3B5BA

Crystal structure of the thymidylate synthase k48q
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
264
structure length
264
Chain Sequence
MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTQRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of an invariant lysine residue in folate binding on Escherichia coli thymidylate synthase: Calorimetric and crystallographic analysis of the K48Q mutant.
pubmed doi rcsb
molecule keywords Thymidylate synthase
molecule tags Transferase
source organism Escherichia coli bl21
total genus 81
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3b5bA00
4EZ8A 3BGXA 3IK0A 1FFLA 1TDAA 2FTQA 3DGAC 3HBBA 4JEFA 3N5GA 3IX6A 4UP1A 3UM5A 3UWLA 1BIDA 1AIQA 3UWLB 1F4FA 4EILA 1KZIA 1TYSA 3B5BA 3DG8C 1LCEA 4FQSA 2G8DA 2VF0A 1TSWA 1QZFA 1BSFA 3KJSA 4O1UA 1TVWA 1B5EA 3EJLA 3IRMA 3QGTA 1JTUA 2FTNA 1JUJA 1F4BA 2H2QA 1TRGA 3BHLA 3QG2A 2AAZA 1JMIA 1EV5A 2TDMA 3EDWX 3BZ0A 4KNZA 1VZAA 3HB8A 1AN5A 1KZJA 2VETA 3H9KA 1DDUA 1TSXA 5J7WA 1VZDA 1TSDA 1I00A 1ZPRA 1B5DA 1HVYA 3GG5A 3BFIA 4G2OX 3DL5A 4H0RA 3ED7A 1JG0A 3IK1A 3KGBA 1F28A 2G86A 1NJEA 4O1XA 1AOBA 4EINA 1F4EA 3DL6A 3N5EA 3N5EB 1BSPA 4GD7A 4KY4A 4DQ1A 3C06A 1TVVA 4E28A 3BYXA 1J3IC 1TDBA 2FTOX 3V8HA 5H38A 1CI7A 3C0AA 3B9HA 1LCAA 3EHIX 4FOXA 4ISKA 1NJCA 1JMHA 4DPDA 4FGTA 1TDUA 4IQBA 4XSEA 4ECKA 1J3KC 4O7UA 3IRNA 1BKPA 1FWMA 2TSRA 1BO8A 5H39A 4DPHA 4F2VA 1HZWA 1TSZA 3NRRA 1B49A 1VZCA 4GYHA 4TMSA 4FOGA 4H0UA 1KCEA 4KYAA 3IJZA 4DP3A 1HW3A 2TDDA 4ISWA 5HS3A 1BDUA 3KJRA 3GH0A 1LCBA 3IROA 1BQ1A 1VZEA 3K2HA 4O1XD 1RTSA 1TSYA 1QQQA 2BBQA 3CL9A 1EVFA 4XSDA 3UM8A 3QJ7A 1EV8A 3I3RA 1SYNA 1F4DA 3CLBA 2G8AA 1VZBA 4XSCA 2RDAA 1BJGA 4G6WX 1YPVA 4E5OA 1BO7A 1J3JC 1TSVA 1BKOA 3GH2X 1JMGA 1THYA 1F4CA 1NJBA 1AXWA 1BP0A 1TVUA 2TSCA 4IRRA 3EAWX 1JMFA 3TMSA 1B02A 3INVA 5FCTA 1NCEA 1TJSA 1TSNA 1TDCA 3EBUA 3BNZA 1BQ2A 3UM6A 1TSMA 1F4GA 4KPWA 4KY8A 2G8XA 2OIPA 4Q0EA 1BP6A 1BPJA 4H1IA 2KCEA 5BY6A 1TISA 4GEVA 1TSLA 3HJ3A 1JUTA 1TLCA 3EGYX 4Q0DA 4EB4A 1AJMA 3IHIA 5WRNA 1EVGA 3OB7A 1DNAA 1HW4A 3BHRA 4LRRA 4PSGA 3EF9A 5H3AA 1JU6A 4FOAA 2ONBA 1NJAA 2A9WA 1SEJA 3JSUA 2RD8A 1JTQA 2RD8B 1NJDA 4IQQA 2G89A 1TLSA
chains in the Genus database with same CATH superfamily
4EZ8A 3BGXA 3IK0A 1FFLA 1TDAA 2FTQA 3DGAC 3HBBA 4JEFA 3N5GA 3IX6A 4UP1A 3UM5A 3UWLA 1BIDA 1AIQA 3UWLB 1F4FA 4EILA 1KZIA 1TYSA 3B5BA 3DG8C 1LCEA 4FQSA 2G8DA 2VF0A 1TSWA 1QZFA 1BSFA 3KJSA 4O1UA 1TVWA 1B5EA 3EJLA 3IRMA 3QGTA 1JTUA 2FTNA 1JUJA 1F4BA 2H2QA 1TRGA 3BHLA 3QG2A 2AAZA 1JMIA 1EV5A 2TDMA 3EDWX 3BZ0A 4KNZA 1VZAA 3HB8A 1AN5A 1KZJA 2VETA 3H9KA 1DDUA 1TSXA 5J7WA 1VZDA 1TSDA 1I00A 1ZPRA 1B5DA 1HVYA 3GG5A 3BFIA 4G2OX 3DL5A 4H0RA 3ED7A 1JG0A 3IK1A 3KGBA 1F28A 2G86A 1NJEA 4O1XA 1AOBA 4EINA 1F4EA 3DL6A 3N5EA 3N5EB 1BSPA 4GD7A 4KY4A 4DQ1A 3C06A 1TVVA 4E28A 3BYXA 1J3IC 1TDBA 2FTOX 3V8HA 5H38A 1CI7A 3C0AA 3B9HA 1LCAA 3EHIX 4FOXA 4ISKA 1NJCA 1JMHA 4DPDA 4FGTA 1TDUA 4IQBA 4XSEA 4ECKA 1J3KC 4O7UA 3IRNA 1BKPA 1FWMA 2TSRA 1BO8A 5H39A 4DPHA 4F2VA 1HZWA 1TSZA 3NRRA 1B49A 1VZCA 4GYHA 4TMSA 4FOGA 4H0UA 1KCEA 4KYAA 3IJZA 4DP3A 1HW3A 2TDDA 4ISWA 5HS3A 1BDUA 3KJRA 3GH0A 1LCBA 3IROA 1BQ1A 1VZEA 3K2HA 4O1XD 1RTSA 1TSYA 1QQQA 2BBQA 3CL9A 1EVFA 4XSDA 3UM8A 3QJ7A 1EV8A 3I3RA 1SYNA 1F4DA 3CLBA 2G8AA 1VZBA 4XSCA 2RDAA 1BJGA 4G6WX 1YPVA 4E5OA 1BO7A 1J3JC 1TSVA 1BKOA 3GH2X 1JMGA 1THYA 1F4CA 1NJBA 1AXWA 1BP0A 1TVUA 2TSCA 4IRRA 3EAWX 1JMFA 3TMSA 1B02A 3INVA 5FCTA 1NCEA 1TJSA 1TSNA 1TDCA 3EBUA 3BNZA 1BQ2A 3UM6A 1TSMA 1F4GA 4KPWA 4KY8A 2G8XA 2OIPA 4Q0EA 1BP6A 1BPJA 4H1IA 2KCEA 5BY6A 1TISA 4GEVA 1TSLA 3HJ3A 1JUTA 1TLCA 3EGYX 4Q0DA 4EB4A 1AJMA 3IHIA 5WRNA 1EVGA 3OB7A 1DNAA 1HW4A 3BHRA 4LRRA 4PSGA 3EF9A 5H3AA 1JU6A 4FOAA 2ONBA 1NJAA 2A9WA 1SEJA 3JSUA 2RD8A 1JTQA 2RD8B 1NJDA 4IQQA 2G89A 1TLSA
chains in the Genus database with same CATH topology
4EZ8A 3BGXA 3IK0A 1FFLA 1TDAA 2FTQA 3DGAC 3HBBA 4JEFA 3N5GA 3IX6A 4UP1A 3UM5A 3UWLA 1BIDA 1AIQA 3UWLB 1F4FA 4EILA 1KZIA 1TYSA 3B5BA 3DG8C 1LCEA 4FQSA 2G8DA 2VF0A 1TSWA 1QZFA 1BSFA 3KJSA 4O1UA 1TVWA 1B5EA 3EJLA 3IRMA 3QGTA 1JTUA 2FTNA 1JUJA 1F4BA 2H2QA 1TRGA 3BHLA 3QG2A 2AAZA 1JMIA 1EV5A 2TDMA 3EDWX 3BZ0A 4KNZA 1VZAA 3HB8A 1AN5A 1KZJA 2VETA 3H9KA 1DDUA 1TSXA 5J7WA 1VZDA 1TSDA 1I00A 1ZPRA 1B5DA 1HVYA 3GG5A 3BFIA 4G2OX 3DL5A 4H0RA 3ED7A 1JG0A 3IK1A 3KGBA 1F28A 2G86A 1NJEA 4O1XA 1AOBA 4EINA 1F4EA 3DL6A 3N5EA 3N5EB 1BSPA 4GD7A 4KY4A 4DQ1A 3C06A 1TVVA 4E28A 3BYXA 1J3IC 1TDBA 2FTOX 3V8HA 5H38A 1CI7A 3C0AA 3B9HA 1LCAA 3EHIX 4FOXA 4ISKA 1NJCA 1JMHA 4DPDA 4FGTA 1TDUA 4IQBA 4XSEA 4ECKA 1J3KC 4O7UA 3IRNA 1BKPA 1FWMA 2TSRA 1BO8A 5H39A 4DPHA 4F2VA 1HZWA 1TSZA 3NRRA 1B49A 1VZCA 4GYHA 4TMSA 4FOGA 4H0UA 1KCEA 4KYAA 3IJZA 4DP3A 1HW3A 2TDDA 4ISWA 5HS3A 1BDUA 3KJRA 3GH0A 1LCBA 3IROA 1BQ1A 1VZEA 3K2HA 4O1XD 1RTSA 1TSYA 1QQQA 2BBQA 3CL9A 1EVFA 4XSDA 3UM8A 3QJ7A 1EV8A 3I3RA 1SYNA 1F4DA 3CLBA 2G8AA 1VZBA 4XSCA 2RDAA 1BJGA 4G6WX 1YPVA 4E5OA 1BO7A 1J3JC 1TSVA 1BKOA 3GH2X 1JMGA 1THYA 1F4CA 1NJBA 1AXWA 1BP0A 1TVUA 2TSCA 4IRRA 3EAWX 1JMFA 3TMSA 1B02A 3INVA 5FCTA 1NCEA 1TJSA 1TSNA 1TDCA 3EBUA 3BNZA 1BQ2A 3UM6A 1TSMA 1F4GA 4KPWA 4KY8A 2G8XA 2OIPA 4Q0EA 1BP6A 1BPJA 4H1IA 2KCEA 5BY6A 1TISA 4GEVA 1TSLA 3HJ3A 1JUTA 1TLCA 3EGYX 4Q0DA 4EB4A 1AJMA 3IHIA 5WRNA 1EVGA 3OB7A 1DNAA 1HW4A 3BHRA 4LRRA 4PSGA 3EF9A 5H3AA 1JU6A 4FOAA 2ONBA 1NJAA 2A9WA 1SEJA 3JSUA 2RD8A 1JTQA 2RD8B 1NJDA 4IQQA 2G89A 1TLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZ8 A;  3BGX A;  3IK0 A;  1FFL A;  1TDA A;  2FTQ A;  3DGA C;  3HBB A;  4JEF A;  3N5G A;  3IX6 A;  4UP1 A;  3UM5 A;  3UWL A;  1BID A;  1AIQ A;  3UWL B;  1F4F A;  4EIL A;  1KZI A;  1TYS A;  3B5B A;  3DG8 C;  1LCE A;  4FQS A;  2G8D A;  2VF0 A;  1TSW A;  1QZF A;  1BSF A;  3KJS A;  4O1U A;  1TVW A;  1B5E A;  3EJL A;  3IRM A;  3QGT A;  1JTU A;  2FTN A;  1JUJ A;  1F4B A;  2H2Q A;  1TRG A;  3BHL A;  3QG2 A;  2AAZ A;  1JMI A;  1EV5 A;  2TDM A;  3EDW X;  3BZ0 A;  4KNZ A;  1VZA A;  3HB8 A;  1AN5 A;  1KZJ A;  2VET A;  3H9K A;  1DDU A;  1TSX A;  5J7W A;  1VZD A;  1TSD A;  1I00 A;  1ZPR A;  1B5D A;  1HVY A;  3GG5 A;  3BFI A;  4G2O X;  3DL5 A;  4H0R A;  3ED7 A;  1JG0 A;  3IK1 A;  3KGB A;  1F28 A;  2G86 A;  1NJE A;  4O1X A;  1AOB A;  4EIN A;  1F4E A;  3DL6 A;  3N5E A;  3N5E B;  1BSP A;  4GD7 A;  4KY4 A;  4DQ1 A;  3C06 A;  1TVV A;  4E28 A;  3BYX A;  1J3I C;  1TDB A;  2FTO X;  3V8H A;  5H38 A;  1CI7 A;  3C0A A;  3B9H A;  1LCA A;  3EHI X;  4FOX A;  4ISK A;  1NJC A;  1JMH A;  4DPD A;  4FGT A;  1TDU A;  4IQB A;  4XSE A;  4ECK A;  1J3K C;  4O7U A;  3IRN A;  1BKP A;  1FWM A;  2TSR A;  1BO8 A;  5H39 A;  4DPH A;  4F2V A;  1HZW A;  1TSZ A;  3NRR A;  1B49 A;  1VZC A;  4GYH A;  4TMS A;  4FOG A;  4H0U A;  1KCE A;  4KYA A;  3IJZ A;  4DP3 A;  1HW3 A;  2TDD A;  4ISW A;  5HS3 A;  1BDU A;  3KJR A;  3GH0 A;  1LCB A;  3IRO A;  1BQ1 A;  1VZE A;  3K2H A;  4O1X D;  1RTS A;  1TSY A;  1QQQ A;  2BBQ A;  3CL9 A;  1EVF A;  4XSD A;  3UM8 A;  3QJ7 A;  1EV8 A;  3I3R A;  1SYN A;  1F4D A;  3CLB A;  2G8A A;  1VZB A;  4XSC A;  2RDA A;  1BJG A;  4G6W X;  1YPV A;  4E5O A;  1BO7 A;  1J3J C;  1TSV A;  1BKO A;  3GH2 X;  1JMG A;  1THY A;  1F4C A;  1NJB A;  1AXW A;  1BP0 A;  1TVU A;  2TSC A;  4IRR A;  3EAW X;  1JMF A;  3TMS A;  1B02 A;  3INV A;  5FCT A;  1NCE A;  1TJS A;  1TSN A;  1TDC A;  3EBU A;  3BNZ A;  1BQ2 A;  3UM6 A;  1TSM A;  1F4G A;  4KPW A;  4KY8 A;  2G8X A;  2OIP A;  4Q0E A;  1BP6 A;  1BPJ A;  4H1I A;  2KCE A;  5BY6 A;  1TIS A;  4GEV A;  1TSL A;  3HJ3 A;  1JUT A;  1TLC A;  3EGY X;  4Q0D A;  4EB4 A;  1AJM A;  3IHI A;  5WRN A;  1EVG A;  3OB7 A;  1DNA A;  1HW4 A;  3BHR A;  4LRR A;  4PSG A;  3EF9 A;  5H3A A;  1JU6 A;  4FOA A;  2ONB A;  1NJA A;  2A9W A;  1SEJ A;  3JSU A;  2RD8 A;  1JTQ A;  2RD8 B;  1NJD A;  4IQQ A;  2G89 A;  1TLS A; 
#chains in the Genus database with same CATH topology
 4EZ8 A;  3BGX A;  3IK0 A;  1FFL A;  1TDA A;  2FTQ A;  3DGA C;  3HBB A;  4JEF A;  3N5G A;  3IX6 A;  4UP1 A;  3UM5 A;  3UWL A;  1BID A;  1AIQ A;  3UWL B;  1F4F A;  4EIL A;  1KZI A;  1TYS A;  3B5B A;  3DG8 C;  1LCE A;  4FQS A;  2G8D A;  2VF0 A;  1TSW A;  1QZF A;  1BSF A;  3KJS A;  4O1U A;  1TVW A;  1B5E A;  3EJL A;  3IRM A;  3QGT A;  1JTU A;  2FTN A;  1JUJ A;  1F4B A;  2H2Q A;  1TRG A;  3BHL A;  3QG2 A;  2AAZ A;  1JMI A;  1EV5 A;  2TDM A;  3EDW X;  3BZ0 A;  4KNZ A;  1VZA A;  3HB8 A;  1AN5 A;  1KZJ A;  2VET A;  3H9K A;  1DDU A;  1TSX A;  5J7W A;  1VZD A;  1TSD A;  1I00 A;  1ZPR A;  1B5D A;  1HVY A;  3GG5 A;  3BFI A;  4G2O X;  3DL5 A;  4H0R A;  3ED7 A;  1JG0 A;  3IK1 A;  3KGB A;  1F28 A;  2G86 A;  1NJE A;  4O1X A;  1AOB A;  4EIN A;  1F4E A;  3DL6 A;  3N5E A;  3N5E B;  1BSP A;  4GD7 A;  4KY4 A;  4DQ1 A;  3C06 A;  1TVV A;  4E28 A;  3BYX A;  1J3I C;  1TDB A;  2FTO X;  3V8H A;  5H38 A;  1CI7 A;  3C0A A;  3B9H A;  1LCA A;  3EHI X;  4FOX A;  4ISK A;  1NJC A;  1JMH A;  4DPD A;  4FGT A;  1TDU A;  4IQB A;  4XSE A;  4ECK A;  1J3K C;  4O7U A;  3IRN A;  1BKP A;  1FWM A;  2TSR A;  1BO8 A;  5H39 A;  4DPH A;  4F2V A;  1HZW A;  1TSZ A;  3NRR A;  1B49 A;  1VZC A;  4GYH A;  4TMS A;  4FOG A;  4H0U A;  1KCE A;  4KYA A;  3IJZ A;  4DP3 A;  1HW3 A;  2TDD A;  4ISW A;  5HS3 A;  1BDU A;  3KJR A;  3GH0 A;  1LCB A;  3IRO A;  1BQ1 A;  1VZE A;  3K2H A;  4O1X D;  1RTS A;  1TSY A;  1QQQ A;  2BBQ A;  3CL9 A;  1EVF A;  4XSD A;  3UM8 A;  3QJ7 A;  1EV8 A;  3I3R A;  1SYN A;  1F4D A;  3CLB A;  2G8A A;  1VZB A;  4XSC A;  2RDA A;  1BJG A;  4G6W X;  1YPV A;  4E5O A;  1BO7 A;  1J3J C;  1TSV A;  1BKO A;  3GH2 X;  1JMG A;  1THY A;  1F4C A;  1NJB A;  1AXW A;  1BP0 A;  1TVU A;  2TSC A;  4IRR A;  3EAW X;  1JMF A;  3TMS A;  1B02 A;  3INV A;  5FCT A;  1NCE A;  1TJS A;  1TSN A;  1TDC A;  3EBU A;  3BNZ A;  1BQ2 A;  3UM6 A;  1TSM A;  1F4G A;  4KPW A;  4KY8 A;  2G8X A;  2OIP A;  4Q0E A;  1BP6 A;  1BPJ A;  4H1I A;  2KCE A;  5BY6 A;  1TIS A;  4GEV A;  1TSL A;  3HJ3 A;  1JUT A;  1TLC A;  3EGY X;  4Q0D A;  4EB4 A;  1AJM A;  3IHI A;  5WRN A;  1EVG A;  3OB7 A;  1DNA A;  1HW4 A;  3BHR A;  4LRR A;  4PSG A;  3EF9 A;  5H3A A;  1JU6 A;  4FOA A;  2ONB A;  1NJA A;  2A9W A;  1SEJ A;  3JSU A;  2RD8 A;  1JTQ A;  2RD8 B;  1NJD A;  4IQQ A;  2G89 A;  1TLS A; 
#chains in the Genus database with same CATH homology
 4EZ8 A;  3BGX A;  3IK0 A;  1FFL A;  1TDA A;  2FTQ A;  3DGA C;  3HBB A;  4JEF A;  3N5G A;  3IX6 A;  4UP1 A;  3UM5 A;  3UWL A;  1BID A;  1AIQ A;  3UWL B;  1F4F A;  4EIL A;  1KZI A;  1TYS A;  3B5B A;  3DG8 C;  1LCE A;  4FQS A;  2G8D A;  2VF0 A;  1TSW A;  1QZF A;  1BSF A;  3KJS A;  4O1U A;  1TVW A;  1B5E A;  3EJL A;  3IRM A;  3QGT A;  1JTU A;  2FTN A;  1JUJ A;  1F4B A;  2H2Q A;  1TRG A;  3BHL A;  3QG2 A;  2AAZ A;  1JMI A;  1EV5 A;  2TDM A;  3EDW X;  3BZ0 A;  4KNZ A;  1VZA A;  3HB8 A;  1AN5 A;  1KZJ A;  2VET A;  3H9K A;  1DDU A;  1TSX A;  5J7W A;  1VZD A;  1TSD A;  1I00 A;  1ZPR A;  1B5D A;  1HVY A;  3GG5 A;  3BFI A;  4G2O X;  3DL5 A;  4H0R A;  3ED7 A;  1JG0 A;  3IK1 A;  3KGB A;  1F28 A;  2G86 A;  1NJE A;  4O1X A;  1AOB A;  4EIN A;  1F4E A;  3DL6 A;  3N5E A;  3N5E B;  1BSP A;  4GD7 A;  4KY4 A;  4DQ1 A;  3C06 A;  1TVV A;  4E28 A;  3BYX A;  1J3I C;  1TDB A;  2FTO X;  3V8H A;  5H38 A;  1CI7 A;  3C0A A;  3B9H A;  1LCA A;  3EHI X;  4FOX A;  4ISK A;  1NJC A;  1JMH A;  4DPD A;  4FGT A;  1TDU A;  4IQB A;  4XSE A;  4ECK A;  1J3K C;  4O7U A;  3IRN A;  1BKP A;  1FWM A;  2TSR A;  1BO8 A;  5H39 A;  4DPH A;  4F2V A;  1HZW A;  1TSZ A;  3NRR A;  1B49 A;  1VZC A;  4GYH A;  4TMS A;  4FOG A;  4H0U A;  1KCE A;  4KYA A;  3IJZ A;  4DP3 A;  1HW3 A;  2TDD A;  4ISW A;  5HS3 A;  1BDU A;  3KJR A;  3GH0 A;  1LCB A;  3IRO A;  1BQ1 A;  1VZE A;  3K2H A;  4O1X D;  1RTS A;  1TSY A;  1QQQ A;  2BBQ A;  3CL9 A;  1EVF A;  4XSD A;  3UM8 A;  3QJ7 A;  1EV8 A;  3I3R A;  1SYN A;  1F4D A;  3CLB A;  2G8A A;  1VZB A;  4XSC A;  2RDA A;  1BJG A;  4G6W X;  1YPV A;  4E5O A;  1BO7 A;  1J3J C;  1TSV A;  1BKO A;  3GH2 X;  1JMG A;  1THY A;  1F4C A;  1NJB A;  1AXW A;  1BP0 A;  1TVU A;  2TSC A;  4IRR A;  3EAW X;  1JMF A;  3TMS A;  1B02 A;  3INV A;  5FCT A;  1NCE A;  1TJS A;  1TSN A;  1TDC A;  3EBU A;  3BNZ A;  1BQ2 A;  3UM6 A;  1TSM A;  1F4G A;  4KPW A;  4KY8 A;  2G8X A;  2OIP A;  4Q0E A;  1BP6 A;  1BPJ A;  4H1I A;  2KCE A;  5BY6 A;  1TIS A;  4GEV A;  1TSL A;  3HJ3 A;  1JUT A;  1TLC A;  3EGY X;  4Q0D A;  4EB4 A;  1AJM A;  3IHI A;  5WRN A;  1EVG A;  3OB7 A;  1DNA A;  1HW4 A;  3BHR A;  4LRR A;  4PSG A;  3EF9 A;  5H3A A;  1JU6 A;  4FOA A;  2ONB A;  1NJA A;  2A9W A;  1SEJ A;  3JSU A;  2RD8 A;  1JTQ A;  2RD8 B;  1NJD A;  4IQQ A;  2G89 A;  1TLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...