  3ASO C;  4OX9 O;  2O01 H;  4B3M B;  2K9P A;  1R3K C;  2VQF B;  3M0D A;  3MHH C;  4EB6 A;  1MFZ A;  1NTK K;  3JAR B;  5BU5 A;  4JAV A;  4H0L B;  4ZKU A;  4MVS A;  5IJ0 B;  3CYO A;  5CCH C;  4O4J B;  1QX8 A;  1XOU A;  1SKV A;  1XNQ O;  4H13 C;  1JY3 O;  1GK4 A;  4ZKP A;  3SR2 C;  1Q6I A;  2CK3 H;  2CAZ C;  2ZYD A;  1ZAU A;  1NTK H;  2ZVO B;  3L9D A;  3VP9 A;  3GMA A;  1PP9 G;  2HJF C;  1VF5 C;  4UVC A;  2AXT E;  4H44 C;  1I7F A;  5LA6 A;  1IFD A;  3SYQ A;  1R3L C;  4P9O A;  2GUZ B;  3RK3 B;  4ZBM A;  2WA4 A;  1NTK J;  2B87 A;  1RHZ B;  2LQT A;  3L74 G;  3U1C A;  1CXZ B;  3H1L D;  2HYN A;  4UB8 H;  1FXK A;  3KHU A;  5LMU B;  1YTZ I;  2HFE D;  3ZRX A;  5AW2 B;  4J11 A;  1WNS A;  2JIZ G;  1PNL A;  4JGS A;  2P1J A;  2XU6 A;  2B89 A;  4FZ0 A;  4YXW G;  3T1H B;  1VF6 C;  3AEB C;  4I50 B;  5IY5 C;  1EC5 A;  2C9N Y;  2JDI G;  1OW6 A;  2QJK B;  2P22 C;  1Q7Y W;  1KB9 E;  1VQK P;  3H1H G;  1R73 A;  3RN4 A;  3ZED A;  1M1J B;  1VQO V;  3E89 A;  1VQN P;  2JK5 C;  1DD4 A;  2DQ0 A;  2E5L B;  3H1K H;  3B40 A;  1FZF A;  4XE5 B;  3RYH B;  1YCI A;  2Y69 B;  2Z0A A;  3H01 A;  1SA0 A;  1SQP K;  1SQV G;  1SS3 A;  4R4M A;  4YIP A;  3RK3 E;  1AQ5 A;  3JAS B;  3E83 A;  1URQ A;  2G3A A;  3CWB H;  1HWT C;  4LF4 O;  1M1J A;  4LP8 A;  2R9I A;  4GOE A;  3OEH G;  5IYD O;  2CTP A;  4JI5 B;  2N05 A;  2XT9 A;  1IBL O;  2YDE A;  2WQY C;  2LFR A;  4J41 A;  2K37 A;  3LSS A;  1BGY H;  4BWN A;  3J81 N;  2FYU J;  3HRN A;  1HJB A;  5IY5 B;  5CA3 A;  1N73 C;  2JRI A;  3H32 A;  1V54 C;  5GW7 A;  4F4L A;  2QJK C;  3TGU J;  1N73 A;  1OWA A;  3DXR A;  3CPW U;  3HKC A;  1KQG B;  4RUF A;  2YSU B;  4GKK B;  1BGY E;  2KLV A;  2JP3 A;  2IZ1 A;  1EN5 A;  4LLH A;  4W7Y A;  2W0X A;  1M1J C;  4EOT A;  1FAF A;  3CXH E;  2GUZ A;  3JCU Z;  3ITK A;  1VQ4 V;  4GIF A;  5KUM A;  1YJ9 P;  1HNW O;  1KQS U;  3LNN A;  1E1R G;  4O9B A;  4I55 B;  4WFB V;  1JFF A;  2FBW C;  2O1K A;  5GTH H;  2KZI A;  4QPJ A;  4CS2 A;  1EDI A;  2Q7C A;  3BA8 A;  1J1E B;  3UIA A;  2QEX V;  1FFT B;  1OCC B;  2P4V A;  2QWQ B;  1JA8 A;  2X6A A;  2P58 A;  2QSA A;  4MT8 A;  4Z1M G;  5IE9 A;  2PI5 A;  4AQY B;  4Q20 A;  2EIN C;  4JTC B;  4IHJ B;  1G2C B;  3H1K J;  1NKN A;  1OCO C;  3RGU A;  1GM9 A;  3CWB G;  4XDJ A;  1FE6 A;  2B5U A;  4O2A B;  2JWD A;  3B5N B;  3P8M C;  4IL6 X;  1N4C A;  2M3B A;  4UCO A;  1HR0 B;  5LHG A;  1M93 A;  3HUS B;  3SWF A;  4P9P A;  3HKB A;  4B3S B;  2HFE C;  5AG2 A;  1FD9 A;  3CS5 A;  1U96 A;  3JAT A;  1M57 D;  3S4R A;  4NXM O;  1OCR C;  3AE5 C;  3G71 P;  2YXQ B;  2N74 A;  2CTQ A;  2WMM A;  3IF4 A;  3SFE C;  2A06 D;  4WFE A;  3L73 D;  2Q4P A;  3JC2 2;  3TJT A;  4JI3 O;  4YTP C;  3ZHU A;  2HG5 C;  2WPS A;  3VOP A;  3AE6 C;  3ETQ A;  3CMA V;  1T2K C;  2K3R A;  4N23 A;  5APX A;  3SYA A;  2WTY A;  2JJ2 G;  1NOH A;  3CC4 V;  2XND H;  1IZ3 A;  2XOK G;  5CCH A;  2ETN A;  3CRM A;  1MSD A;  4P30 A;  4DV6 B;  3BRT B;  3FXE A;  5H2F E;  4PV1 C;  3BY6 A;  2E74 D;  4GKJ B;  1HGV A;  2MKV A;  1BGY J;  1VDF A;  3H1L G;  3H25 A;  1BSM A;  1PL4 A;  3BAS A;  3R4Y A;  4JV5 B;  1AR4 A;  3EHB B;  1YI2 V;  4QE7 A;  3ABK C;  3G71 V;  2FYZ A;  1PP9 J;  1P84 I;  4PA4 A;  3BCC J;  3DSQ A;  5J2T B;  3HTK B;  2JGD A;  3N2K A;  1WAZ A;  1WB8 A;  2PY5 A;  1YHQ V;  5FL7 G;  5IJ9 B;  3JAR A;  1L0N D;  4IL6 E;  3B77 A;  5LA6 B;  5EBW C;  4FFK A;  4LF9 B;  2XUM A;  3PP5 A;  1NAY A;  4UCV A;  4PJ0 H;  3BCC E;  4FPP A;  2PP6 A;  2NNU A;  3D71 A;  2GUS A;  4YHH B;  1XMQ O;  1IBM B;  5CN0 A;  2Y0P A;  2PYJ A;  2VRZ A;  2H8P C;  2ZXW C;  2UXC B;  4X65 O;  2FFD A;  3BCC H;  1IK7 A;  5ITZ A;  4JBZ A;  1P84 F;  2PUS A;  3G3Z A;  4W4L A;  1N7S A;  2CH7 A;  3ZHS A;  1SQP E;  3CWB D;  4PI0 A;  4AQY O;  4MVZ A;  3OFN G;  4I9W A;  1FJG O;  2JS5 A;  3O6Q B;  4GLX A;  4BAY A;  3TGU E;  5AW0 B;  3SSU A;  3RYI B;  5GTH Z;  1L0L E;  5EZY B;  2OQQ A;  4QE9 A;  4BXL A;  2OYH A;  1VQ4 P;  4LF6 O;  4DV0 O;  1L4A C;  3ABL B;  5CMZ A;  1YIJ P;  5AW7 B;  4HZ3 A;  4DT0 A;  1XI1 A;  1LTJ A;  4DCK A;  2WLI B;  1JOC A;  5CBH A;  1YYC A;  3WU2 E;  3E35 A;  1FJG B;  4H44 B;  4WVZ A;  1KKC A;  3ZRS A;  3ZMV A;  3E8G A;  1XQ8 A;  2ZXW B;  2L5G B;  1K5S A;  4H44 D;  5H2F Z;  3OM3 B;  4GX1 A;  3ETE A;  2E74 C;  3L71 E;  3CC2 V;  5APW A;  2BTO A;  2OTJ V;  3OMN B;  3SYC A;  1JY2 O;  2FXM A;  2ZT9 D;  4AI8 A;  5TIS Z;  2X6C A;  1K73 Q;  1AIL A;  1RSO B;  2OT5 A;  4QIW F;  3SWY A;  4BIO A;  1M8O B;  2EIN B;  4UB6 H;  3ICX A;  3IC9 A;  2Q9L A;  2CGO A;  4PD4 H;  3GW6 A;  4BIU A;  1BE3 E;  1S2E A;  3HR0 A;  1TUE B;  1TVK A;  1LT9 C;  3C9I A;  1JMB A;  2HOD B;  4HNA B;  3DGE A;  3RVZ A;  3CXH F;  1J5E O;  2JWA A;  1RE4 C;  3RYC A;  3B71 A;  2ZR3 A;  1IDS A;  4FVM A;  4GYC B;  2R5B A;  1M7L A;  1FS0 E;  4H33 A;  4OVN F;  5LOV A;  3OTO B;  4DR1 O;  1ZWI C;  3EVK A;  3JD0 A;  2AXT H;  2A06 H;  3L73 H;  3I56 P;  5IJ0 A;  4K8X A;  1XUQ A;  3K58 A;  1K04 A;  2CK3 G;  3IAO A;  1RSO A;  3OMA B;  1H2L A;  1RF1 B;  1QL1 A;  5LP6 A;  2PGD A;  3GHG C;  2LGW A;  3OR6 C;  1B06 A;  1NT2 B;  2B9Z A;  2IZ0 A;  1TAE A;  2QJ1 A;  2WLL A;  4NR1 A;  1BT8 A;  2Z5I A;  3QVN A;  2VRS A;  1MSW D;  1P7B A;  2Q7G A;  2B88 A;  4YY3 O;  1XHX A;  4HB1 A;  4NXN O;  3RYC B;  4JV5 O;  1KU9 A;  1NR7 A;  1EM1 A;  1TVK B;  3KCX A;  3TXQ A;  4JI7 O;  3H1I E;  5KAI Z;  2JJL A;  4EDF A;  3CXH H;  5EFW B;  1G6U A;  4A5U B;  1N8R W;  3AK1 A;  1L0N H;  1OVV A;  3CB2 A;  4D7S A;  3M91 A;  5AW9 B;  4IT5 A;  4N3Y B;  2PI4 A;  4TV9 A;  1KIL B;  3U0Z A;  3RK2 C;  2QKS A;  4PA6 A;  3N2G A;  3H1H D;  2HHH B;  1M90 Q;  3AEG C;  4XA4 A;  4LH7 A;  4CZZ A;  4NKG B;  2M5A B;  2PF4 E;  1G2C A;  5KKZ C;  2B1I A;  3BCC D;  5J2U A;  2BSK A;  1PIX A;  2L35 A;  2ZCE A;  1ARO P;  2ARH A;  4MTG A;  5L3F A;  3QF7 A;  4I7Z B;  5KA6 A;  3LSU A;  1ZOY C;  3MZW B;  1J1E C;  2ITD C;  4U3J B;  2RKL A;  1US6 A;  5C93 A;  3E1R A;  3B4S A;  3AK3 A;  3JAL A;  1VQ9 V;  3MHV A;  3VMZ A;  2OTJ P;  3S9O A;  1MV8 A;  2OCH A;  4LF5 B;  3H1J J;  3U11 A;  2WIT A;  3CCS V; 
#chains in the Genus database with same CATH homology
 3B4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...