3B5JA

Crystal structures of the s504a mutant of an isolated abc-atpase in complex with tnp-adp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
243
structure length
243
Chain Sequence
HHDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-hemolysin translocation ATP-binding protein hlyB
publication title Water-mediated protein-fluorophore interactions modulate the affinity of an ABC-ATPase/TNP-ADP complex
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 73
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2007-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3b5jA00
2OCPA 3KTAB 5BN4A 4A0RA 2QN6A 1ONBA 1RZ3A 2EFHB 3EXAA 2GDJA 3SHWA 3A37A 4KVGA 2G1JA 2NO0A 2ZS7A 4LV6A 4D4LA 3CPHA 3W9YA 2AN9A 3P32A 1RFLA 1NMXA 2WJJA 2ZI6A 4TTPA 2ZYUX 4TYNA 3MAAC 1M2OB 1CU1A 2BKUA 4PX9A 3SYKA 1R8QA 4JKYA 5GVRA 4IOJA 2JLXA 1TQDA 5EP4A 2QT1A 4WW0A 1YHNA 5HTKA 3K53A 1UKZA 1J90A 1E2FA 3TAHA 2CL6X 1MV5A 2QTHA 4ACAA 4DSOA 2XGJA 1MABA 4DLZA 2V6IA 4RFVA 4NCHA 1MABB 1OIWA 5A4JA 1Q21A 4BLSA 1II0A 2JGNA 4AKHA 4FWTA 3M4YA 4XOIA 1AK2A 2GTPA 1UAAA 4GMDA 4I81A 4IEEA 1YZGA 4Q01A 5FL7A 1YRBA 4UNQA 1NG1A 1L2TA 2MSCB 5KTYA 3KKPA 3IO3A 1RRGA 4JL6A 1DAEA 1TADA 1KMHA 1KDRA 1SVMA 1KMHB 1TU4A 3BXZA 3SZRA 2JJ1A 1TF5A 2SHKA 4MGIR 2FEOA 1WRBA 4LYJA 5K8LA 2PBRA 5JI3E 4GRAA 3KDSE 4CEIA 1MT0A 3BB4A 2F1RA 2ZUCA 4CEIB 4NBSA 4RCYA 4M53A 5C1BA 4KAXA 3FTQA 2VSFA 3AVUA 5FTKA 3PUWA 2PZFA 3Q5EA 1FFHA 2R6GA 2H7VA 3K8YA 4TMWA 2W0SA 4JIMA 4TSFA 1CJUC 5E95A 4QHYA 2P65A 3RNLA 1JPNA 4OYHA 4AURA 5EJEA 3A4NA 1I4DD 3CF2A 3CNOA 5DHFA 4DKXA 4G3XA 1P3JA 2WWHA 1IONA 1M7BA 4BFVA 2IYUA 5FTLA 3QI2A 5CDFA 4G1UC 4ZO4A 2X8AA 3SI7A 1NBMA 4IDPA 1OLOA 3SOPA 3VNUA 1NN3A 1AS0A 2F1JA 2ZRDA 4OKSA 2ZE8A 4XTCS 1UM8A 3I72A 2WMOB 1Z3IX 4OHZA 5JRJA 1M1YE 2XTZA 3AVPA 3R8CA 1P2TA 2OBMA 2XB2A 5HCNA 4ZDWA 1T8TA 1G6HA 1KSFX 4K8OA 1Z63A 3P4YA 1E2NA 521PA 2IA5A 1AZTA 4LV8B 4NCNA 4XWAA 2HCBA 1YQTA 2CK3A 3ZD6A 1G7SA 5ELXA 1RYFA 3VKGA 4B2PA 5DI9A 2OT3B 3BH7A 1WP9A 3GD7A 1OFTA 5FBQB 2WPDA 1GL9B 2JDIA 3B13B 1ZNYA 3PUXA 1QZXA 2F9LA 4Q4JA 5IRCD 4ARZA 4Q4JB 2P6RA 4Q1CA 4ARZB 821PA 4QOSA 2QORA 2GILA 5HPYB 3SNHA 1W4BA 2QSZA 4DLXA 1P2VA 4NYMQ 4C0BA 2I1QA 2ZI4A 4CRWB 2ZS8A 1IXRC 1P62B 4Q47A 3BE4A 2BBTA 3MGCA 1P75A 5FOWA 3PUYA 2XZOA 4TYPA 3DMDA 4ERNA 1FNNA 2UZ3A 2YOFA 3UXMA 1GIAA 1LTQA 5BYKA 2NG1A 3CH5A 4HAVA 3RWOA 1XMVA 3KQNA 3LQQA 1XF9A 4IXMA 4EIWA 4Z54A 1OFIA 4FMDB 2CDNA 2KBFA 3I8XA 2K5UA 2C99A 2A5FA 2B7BA 2CLCX 2FPMA 2VBCA 3MWLA 3L82B 1HE1C 2NO7A 1S9HA 4ZKEA 3ZD7A 5AJWA 3IEVA 2GWHA 3BGWA 3I8SA 1EFUA 5LPNA 2CCGA 1BO6A 2IL1A 4HB4A 4Q66C 2GXUA 4QHTA 4HDQB 3FHTA 4A82A 2PCLA 4OQNA 4PC3A 1EWQA 1IN5A 2PH1A 4D81A 1ZAKA 2OCBA 5EXSA 3EPKA 1AKEA 1SVSA 4XD7D 1F2UA 2FFHA 1F2UB 1XMJA 1QG4A 2ATVA 3I3SR 2RGEA 4C4PA 4EQ6A 3KZ1E 2IW3A 4B3FX 4EQ6B 4LC0A 5FH9A 4F4CA 1WBBA 2ZS9A 2PT5A 2ZSDA 3NH9A 1W2HA 4E07A 4PSAA 2X77A 4NCIA 4ZDKA 1Z0JA 3VR3A 4LDJA 1P72A 4Z1MD 1Z5ZA 1E9RA 2CHVA 3QG1A 4H1VA 4LBWA 4RKEA 1T3LA 5FR1A 4QM6A 1GG2A 3BERA 3QPUA 3OHMA 1BOFA 1QRAA 2XOKA 1BMFA 3EASA 1R4AA 3SE0A 2QMUA 3FB4A 3W6NA 1E9DA 2IBMA 4Q00A 4MKHA 4Q18A 3ZYCA 1VYVA 3CUEF 1NJFA 2A2ZA 1U98A 5JCPA 4V0KA 4R9UC 2OAP1 2JLYA 1Z2AA 3GQBA 1PJRA 1G3MA 4Q9HA 2ODEA 4KI0A 3LLMA 5CYOA 4H1UA 4JLJA 2NZJA 4HUTA 1GKYA 3KXKA 2JCSA 2E9SA 1KI4A 2IYSA 2ZJBA 3QPWA 2NTYC 4PQFA 3GLIE 2JLWA 1P4SA 2HT1A 5DH9A 1IN4A 1XJCA 2J45A 2CE7A 4A0FA 1G16A 3LFUA 4G5QA 3NHBA 2H1LA 2VP2A 4QNRA 2GBLC 2JASA 3WBKA 1SKQA 3DMNA 2ANBA 1NN0A 2R65A 2ZRMA 2OCYC 3KJEA 1WMSA 4W7SA 3T1VA 3GJ0A 1P7CA 4IFBA 1QVAA 4II7A 5AUNB 3Q3JB 1IQPA 1LW7A 3LWNA 4HLCA 4KCGA 3X1DA 4ABYA 3B1XA 1FMLA 2XZPA 3RC8A 4G5GA 3X1ZA 3KKNA 2ZRPA 1TAGA 4Q7MB 4UXJA 1GUAA 2VHQA 2ZJ8A 2J9RA 2VHUA 1QHNA 1NL3A 1MO4A 3NVAA 3DKVA 3ADCA 3PUZA 1NLYA 2DFLA 1E1QD 2ERXA 1KI3A 1XEFA 2ZANA 2BKEA 1TX4B 2X2EA 3CLVA 2QP3A 3LXXA 4JSTA 2NOAA 4D0NA 2AWNA 3W3AA 3FMFA 1E0KA 4OK5A 4M1MA 4V03A 2C03A 1FX0A 2JLQA 1DAFA 1FX0B 2QZ4A 4FI3C 3WY9A 3FKSD 1KDOA 2XJ4A 5K8TA 3K9NA 4FWIB 1DADA 2ZSEA 3K0CC 1SXJA 4C2UA 4LC1A 1SXJB 5L3SA 1BS1A 2FFAA 5L3SB 4G5OA 3ND9A 3LBIA 4UKDA 4CZ2A 4Z51A 4DSTA 2REBA 2O8FA 4A2WA 3TUIC 2O8FB 5DISB 2XB4A 2V3CC 4YDHB 3THXA 1YZKA 1UEIA 3THXB 2GA8A 4M1WA 2MMGA 2JLZA 2REOA 3K0AA 3L2OB 3R9XA 4BFZA 1R0WA 3K0AB 1XJ0A 5F98A 2QP9X 2J7PA 4Q19A 2W83A 2J1LA 2IYRA 4V0ME 4MGKR 5CM9C 3ICQB 2ODNA 1OXUA 4MYUA 4ZKDA 2FDCA 4MDEA 2J46A 3ZVNA 1S9DA 2EWVA 2PX3A 1S1CA 3GEEA 1OT3A 4I99A 5EE1A 4PPNA 2RGNC 3T5DA 2W6ID 3LW8A 4EFMA 2PMKA 5TV2A 3BOSA 5EUQB 3KQUA 2HXSA 2OUKA 1P60A 4MITA 4UNSA 1F60A 5SZKB 2C8VA 3TGPA 1Z07A 3TUJC 421PA 4LJ4A 4YC7A 1GL6A 4FCTA 3EPLA 4KVAA 1UDXA 4BFSA 1Q3TA 4XWKA 3RAPR 1VG1A 4RZXA 4YDSA 4PC2A 1M34E 1DO0A 3BFKA 1F5NA 5D3QA 1Y63A 3WYAA 3MWYW 2LKCA 4S2EA 2JATA 1T5IA 3AB3A 5LD2B 3PR1A 1KKMA 4LOAA 4O3MA 4UNRA 2JLUA 2OFWA 1FQJA 2BDTA 3TW4A 4D82A 1D8TA 1OHHD 1E0JA 1J70A 4MUAA 2AXPA 1OFHA 1W0KD 2PLFA 4I1OA 2IS6A 3KJHA 3QXXA 3RRYA 4MRSA 1G18A 2QGNA 4PC7A 4MYHA 1ZVQA 5JBQA 4HAZA 1VCOA 4H9GA 4OQFA 1NIPA 3E5HA 2OBLA 2WJHA 4HAXA 1MKYA 4JBXA 1Z6TA 1PLJA 2VH5R 5B30A 3A1TA 1GITA 4PZYA 2AWOA 1G4AE 5FPSA 1KIMA 4FINA 3KFXA 4AIIA 2GF0A 2ZVPX 3P1JA 1T6NA 3FFAA 1KK2A 4ZCIA 3BH6A 1TTTA 4MGZR 3LX8A 1KY3A 1ZM2A 4JLPA 4PAOA 2Q9AA 1VHLA 3THOA 3L0PA 4PQYA 2ORWA 1Z0KA 3OZXA 4EPYA 3TVTA 4XH9B 3RS5A 1XEWX 3RLFA 1G8FA 3PV0A 4ESVA 2WOJA 4OI1A 4Q9JA 1G21E 1ESNA 1SVKA 3C16C 4BPBA 4KYUA 1Z06A 1CKEA 4RY2A 3PJRA 5IHPA 2O0HA 1G1MA 1T5LA 3A4MA 4WOPA 3EW9A 3UIEA 4E5UA 3WMFA 1CR1A 2WZQA 1E79A 3K70C 4O2RA 5JRZA 1TMKA 4A0GA 4O0MA 4XVQA 3VX4A 4OBEA 4TT3A 2DYKA 1BYIA 3D3QA 4QJ4A 1ZC4A 3GFTA 3RRMA 3R20A 1YE8A 1I2DA 3QXHA 3W8RA 1G8GA 4G01B 4DT1A 4XWOA 4DT1B 2NPIA 5CYPA 1OKKD 3B1ZA 2ZU6A 2XX3A 2H5EA 2GESA 3IQWA 4ZDJA 2FSIA 3MFYA 1R5NA 2D3WA 3QNUA 5KSPA 1CF4A 1RE0A 4DDVA 2NIPA 3H86A 2VTKA 4DIEA 3AVXA 2BEKA 2ZYVX 2R9VA 3SFZA 1ZM9A 2DFKB 4IKEA 4PANA 2WWFA 2KWIA 1Z28A 1P9WA 4B75A 2F43A 2J87A 3N5CA 2F43B 4Q02A 5D3MA 4DCTA 4GI7A 1G5PA 2IYTA 2ONKA 4K81B 5D3MB 1VTKA 1NKTA 2GZAA 2WOOA 3UANA 3CWZA 2B8TA 2BVNA 3TVDA 2R8RA 4I1UA 1VMAA 2ZRFA 2GCNA 1B23P 1VG8A 2VHCA 1XZPA 2GK7A 2ASEA 2ZR7A 2ZRLA 1XXHE 4Q1DA 2C2HA 3U7EB 1YR6A 3QKSA 3X1XA 4RSGA 1N5JA 4N0DA 1DVRA 2ZEJA 3I5YA 4TMXA 2J0SA 1FOEB 3ZQJA 4W5WA 1KZGB 4WBSA 121PA 3IIJA 2GJ9A 3SFVA 3ZQ6A 3FMPB 2ZR9A 5BYJA 1CLUA 1J2JA 3L43A 4D0GA 3W5IA 5EXPA 4ZCLA 4Q7KA 1HY3A 2OXRA 4YLGA 1MO6A 2VEDA 2C96A 4NYJR 4BGDA 4GPTA 4LJAA 4BLRA 1OIXA 2OXCA 3TKLA 1A2KC 1CJMA 1CS4C 2QSYA 4LZZA 2FNAA 4C0LA 5LB4A 4NTZA 3ZGXA 5FFMA 4HDOB 5F3WB 3E2IA 1Q20A 3QKTA 1D2EA 2OG2A 3LO5A 3W8NA 4QRHA 2D7CA 3HPQA 3QJYA 2HT6A 2JJ8A 3IBGA 3AVOA 3MJRA 3I73A 5EP3A 5G3YA 4IDQA 1GRRA 1RIFA 2H8KA 4LJ7A 2OESA 3WP0A 1TQ2A 4W9MC 2DHRA 4HEJA 3QG5A 2O8DA 3AP3A 1ZD1A 2D06A 2O8DB 3PXGA 3TW8B 4Q7JB 2QA5A 1JAHA 1ZBDA 2AHOA 3AUYA 1I4LD 4PHHA 2DFTA 3AVQA 2GJSA 2VP4A 3AGQA 2QPOA 4CGZA 3SJAA 1R2QA 1JXMA 2JEOA 3NH6A 4QHSA 4LJ5A 1UKEA 4GDFA 5CITA 2NZ8A 2NPFA 1NVUQ 1QHSA 1IXSB 4BZQA 3TJZA 1CJVC 4JMPA 1E2GA 2QBYA 2YC2C 2CHGA 2QBYB 2FZLA 1G7RA 2YINC 3ZH9B 4P4UA 1VPLA 3F8TA 1XX6A 3W6PA 1MRNA 4Q4HA 1JBKA 2IXEA 5J4LA 4Q4HB 1JXOA 1N5IA 3K0SA 3CX7A 2GEVA 3FYHA 1GM5A 4US0R 4FIDA 1KO5A 4L8GA 1QHYA 3RWMB 2ZE5A 1GDDA 2ECKA 1Z29A 4LHVA 2G9NA 4CT4B 3EA5A 4GZMA 4A4DA 2ZRIA 1DOAA 1PLKA 1Z8FA 4HB3A 4LJ9A 1HEIA 1I4TD 4JSYA 4AYWA 1H8HD 5BWMA 1RPZA 4N3NA 2FWRA 3I4LA 3RC3A 3KFVA 1AJEA 4LHXA 5FPYA 5DN6D 4HLQB 5HCIA 3SHFA 4F91B 1II9A 1XTRA 3F5FA 2Q3FA 2RH5A 2HJVA 4DLUA 1GZSA 1DBSA 2BJWA 4K46A 5EE5B 1OV4A 4B47A 4XD7A 3EPJA 5FUWA 5KYKA 1AQUA 5GJVC 2REXB 2B92A 2O0KA 2AKYA 1COWD 3EZFA 2RGDA 1LY1A 4E03A 1E2PA 1ZRHA 1X86B 1SULA 3DL0A 5C2JB 2F7SA 5EP1A 2JIZD 3C7KA 3A58B 1P73A 4JVLA 1R8SA 5FOSA 1KDTA 4DLTA 1UBEA 1VDZA 1G7TA 1N3BA 2YZ2A 2ZE6A 4DXAA 1XPOA 4M1KA 1NY5A 3LW7A 5IDVA 4Z1MA 2C78A 2IK8A 4RD4A 4RFSA 4PAQA 1GSIA 4RFSB 1Q12A 2OILA 4TZ0A 1E9BA 6Q21A 3LDAA 2V54A 3BIFA 2GK6A 2HLDD 2BOVA 4TMKA 4JLDA 4R98A 2O0JA 2CLDX 3C8UA 1N0UA 1XCGB 1OPXA 3N2IA 1JR3E 2BBOA 1YZNA 1N6LA 3BRWD 4FCWA 4L9SA 4MRNA 1EG7A 4U00A 4UXHA 4C2TA 5LBIA 1IY1A 3A4LA 4PZZA 2IS4A 2CLSA 3ZVLA 5AJZA 3CR7A 2WSMA 5CIWA 5CLQA 1FZQA 2IXFA 3QE0A 1GKIA 1C9KA 2PL3A 3EPHA 4HLDA 4DUGD 2FFBA 3K0FA 3K0FB 1U9IA 1NMYA 4A36A 1KSGA 2G77B 1CULC 1HYQA 3W5JA 1GNRA 2ORIA 1IHUA 3U3JA 5C18A 4JBWA 1S8FA 3T61A 3RS3A 1NRJB 4BRWA 2YKGA 1YJ5A 5JMTA 3P20A 4TZ6A 4QBIA 4NP6A 1NVVR 3EZ7A 3NTUA 5FUYA 1HQYE 1Z08A 4QJ3A 4YQFA 4M1YA 1IBRA 2IXGA 2ZRJA 4YONB 4AG6A 2GETA 3GJ5A 3TIFA 2Z4RA 1R10A 4QBGB 3L0IB 3PEYA 1XD2A 1A7JA 1E1QA 1XD2B 4D4MA 3ADBA 2WWXA 2Q9CA 1U8ZA 1XTJA 4DVGA 2IHYA 2OFXA 5JLJA 1KNQA 2GF9A 4V02A 3QEOA 4XIGS 3TR5A 1WB9A 1CEEA 2J0VA 3W3ZB 3GJ4A 4TL7A 3QPVA 3LA6A 5EQTA 3GLFE 3QXSA 3IKJA 4U7DA 4QFMA 3A1UA 4TLBA 2ZE7A 3FKSA 4RJLA 1TU3A 4DCNA 4F93B 1DAGA 2P6NA 4GNKA 1PUIA 2FFQA 3SU8A 3Q85A 1A1VA 3WHLA 4L5BA 2ZAMA 3MUFA 2P67A 1G4UR 3U5ZB 1Z0IA 2ZAOA 3BD9A 3ETLA 2DFNA 3V4FA 1TQ4A 2GXQA 3Q5DA 2FF7A 2J41A 2WHXA 3GMTA 1CR4A 3GJ6A 5LB2A 1LVGA 2ZROA 2WKPA 2OM2A 2YHSA 2WAXA 3U44A 1NI3A 3U44B 1ZNWA 1J99A 1FMJA 2D2EA 2H17A 1W0JD 4ZV4A 5L3RA 3O47A 3K09A 3AP2A 1AZSC 3F3YA 1W49A 4PPQA 2QTFA 4HAUA 1PLLA 1YZUA 4MH0R 2CHQA 3SYNA 4BFUA 4CEJA 2NO1A 1R6BX 3WYFA 1XRJA 4CEJB 3BB1A 4R7ZA 4YMUA 3JZMA 2IF0A 4M4SA 3GLHA 3VMFA 2QE7D 3GLHB 2O52A 3ONWA 1KYIA 1P9NA 1NNEA 4EFLA 3KQLA 3RRZA 2W6IA 3B85A 3B1WA 4KODA 1N6OA 2G88A 3P26A 3CX6A 1NSFA 3OAAD 4HDCA 2AFHE 1A82A 5F2EA 5TY0A 2ZXUA 1ZJ6A 4AYXA 2DR3A 5DE3A 4KJZA 5GADl 1E0SA 2BHRA 3CNLA 3CKLA 4CW7A 1RRCA 1P61B 4BWYA 1QHXA 1TEXA 4RD2A 5K8IA 1CRPA 1GAJA 3NEYA 4LHZA 2C95A 4V0NA 2Z5FA 4UXIA 2YC4C 5FPTA 4IOLA 1N6KA 3GLIA 1ODFA 3QXCA 4B2LA 1XFAA 3U3OA 5BN5A 2L0XA 3B5JA 2VIIA 2QG6A 2ZREA 4ZI3A 4DWJA 3VFDA 2JAQA 2XITA 2W00A 3FFBA 3BORA 2BIFA 2P6UA 4PQRA 1Z6YA 1OHHA 5DNYB 1JB1A 4PFSA 4LPSA 4NYIQ 3GLGA 4PZLA 5J4HA 1E1RD 1P2SA 3GLGB 4LYFA 1E2IA 2W0MA 5EZ5A 5CDFE 1W0KA 4JJKA 1CTQA 4TYYA 5KNDA 3AF3A 2VP0A 3CONA 4FMBB 1XNJA 2ZYTX 1NBME 4RZ3A 4E09A 3EX7C 4AI6A 4JZKA 4LGMA 1G5RA 1MH1A 4G5RA 4YMWA 3K9LA 2KB0A 4JT4A 1Q3HA 2A5YB 3R8FA 3C5HA 4S35A 2G3YA 1KSHA 3HPRA 3EC1A 4OJQA 2NGRA 4LSGA 3IBYA 2F55A 1EFCA 2QMHA 1JQLB 2YOHA 4B3CA 2QRZA 3AQ4A 5FUXA 4B35A 4LRWA 4KBFA 3TE6A 4DIDA 3WXMA 3U61B 3EIHA 2ZUBA 2IUSA 4NDZA 3GP8A 2OZEA 1T3SA 4B74A 1JECA 1OFUX 3DEFA 4BE7B 2IYXA 1W48A 2NO9A 2WICA 5DO9A 4DLVA 4C0KA 1SVWA 1UKVY 2ZYWX 1YKSA 4HATA 5AJVB 3QEJA 2QU8A 3NKVA 1E9EA 5G53C 1ZW6A 3KKOA 2OV2A 4PC6A 1NIJA 4RKFA 2FGJA 2G0TA 2BMEA 2IEYA 3NG1A 3IGFA 4N0EA 3ZS9A 8OHMA 2NMVA 5DGXA 1J8YF 1F2TA 1F2TB 1NVWQ 4F92B 2AK3A 1SXJC 2GZDA 2BMJA 1OXTA 1S3GA 1OKKA 1XMIA 4KLZA 4M9XA 4PHTA 1NF3A 3CRW1 3HYRA 1JALA 3T1QA 5EE3A 2FU5C 1KOFA 1OIVA 1TPZA 2H18A 5G3ZA 1Z22A 1M6NA 4C9BA 1DO2A 3PIRA 1KY2A 4BFXA 3ZLJA 1K6MA 4Q9KA 3DVLA 2IT1A 2FV8A 2XNDD 3GJXC 3QOFA 1G291 2EW1A 3V9PA 1N25A 2OE2A 4LYHA 2CXXA 2W2XA 2PMDA 3KUCA 4HAWA 1KI7A 1YZLA 2FH5B 3I32A 3N2EA 2QPAA 3B6EA 1UBGA 4U5XA 3CBQA 1XEXA 4EPVA 1XEXB 4JYCA 2J0QA 4KFRA 3BS4A 3TH5A 4A2QA 2HUPA 3LXRA 1HE8B 3DZDA 1HUQA 4FCVA 4A6XA 1ZIOA 1N6PA 2A5JA 1H65A 4XSGA 4KFUA 4JS0A 4F4JA 1NN5A 3CIOA 3QUSA 2A9KA 3NHAA 4FD2A 4L15A 1ELOA 2WWGA 5J40A 3IDQA 3E1SA 1K5GA 1DS6A 5H1YA 2YWFA 4B43A 1PVOA 2RGBA 4B33A 1KI2A 2Z4SA 1S96A 3EWSA 4OQMA 1NLFA 2ZVQX 1E2QA 3NIBA 2VA8A 5AJYA 2J3EA 5LD2C 3RS4A 2V9PA 1T0HB 3B7GA 2X1VA 2ZJAA 3RANA 2ZM5A 1KI1A 4DCUA 3QY0A 3OEHD 4LHYA 1EFRD 2IEZA 2ZJZA 1EX7A 3G82C 4NYMR 5JWOA 2CEAA 3TAUA 4FMDF 2Q3HA 2ONJA 4MYTA 3ZS8A 3BFXA 4Y0AA 3ZIAD 1Z0DA 4QGGA 1E2KA 3QIAA 4O2LA 3OESA 3TLXA 3TQCA 1OB5A 4UQOA 3TRFA 5HE9A 1ZNXA 2JLSA 2IYWA 4IXNA 4YMTA 1CJKC 4IDNA 1CR0A 2XAUA 1R5OA 2G6BA 3LX5A 3AKDA 5F9HA 1YR9A 1GWNA 1OW3B 4JJZA 2R2AA 2UZIR 4QG7A 1W36D 3ECCA 4PHGA 4IRUB 1JJ7A 3U7FB 4TLEA 3VKHA 1MRSA 4OI2A 5JZVA 4MRRA 4BECA 5B57C 3AH8A 2GNOA 1OXVA 2F3RA 3GJ8A 4AKIA 4MQBA 2CCKA 2GCPA 2ODWA 5FI0B 2J7KA 5TVKA 4UNPA 3BFVA 1XBTA 1KHTA 2RHMA 4A92A 4LX0A 1SZPA 1ZD9A 4EKDA 1OH7A 5FBWB 5KO2A 1GKUB 2UKDA 2WJYA 1E2EA 1QDEA 2D62A 4DDTA 2EU8A 5KSZA 4D80A 3I61A 1OH8A 1R7RA 2B7CA 2LCFA 5H70A 5AJXA 3I5XA 3NBYC 3FHCB 4C0JA 3AVTA 2IWHA 4XJXA 3NXSA 5TB5A 2R62A 3T5GA 3KXIA 1SXJE 1VKJA 3PCRB 4XSHA 721PA 1OJLA 3MRSA 2WWIA 3MD0A 1O87A 3NEJA 3ZZ0A 1YVDA 5JFGA 2VL7A 1XWIA 2Q6TA 3QBTA 4DSNA 1E3MA 4PSKA 1N6RA 1EGAA 3PVSA 4QGHA 4WA7A 2FN4A 3GPLA 4WXRA 2IYYA 2GJAA 4BFWA 4URUR 4IDHA 1G9XA 1ZMXA 4OHXA 2RB4A 3TK1A 1G7CA 4F38A 4C7OA 1S1MA 2R6DA 1W5TA 2ATXA 2GAOA 5JSZA 4C7OB 1H8HA 4DSUA 4EPRA 5KUTA 2AFIE 1QHIA 1YZTA 2FSGA 3P27A 5FOTA 4G5SA 1ZINA 5DN6A 1WF3A 2GZHA 5AUOB 1MO5A 3HU1A 4A8JC 1ZCAA 4TWZA 1LF5A 1E2LA 1XTIA 4B48A 2IYLD 1RKBA 2A7QA 1COWA 3H84A 1J8MF 1KI9A 2BM0A 3G5UA 4WZBE 4Q1FA 4KXFB 1G20E 2BMFA 2JIZA 4UNNA 4WAUA 2QQ0A 1T9HA 1EWRA 1U94A 1ETUA 1U8AA 3M0EA 5TDHA 4PO9A 1Z0AA 4EAQA 2ZRHA 3HU2A 1ZYUA 4BRUA 1JR6A 5DYGA 4EDHA 1VIAA 2VQSA 3CPJB 2WWWA 1IY2A 1MR3F 2D4HA 2HF8A 5E7MA 4A6PA 1IN7A 1DG3A 2HEIA 4KFSA 2JJ2D 5HZHA 1E32A 4M21A 4LCBA 2HLDA 3KB1A 1SVLA 1VCMA 2IYVA 4HLUA 1VIYA 4UJ3A 3R9WA 4A8JA 2EWWA 2ZTSA 4A8JB 3AF0A 3PITA 1HH4A 3HJNA 4RZUA 1KO8A 3BJIC 1LV7A 1WQ1R 5KNCA 5AK0A 4R2IA 4FMCB 1ZP6A 1TF7A 1T4GA 1X6VA 3TSZA 1FTSA 1KK0A 4AY2A 1BIFA 1QVRA 2BBSA 4DCSA 2Q21A 1AGPA 5CK5A 2V6JA 2KI5A 4KO8A 2NO6A 3B1YA 4DUGA 4XVUA 3UG6A 5SZIA 2VO1A 2XEXA 2G1KA 4EPTA 4Q4LA 3EIEA 2QM8A 3EIQA 4PAMA 3UATA 1AGRA 3AF2A 2RKOA 2LWIA 4CT5A 1N5LA 1GFIA 4M0LA 3IPXA 4HZIA 3LQRA 2FMXA 2YV5A 2VSXA 2DB3A 2Y8EA 5HKKD 4CVNA 2J0UA 1ZUNB 2QM7A 4JYBA 4WXPA 3QKSB 2J0UB 1SVIA 4ZCMA 2PJZA 5HE8A 1GNQA 1N6IA 2VP9A 3TQFA 3DKPA 4LUCA 3NC1C 1FTNA 2RGXA 3CB4A 3T34A 2ZI9A 1U2RA 1XZQA 3KQHA 4WVFA 2IF2A 1D2MA 3WNCA 5EE9A 5JEDA 2KJQA 4BLOA 4AKEA 1ZM7A 4MKIA 4B73A 5JECA 3EZ6A 2BC9A 5C4MA 1AS2A 1XTSA 2GCOA 5B2ZA 3MSXA 2ZI7A 2PX0A 1G3IA 2BM1A 2D2FA 1LFDB 1YU9A 3DOEA 3N70A 5E7JA 3SBEA 2ZUDA 1HT2E 5CK4A 1Z6XA 1OE0A 2BJVA 2ODBA 4YMSA 2AKAB 2ZQ5A 2ANCA 1D9XA 3P4XA 4URVR 2P0EA 4RZ2A 1OB2A 1RRPA 4Q1EA 1KAGA 3PENA 1NSTA 4BLTA 1QHHA 4GSYA 2YWHA 3DM9B 1US8A 3OIVA 4DLYA 1US8B 2W2VA 1D9ZA 2AK2A 4M1SA 3NWJA 5EXXA 1ZCBA 1R0YA 3MCAA 3SYLA 3AF1A 3LRPA 1F6BA 4IDOA 3K1JA 3VR4A 4EUNA 4Q48A 2ZSFA 2C9OA 4WZAE 2P5SA 5FBLB 4D2IA 4LJYA 4IFEA 2AD1A 2HV8A 2CNWD 3F0TA 3TUZC 2ZETA 2YWEA 5KHOC 4CF7A 3O8CA 4LBYA 1LF0A 4MYCA 2CJWA 5GJCA 2CJWB 1W0JA 1GP2A 1DAMA 1JQJC 2QY9A 4IVPA 1X8LA 1WDTA 3OIWA 4BLPA 4HSEA 1BH2A 2GEDA 3AP1A 1TNDA 4OJKA 5J4KA 4OQXA 1KO4A 1Q22A 1AIPA 1Z0FA 4GP6A 2BMDA 5DYIA 5BXQC 2MSEB 3B9QA 1AA9A 3VTKA 3HYTA 4URYR 1XEWY 1RYHA 3D8BA 3VKWA 2QE7A 3T15A 3FE2A 1U8YA 1KO1A 1Q0UA 2WKQA 1L8QA 4EJSA 3AKYA 2IYQA 1OXXK 2QQEA 4Q7LA 2G83A 3PFIA 4MGYR 3CM0A 5CJPA 1HQCA 2PLRA 3OAAA 2J59A 4TYQA 3AVVA 1E6CA 4NE2A 2PEZA 4QKQA 2C9YA 4JL8A 3ADDA 2XSZD 3UG7A 5IF9A 1UF9A 4DRZA 5SZHB 2DY1A 3C15C 2ERYA 4X8LA 5FTNA 4AYTA 2OBNA 4B6EA 1OF1A 5JCZA 3KKQA 2Z0MA 4Q1BA 1A4RA 3U3MA 3CF0A 2QEQA 4BQSA 2FE4A 4GFDA 3L8ZA 1V5WA 4P31A 3VAAA 5F9FA 1EFHA 2Q3MA 1UPTA 2CBZA 1KTVA 4DC9A 3IIMA 3B1VA 2KE5A 5FR2A 3QSYA 1B0UA 5SZJA 4A0HA 1U90A 3UWOA 1RC8A 1E1RA 3KXLA 621PA 2BCGY 3TSOA 1KK3A 3GCGA 1Z6GA 1W46A 1CJTC 4BASA 3L8YA 1AQYA 1WXQA 2C77A 2GVDC 4GOKA 4V0LA 5KOYA 4P4TA 1WA5A 1NP6A 1EFTA 2WV9A 3IO5A 4CDGA 221PA 4Q4AA 4A15A 4MRVA 1LB1B 4Q4AB 1U9IC 3U3RA 3HU3A 1D5CA 1W5SA 4XVRA 2IX3A 4LV5B 4M22A 1VECA 2ZRKA 5CLLA 1BKDR 1E69A 1IJEA 4WIAA 2QAGA 3KJGA 3OEED 2GJKA 3L0SA 1Q57A 2QAGB 3CX8A 5FPHA 2XTNA 5B58C 4PPGA 3OIYA 1XDBA 2ZPTX 5IK2D 3RYTC 1NLZA 2W6JD 1UKYA 4XTRA 4C30A 3TSWA 4KHZA 3QF4A 2FA9A 3QF4B 1TUEA 4KBGA 3KTAA 3LBNA 4B2IA 3JZAA 5JEEA 4ASUD 3MJHA 2ZRBA 3A6PC 2HJGA 3NBFA 5DI3A 3Q7PA 4J0QA 5DI3B 5KDDA 5C46F 1KSJA 4LBVA 3Q72A 4GMXA 3CWQA 1HA3A 1KI8A 2DWPA 1YR7A 1G3UA 1E96A 2PZEA 4A9AA 3LBHA 1E9CA 5JHGB 3QENA 5A0FA 1Z6AA 3D6TB 1E99A 3AKCA 4P33A 4QJ5A 4DCVA 3O8DA 1AM4D 4LI0A 4M1TA 4RVCA 4PTLA 4RD0A 4TL9A 2IHBA 5LDDC 3IUYA 3B9PA 3MG9A 3K70D 2R6CA 2VYFA 1GTVA 4M9QA 5JS7A 4X8HA 2PZGA 2WWYA 1XPUA 4RD1A 2C5LA 2R44A 3O8RA 1UBCA 1F48A 2ZRCA 4B71A 2P5TB 4BZXA 2BV3A 3KX2A 1P2UA 4PO1A 2BEJA 2Q9BA 1E9SA 2XNDA 1DARA 3SQXA 3I1FA 2UVQA 3DM5A 1JPJA 3C41J 2QMEA 3CW2A 3W90A 1JEDA 1KNXA 1XCMA 5G40A 4FN5A 2QTVB 4BLQA 2IWRA 1YR8A 2FSFA 4GOXA 3K09C 3ZZUA 4QNMA 1O3YA 1DAHA 4A1FA 3FGNA 3TMKA 1WCV1 2IYZA 2QT0A 4JL5A 1C4OA 4Q03A 4BEBA 2OEPA 1FUUA 2RGCA 1DELA 4TYWA 1XU4A 3M1IA 4P0TA 2YJTD 5A5GA 2JLRA 5C4GB 1G64A 5CB8A 4KYIB 2FJUA 3OFND 1L4YA 2QI9C 4BUJA 2QRNA 3DHWC 5KPDA 5DLQC 1XJQA 2AD5A 4HAYA 3FHOA 2CVFA 1RRFA 3L0OA 5DHAA 5EZ6B 4OI4A 1W36C 3ZVMA 4QBHA 3PEUA 1G8HA 3UWKA 2XZLA 4M9ZA 4X8OA 4BZPA 1T91A 5CM8B 4YXWD 5JJIA 4IOMA 4L9WA 1XTKA 1DTSA 1F3OA 3JVUA 5GVSA 3UMFA 3OEHA 2CCJA 2CL0X 1EFRA 1IM2A 2OHFA 2PEYA 3AV0B 4C3ZA 4PO8A 5JJKA 1GRQA 5G41A 3UKDA 3ASZA 3KUDA 5IT5A 1Q1BA 5KPJA 1KMQA 3HP1A 3ZIAA 2O8BA 3CH4B 2O8BB 2V1UA 2QUZA 1XTQA 4OQLA 1H8ED 1LS6A 1U0LA 3NC0C 5H68A 4HB2A 1SQ5A 4QM7A 3IQXA 4QC2A 3CRMA 1X1RA 1JR3D 2DBYA 3DZ8A 3Q9LA 4RCZA 1YZQA 1UBFA 2OSBA 3GEIA 4L4UA 2V7QD 2A30A 1JAIA 3B60A 1D2NA 4HYYA 4N1AA 4TLAA 3FKQA 1D6JA 1ZNZA 2WSSD 3GJ7A 3ZJYA 4C0SA 1W36B 4P4SA 4P4SB 1QHGA 3KKMA 1U0JA 3WRYC 4DJTA 3LD9A 4EPWA 1W2GA 1XMSA 5JWHA 3ZDQA 3GLIB 1XB2A 2ZJYA 1IY0A 2D74A 2RHDA 4HZUA 2GVZC 5DIFA 4HZUB 3WMEA 1AKYA 3J81k 1VYUA 2RAPA 4NZYA 3BWDD 4JLNA 2C98A 3OE7D 2ORVA 2ZI5A 2HYIC 4GL2A 2B21A 1K8RA 5GJWC 4JBYA 2FZ4A 1OH6A 2VF8A 1KAOA 4W5JA 5J4YA 3U2QA 4DBLC 3KQKA 2WAYA 1FPMA 5B64A 4MKGA 1PUJA 1W1WA 4I1SA 2FOLA 2HXYA 2R6AA 3A8TA 3ASYA 1P5ZB 3OIUA 3Q8XB 4NPHA 4DEYA 5J5CA 4CIDA 3U6KA 4MKFA 1PV4A 2RCNA 2IS1A 1NN1A 1DG1G 4B76A 1ZC3A 1LNZA 1EK0A 1KO7A 4MRPA 3VNVA 4UJ5A 4TLDA 3ZVRA 4B3BA 2TMKA 4IJMA 3CPEA 3LY5A 1Z83A 3WNBA 3D7MA 2CE2X 2O8EA 1E98A 1TL7C 4M8NE 2O8EB 1X8KA 2HF9A 4TN1A 4LYAA 1G5TA 3CZPA 2BWJA 4M1OA 4POAA 1KI6A 2QAJA 2XTMA 1KI6B 5AUPB 1XD8A 2V8OA 3GJ3A 2V4ZA 1Q1QA 1BYUA 1GILA 2XXAA 3BBPA 1KJWA 3SR0A 4P32A 2XXAB 4FXPA 2YYZA 4ZIRA 5P21A 1QF9A 3CO5A 4ZIRB 2ZRGA 3WMGA 1E9AA 3GLHE 4CEHA 4CEHB 4F7WA 5BN3A 4TTRA 1TUIA 1OSNA 4AKGA 2H57A 4OK3A 3UMRA 4IHQA 5EXTA 4AK9A 4JLBA 1XCPA 3EA0A 4Z8YA 5JS8A 1KKLA 5L3VA 2WBLC 5TXGA 2WJGA 4GZLA 2O5VA 3RSOA 4V0MA 3THYA 2JJ2A 1X8JA 2WMNB 2X19A 3THYB 2DWOA 4TQUS 2YNMA 5HR5A 2EYUA 3QVUA 3UK6A 3MWKA 2VP5A 1ZIPA 3AM1A 1SGWA 1XP8A 5FL7D 3B2EA 3HDTA 4TL8A 3T1TA 3BH0A 1U81A 3U6BA 2A78A 3AF4A 2IUTA 1CP2A 4NMMA 5FOVA 1N0WA 1G3QA 1OH5A 4OK6A 4B34A 3RS0A 2JJ1D 2OLJA 3QKRA 3GLGE 3LV8A 3QKRB 1RJ9A 2WJIA 3VR2A 3AVYA 5H8WA 1RJ9B 3X1YA 3WNDA 2IC5A 3LLUA 4MUBA 2AR7A 4LHWA 1HT1E 3BAFA 4IW3B 4FW9A 1LS1A 1NVXQ 4LK2A 4US1R 3IEUA 4C0AC 4URXR 3GEHA 1EX6A 1JNYA 4D6PA 4EFNA 1HV8A 3SN6A 3VU9A 4DDUA 3U60B 4NKRA 1VYTA 3REGA 2XJ9A 4TMVA 4TSFD 3VU9B 4KITB 3VX3A 3WHKA 5HKKA 5JJLA 3CF6R 4URZR 3X1WA 3SS8A 3FWYA 1GVNB 3KB2A 4KV9A 3EC2A 1TF2A 3CR8A 3A1WA 2N46A 1WBDA 5BQ5A 2KSQA 1KZ7B 1NKSA 3CNNA 2VPPA 4Z8XA 1CRQA 5FL3A 2PJRA 3Q7QA 2O8CA 1ZUHA 2GBLA 1KGDA 3VR6A 4C0QC 1NBMD 2ZRAA 5M04A 2O8CB 2PT7A 1IN8A 3QF7A 1Y3AA 3O8BA 4IEIA 4IOKA 4DLRA 4OI0A 3CRVA 1II8A 5AWFC 2E1RA 1II8B 1G19A 2X2FA 1CBUA 3R7WA 1KJZA 3R7WB 2H16A 1GNPA 4EPXA 3R9IA 1M7GA 4B32A 1SKYB 5KDOA 2FPKA 2LKDA 4L16A 1G6OA 4BFTA 1N5KA 1M74A 2BBWA 5KDLA 1M8PA 1R0ZA 3JVVA 2CK3D 4M9SA 3TR0A 1IOZA 2DWQA 1X3SA 1SHZA 3K9HA 3C4JA 2WPDD 3A1VA 2F9MA 2JDID 2C04A 4LJ6A 4E22A 3BK7A 1E4VA 3RRNA 3RSLA 1XPRA 2QMOA 3WYGA 5E3HA 1IN6A 2CNWA 4NYJQ 3EZ2A 1QG2A 2EFGA 3K0CA 3G0HA 2ZSAA 5FUVA 2ZU0C 4ESHA 4B44A 2WKRA 4DDWA 4JLVA 4U02A 4IVQA 2YWGA 4D4KA 4JVNA 5L3QA 1U0HC 5L3QB 3ND8A 3B78A 1N2CE 4DLSA 2AXNA 2IS2A 4CYMA 4I1VA 4NYIR 1R0XA 1ZD8A 1GOTA 2ZIAA 2EFDB 3EWAA 1YRAA 3FMOB 1E4YA 3DDCA 3QXJA 4LY6A 1SVOA 4G0NA 4URWR 1W4CA 5DSZA 3EAQA 2OLKA 4DEXA 3E70C 3QKUA 1IXZA 4IVRA 4NL4H 1ZM3A 4OHWA 2QNRA 2GXSA 1DAIA 3PQCA 4D0LB 2FG5A 5KSYA 5E4FA 2GXAA 2ZI3A 3X2SA 3ZZTA 3B82A 3THWA 2VLIA 1M7HA 3THWB 1ZUIA 4NCKA 1EXMA 4PSVA 1DEKA 5KU1A 2XSZA 2B8WA 2VF7A 3U4QA 3U4QB 3UPUA 4LWZA 1W47A 2W58A 2HCJB 1QBKC 1ZU5A 2F6RA 4MA4A 3EG5A 4PPFA 1Q1EA 2RGNA 2WJVA 3QVVA 3B8HA 4NH0A 3VHLB 3U7HB 3AKEA 2YOGA 4GT1A 3KJIA 5FI1B 4PR0A 5JSZB 5EUMA 3AUXA 1T0JB 2PCJA 4HLUC 4B6FA 3H1TA 2F1HA 1KK1A 1S0UA 4B3GA 1XXHA 3REFA 1RVDA 1XXHB 3T35A 2I1VB 5UKDA 1SHKA 3A1SA 4P3YA 4X8MA 4BEJA 4KU4A 4DZZA 2Z43A 3KL4A 2FPLA 1FW6A 1SKYE 3I62A 2F3TA 4C0HA 1E9FA 2XOKD 2MMCA 1BMFD 2GAAA 3NDPA 4Q9IA 3WRXC 1OYWA 1S3SA 4JLMA 4AWXA 3VQTA 1G8PA 1U99A 3AEZA 3QBVA 1JI0A 1CXZA 1E94E 2V55B 2GRJA 1RW4A 5EP2A 3PUVA 4HB0A 2AX4A 2QGZA 1S2MA 3DO6A 3HWSA 4LPKA 1MO3A 2ZITA 4TL6A 3TBKA 1NMZA 2JA1A 2KBEA 3OEEA 3V4RA 3SJCA 5TMPA 3I92A 1NY6A 4AD8A 2EYQA 3HR7A 4GOJA 3UMSA 4Q9LA 3RHFA 4KSCA 2V1XA 4D25A 4W5HA 4R71A 4PHFA 3DOFA 1E0AA 2P2LA 5IK2A 5ANRB 2W6JA 4JLAA 1NG9A 1PZNA 3AGPA 2RGAA 2GKSA 2HDNB 2FEMA 4TTQA 4NU0A 3CZQA 3H2YA 4JVSB 4TQ9A 5CJ2A 1G3RA 2EQBA 3VHXA 4ASUA 3EARA 3T1OA 5J4VA 1E2MA 5L8VA 1AS3A 4HUQA 4TMTA 1KJYA 3LAWA 1UJ2A 3BC1A 4HUQB 1I2MA 1FP6A 5AR1A 3LH5A 5AUQA 3SQWA 1VHTA 2HYDA 2VSOA 1WE2A 2B6HA 2P3SA 3RS7A 3WBJA 3C14C 1OXSC 1Q1ZA 3FPAA 2OFOA 3H4MA 1E2JA 3ADKA 3IPYA 3WP1B 3K70B 1UADA 3RDPA 2J5XA 5GJBA 2WM9B 4WZ6A 1IJFA 2RMKA 2CMKA 2YVUA 4KLNA 1FNMA 3CRQA 1G8YA 2R6FA 2ZRNA 4ZPXA 1R5BA 4V0OA 4LJ8A 2ZJOA 2VHJA 4US2R 2OO7A 4ZI2A 4JLOA 1SXJD 2GEUA 2FSHA 3U7GA 3FDIA 4QBFA 3D31A 1EESA 1FQKA 2VP6A 2GJ8A 2GCOB 3HR8A 2BCJQ 2XNSA 3RS2A 1CIPA 2H92A 3FOZA 3T06B 2E87A 2D7DA 1UFQA 4JVMA 5EE0A 5E7IA 4QXAA 4A2PA 1HURA 3AVWA 2G0NA 1A2BA 4GP7A 4OL0A 5JHHB 1AN0A 1FP7A 1NVVQ 3M6AA 2I3BA 4NCJA 2OCAA 2EFEB 2NQ2C 1ZU4A 4AG5A 5CB6A 1QHHB 1E2DA 3QQ5A 2DPXA 3NBZC 3RABA 1GRNA 4EJSC 2A5DA 2J7PD 2N42A 5K8UA 4RD6A 1X1SA 2QENA 3OFNA 1T3HA 2AL7A 4HI0E 4D26A 1IAQA 4TLCA 4JLKA 5FTJA 4BFYA 2F1IA 1Z2CA 1FL9A 3T12A 1UEJA 5FTMA 3LNCA 4ZDIA 4Y0VA 2CVHA 1GL7A 1T8UA 3MMPA 2Z83A 3ICEA 1VG9B 2Z6VA 1W7AA 2MSDB 5FPKA 1W44A 4QL3A 3NBXX 3BB3A 4YXWA 1J7KA 3SC3A 4NHOA 2OAQ1 4Q1AA 4M2LA 2FX3A 4ILEA 4NONA 3DPUA 5KSOA 1DPFA 1G41A 4R2HA 3V00A 3S1AA 1JJVA 4O25A 3S1AB 4I4LA 5JI2E 2I4IA 4ON9A 2GHIA 1W4RA 1K5DA 1V43A 2WIAA 4PC1A 2QROA 4JT2A 2QP4A 2ZJ2A 1P6XA 5CIQA 1H8EA 1ZM4A 4EJSB 1TQ6A 3CRRA 2RGGA 2IUUA 1JR3A 1P9RA 2EFCB 3OF5A 3TNFA 3W34A 2N1BA 1VCIA 2V7QA 4DHEA 3K9GA 4DB2A 3U3KA 1DE0A 1E2HA 3SJBA 4ACBA 4Q21A 3RVBA 3W6OA 1S4QA 2WSSA 3LVRE 3A36A 3FMIA 3IHLA 1JEEA 2QAGC 3H0KA 1TEVA 4KSBA 4TQAA 4AC9A 2WVJA 4RD3A 1Z47A 4KFTA 1ANKA 1XD9A 1N6NA 3SJZA 1FUKA 1L4UA 3NDBB 3GFOA 3IHWA 4F4IA 1W4AA 4GBMA 1MOZA 4DLWA 2QPTA 5BW8A 3C5CA 3OE7A 3K0EA 3SEAA 4B3XA 3EZ9A 4PXAA 4LBZA 2VRWA 1Q44A 3VR5A 2ZSBA 2W2TA 4D4JA 4QGFA 1UDWA 2EVWX 3LVQE 4ITRC 1KDPA 2WTUA 1NJGA 2CL7X 5FBRB 2JLVA 3MLEA 1VCNA 2A3RA 2WIBA 2A5GA 4DB4A 1G17A 2FGKA 3SBDA 4FMCF 2QL6A 5J47A 1N0VC 5KNBA 4TMZA 1CR2A 1ESMA 1VG0B 1A5TA 2ZR0A 3IILA 3PG5A 2C9CA 2Q0HA 3IIKA 4Q5IA 5HZKA 3GLFA 1DAKA 1E79D 4YMVA 3MWJA 4OHYA 3GLFB 3SDZA 5FBVB 2VHTA 3GFPA 3VR1A 5FOXA 1HTWA 1C1YA 1N6HA 4B3DA 3PEWA 4MDFA 3PEVA 5JWRA 2ZJ5A 1L7VC 4QGAA 4TT3D 5TARA 1OYYA 4JKIA 2DCUA 4OHVA 5FOUA 3FVQA
chains in the Genus database with same CATH superfamily
3KTAB 5BN4A 5TF4A 1DLIA 2QN1A 4MJ7A 3DP9A 2FMTA 3GH1A 2EDCA 3VU1A 5CX4A 1JR4A 2FVXA 4KVGA 5F5NA 1M2VB 3R0QA 4PFQA 2GN8A 5CVVA 5H82A 1NE2A 2LVBA 1YA4A 1IEWA 1PV1A 2AN9A 1NMXA 2WP0A 4JEHA 4TTPA 2PSEA 2ZYUX 4V2UA 2JI6A 1M2OA 3WL4A 4BS9A 4UTNA 1CU1A 2P2DA 2Y4OA 4PX9A 4RZHA 1SUDA 4JKYA 5GVRA 2QX8A 3SYKA 3WFZA 3FOWA 1Y1KE 4QQKA 3JD1A 2C58A 4HXEB 2K2WA 4WW0A 3VV2A 2HJHA 5C8XA 3K53A 2ONZA 3TDMA 3KUKA 1E2FA 3JQPA 3FMVA 3PICA 1V16B 3MJDA 2CL6X 2NUAA 3GOQA 1MABA 1WIWA 2V6IA 4RFVA 1N2ZA 2QV7A 3OPYI 3VOSA 5DBHX 3ZTTA 1OIWA 3QVXA 4JN6B 1ZXXA 1II0A 2EAUA 3ESCA 3KHKA 3VUFA 4YX9A 4AKHA 1KH2A 1L8AA 2B8NA 5F2KA 1P2DA 2B0CA 2UXCB 1YZGA 3SDBA 5FL7A 3SZ3A 1YRBA 2I9PA 1SAYA 1Y3DE 2MSCB 3LQ4A 4C4XA 1SQSA 2BJHA 1TADA 3IESA 1KL7A 1KMHA 1ND6A 3T7EA 3VYUB 5AVZA 1SVMA 1C3OB 4YEDA 2FEOA 4LYJA 3EDCA 4R1PA 1NNLA 2XYVA 3DEJA 1XU9A 1D4ZA 4LQLA 3SS7X 3KDSE 2K6GA 4GYYA 3ME5A 2F1RA 2B0JA 2DBRA 1RAEA 2OP0A 3AY7A 3LTEA 4QPDA 1K6JA 1A95A 2FFJA 3Q5EA 1FFHA 4RK1A 2H7VA 3EFOB 4K9RA 5HX7A 4TMWA 2A9PA 2W0SA 4XEHA 2R3SA 4UFOA 1C9MA 5E95A 4UMVA 1TO6A 3GAZA 3L7JA 4PX2A 4N5LA 1UZUA 4A5SA 3FY4A 3I9LA 3FOAA 1I4DD 1U4OA 5DHFA 3R44A 1P3JA 4ALKA 2Y71A 3P19A 2JFWA 2IYUA 2WM3A 3TS1A 5B1IA 1Y3HA 5CPBA 3PEFA 4GBJA 4XUEA 3BWBA 3EMKA 1N75A 5BNZA 3R0ZA 5C81A 4RKWA 3QPAA 2ZB7A 1IWOA 3LX4A 1ACJA 2C29D 1W59A 3OLYA 1P8AA 3E5MA 3SOPA 3RVJA 1OZGA 1CERA 3KOXA 1U1GA 1E1CA 2JGKA 4L9AA 4C7JA 2DKNA 1VSVA 4XTCS 4OHZA 1AKTA 3IP3A 2WF9A 2P91A 1P7PA 5LBTA 2ES4A 4F11A 1SC6A 5HCNA 1NOIA 5LQMA 2JVIA 4FDLA 1R3UA 1T8TA 4KUGA 5DGIA 5A6VA 1G6HA 1H0RA 2A88A 1QKIA 4CXMA 4IZIA 4LOHA 3MOIA 521PA 3JQAA 2Q07A 4NCNA 4XCQA 3W2FA 4XWAA 2CK3A 4YYZA 2WIKA 1G7SA 1RYFA 3HRIA 3RF6A 3VKGA 2OT3B 1ZW1A 1T9BA 3L8MA 5FBQB 1T3GA 2EC5A 2WPDA 3UWDA 4CV1A 1MJNA 3RC9A 1WTAA 2F9LA 4KUHA 4BQPA 1Z7BA 2FZGA 2RC5A 1CUFA 2X7JA 1MG0A 3IAS1 2XGOA 5CAEB 5IXYA 1G8AA 2W6PA 4TWAA 4NR0A 1P5HA 4JASB 4JJ6A 2P30A 2IH4A 3PGMA 3MTEA 4JB2A 2QSZA 1EUZA 1DTWA 1VSQA 4I9UA 4RORA 2I1QA 4ROTA 5HM6A 4MIEA 2B1IA 2FW6A 2ZS8A 1IXRC 1P62B 1JEYB 2VK8A 2M6RA 3R7FA 4IH4A 3RD5A 4CR7A 4EVSA 5H3HA 4F4HA 2VZ9A 2WSLA 3RRBA 2XZOA 2JZNA 3UH0A 1FNNA 3L77A 5CXSA 1M1ZA 3C1TA 4F04A 5C8YF 2X0KA 4QG3A 1YCGA 3WLTA 2G1UA 2O5EA 4QXRA 2D0PB 2YXDA 1P9OA 2C7GA 5BN1A 1N2BA 4EIWA 1GPYA 1U80A 2O20A 1OFIA 4FMDB 4Z54A 4LDNA 2AN5A 3NCTA 4UMFA 2C99A 4ZI7A 2B7BA 1BFKA 1K7FB 3MWLA 3GWGA 3L82B 4BJ6A 2NO7A 1S9HA 4MUGA 1UMDA 3OTGA 4BV8A 3QLTA 2QN7A 3IEVA 3AJDA 2WIGA 4FFDA 5K3DA 4WFKA 3WIBA 4BQOA 1ABBA 3AR9A 4F8EA 1PWZA 2WU0A 4HDQB 1FLDA 3DMTC 2IKQA 2PCLA 1RWWA 4GMKA 3WLNA 3CHYA 1WBJB 4D81A 5TX7A 2OCBA 3BSFA 1AKEA 4FZRA 4PW0A 1T1IA 4XD7D 1MQ8B 5A5VA 3V9AA 2C1EA 4PG4A 2FX2A 5A1JA 1QG4A 3VXKA 1N7GA 4RJ2A 2YHIA 4C4PA 4QARA 1V2GA 2RG7A 3KP1A 4EQ6A 5JY1A 1ZZGA 5IBRA 5J1TB 2WZBA 5EQJB 3TLGB 2ZSDA 3OQJA 1W2HA 4G07A 1TO2E 5EIOA 4F3NA 1PT5A 3WB0A 2CHVA 4Q15A 2UVPB 4OAQA 4H1VA 4LBWA 1K75A 1MIHA 3CINA 2WU3A 4RKEA 4QM6A 1S2LA 3SSMA 4LF6B 3HCCA 2AX3A 2X8WA 1BOFA 3L4JA 2IDZA 4N5DA 2QMUA 2YZKA 5A3SA 2YVLA 2QTAA 3B70A 4FDUA 2XVZA 4RMGA 4Q18A 5TQ2B 1NI4A 3VC7A 1NR5A 4GGPA 2WZCA 1RBMA 1EDEA 3MBOA 5KZMB 3A9SA 3B3GA 1FJGB 4KX5A 4V0KA 3W2EA 2BTQA 2QRGA 2ZJ1A 3GQBB 1E3DA 1E3IA 3LZDA 4YPFA 2C4NA 1G3MA 2PK3A 2QVYX 3TPZA 4IGFA 3DE3X 4H1UA 1Z7YA 1MIOB 4GL4A 3D4OA 2HU5A 3S0JA 5AKLA 3IUNA 2ZJ6A 4JU9A 1U0EA 2PE5A 1GKYA 4P9NA 4BO3A 4NCAA 1UQUA 4RYLA 3MRTA 2E9SA 1KI4A 2IYSA 4K6KA 3V4ZA 4INOA 1AKUA 5BR1A 3V1KA 3GLIE 1MB2A 3HJCA 1IOLA 3ROEA 1IN4A 1O4WA 2IS1A 1ZGHA 4OFZA 1G16A 1IB0A 1IUNA 3GRVA 4ND2A 4QNRA 4RANA 5K3FB 2GBLC 2JASA 5KQGA 3E35A 3DMNA 4RK6A 2F90A 1NN0A 2R65A 3ETJA 1Y5IA 2OCYC 4R1UA 5TC4A 5BVGB 3DXFA 2XRZA 1EAYA 3GJ0A 4CCWA 2WLTA 1P7CA 2XB6A 1R27A 5IAEA 5ICMA 1LW7A 3SC2A 1JDNA 3OU2A 1FMLA 2BHLA 2CW5A 2XZPA 2RFLA 5HF9A 4B3RB 1VOTA 1QIKA 3KKNA 1N4AA 3X1ZA 5JNLA 1Y48E 1YR1A 3ZHUA 1EP3B 1TAGA 4RW0A 4GOND 2VHQA 3FZQA 1F2VA 1NL3A 3UMBA 4R31A 4HNGA 4JI2B 3KPJA 3R3ZA 4N49A 5DYTA 3RU9A 1E1QD 1KI3A 1RWNA 2ZANA 2C9MA 3SQLA 2BKEA 2WI8A 3LXXA 4A8PA 4RGYA 4AZSA 4XGRA 3BYZA 1QQ6A 3FMFA 3GT7A 2IH5A 4A3SA 1MOQA 4OK5A 2AZXA 2HUNA 1AN9A 1ECGA 2QYHA 1H6BA 3FPEA 1TW3A 2PWAA 1E9VA 1VP9A 1XMPA 3G0OA 4JT9A 1EGHA 2WF8A 3SCZA 4CMBA 1W25A 3Q6IA 1U3TA 4HO1X 1FX0B 2QZ4A 1EE9A 2Q2QA 3FKSD 3WY9A 5FX2A 5FIUA 1JIJA 3KYCB 3HJUA 4ETNA 3K9NA 2J5KA 4FWIB 1DADA 2A3NA 2GFHA 1T10A 2EZTA 3K0CC 1LRJA 1L7MA 4GAEA 5F23A 4C2UA 1HMPA 4Q3LA 5EZYB 5I4CA 2FFAA 2QXTA 4B3MB 5BOVA 1DWPA 5HJ2A 4I55F 4MCJA 3ND9A 4I6JA 2QI9F 1G6KA 4U39A 4C4OA 4UKDA 2DPMA 4V1CI 5JTTA 1DG9A 1O08A 1M2EA 1BVUA 1THGA 1CZNA 4FPXA 4QA9A 4HG2A 3AR7A 3LMKA 5AXCA 3TUIC 5K0BA 1X9HA 3G59A 5I9TA 3GFQA 4LTNA 3TL3A 5DISB 2X8LA 3OECA 3ZXSA 2GBFA 2YW9A 3N8GA 3THXB 2GA8A 4NE7A 2MMGA 1NUHA 2ALJA 2MDTA 4MUEA 5TQVA 4DV3B 4R9NA 5AKKA 1PFWA 3QNMA 5T6BA 3OJFA 5FADA 1DC7A 2J7PA 3TKAA 1EYZA 4Q19A 2SBTA 3JXEA 1FNSA 4YRAA 2G1AA 4V0ME 4CU2A 1P5FA 4FDAA 3JQ8B 3LX6A 1V41E 5MFPA 1LI5A 1KU0A 2O50A 1U7HA 4IRXA 4MYUA 1SC1A 1TFUA 1NVFA 4EHKA 4UTOA 4WZBA 4DG9A 1IZYA 3ZVNA 4EHHA 1FTWA 1EM8B 1S9DA 1JT9A 3D3NA 3WXBA 1G20A 2AG1A 2CXRA 3MXOA 1S1CA 3GEEA 1OT3A 4B4WA 4CT0A 4BVBA 1X19A 4U0KA 4UTXA 3LW8A 3T5DA 1I2BA 2GYVA 2LXNA 2PMKA 3BOSA 3LHIA 3Q1LA 1M75A 2Q7DA 2V7XA 4UNSA 2JFGA 4DQKA 1F60A 3OCZA 1NYTA 4PG7A 4QYMA 1VPEA 3QSGA 5KBYA 3I0NA 4YC7A 2R60A 3SEQA 2BONA 4FCTA 5F77A 1UDXA 3TQHA 2IKSA 4X3PA 4BFSA 4BL5A 5AQ1A 1OLXA 4DC0A 4PC2A 3R75A 5IKPA 1AKRA 3DBLB 4D9IA 4IHJF 5LOVA 4W1RA 3A14A 3RTGA 1E6WA 2XZDA 5ESDA 2C8LA 3HV2A 2EJCA 4K9PA 2GD0A 4U2FA 3LPCA 5AO9A 1RZVA 4O3MA 1BWRA 4J3JA 3WYDA 2VK1A 3G0DA 1WXGA 1A4UA 3BSSA 2BDTA 3H18A 2QN2A 3TW4A 4GXQA 1UT8A 4CQMD 5CHEA 4AQDA 3DLHA 4YALA 1UUFA 3IAXA 1SN7A 1OFHA 4C6HA 3MGAA 4RY0A 5L51A 1L5ZA 5JOQA 5KNDD 2JKVA 4DV7B 2IS6A 4U6QA 3ENQA 3GB9A 3RRYA 3AKZA 2H2IA 1G18A 2VRCA 4DMGA 4PC7A 5TS2A 2FHPA 4OQFA 2VPXA 2GBCA 4M49A 3PBKA 1SU6A 3IEPA 5DT2A 3QV2A 3NYIA 5B30A 1EDBA 4LISA 5BT8A 5FPSA 2CVQA 2AWOA 4XQ9A 1KIMA 2G7MC 4K8RB 1PYOA 3OEYA 1Q6ZA 3KFXA 4MI1A 4RVGA 3P9CA 3JR3A 4X0EA 1IXYA 1RXUA 4MV9A 1TTTA 1KEVA 3IVXA 3KOMA 1KE1A 4LFAB 4JLPA 2P8SA 2RH4A 3EODA 3R5SA 2CFIA 1VHLA 1AGXA 1EFPB 3O84A 1HT3A 5KJEA 4XH9B 1IUOA 3R0VA 1XK7A 4I3HA 5GWXA 2IIVA 4BQNA 3COYA 2K87A 3PV0A 4OI1A 4ESVA 1NQXA 4ZZ0A 4RDXA 3C16C 2PMWB 2RK6A 4IGEA 4YUZA 1PDWA 1DDGA 5KVSA 5H02A 3A4MA 2GASA 5F1KA 3GFVA 1I4OA 3UIEA 1G38A 1E79A 4MV4A 3S7TA 3K70C 4G09A 2DXIA 5JRZA 3W6ZA 5KTTA 7MHTA 4UC0A 4XM1A 3JQCA 5I7SA 1UMKA 1W52X 4ZJZA 1GPUA 1AZLA 1DC6A 4FNGA 4OBEA 1MW8X 2DHQA 3PEEA 5E6UB 2P6OA 2ASVA 2IPAB 4RPLA 5JC1A 2WJPA 3G68A 1RKQA 3R20A 3RRMA 1YE8A 2I4OA 3QXHA 3WWPA 2I2AA 1IG3A 3CY6A 3E15A 3QFFA 1J5EB 5KX5F 4OQZA 1OBFO 4TLLB 2XX3A 1E7YA 1GHTA 4R6XA 5D87A 4Q3OA 3I2KA 4WZAB 2AA3A 2GZ2A 3R41A 3MFYA 1J9GA 1R5NA 2XUKA 3PC8C 2WUDA 3QNUA 1CF4A 1RE0A 4DDVA 1ONSA 5K6AC 1BXGB 3BX1A 1QIGA 4X93A 3TIGA 3HHPA 1RAFA 2NAFA 2R9VA 1J21A 3L6EA 1JU3A 2PUWA 3HHEA 1RFGE 3CGGA 2ZW9A 4XXHA 4TPKA 4JBGA 4P82A 3KLOA 4UHCA 2Z3ZA 4IHAA 3S7ZA 3M8KA 4YCLA 1ND5A 1XTBA 4G26A 4EMSA 1UBTS 2GPSA 3PYMA 2POCA 4QT4A 1H2YA 1IYZA 4YCAA 2WOOA 5K51A 3UANA 3C7AA 2H4XA 3CWZA 4JXZA 2DTEA 1Y8ZA 1A2OA 5DM70 1LBTA 4MP8A 1JIXA 3DAGA 4BNYA 1OLUA 2ASEA 2HDHA 4Q1DA 3ZU5A 4R8KA 3ZY2A 1ZSVA 4B6SA 3U7EB 4KZKA 5JRDS 1KVQA 3N59A 3QKSA 3VZCA 1N5JA 1C7JA 3LBYA 5SY4A 2OO5C 2ZEJA 5HVNA 3FUXA 2CNKA 2IIBA 3H9BA 3C0KA 3LYHA 5LQRA 4PGFA 5T4EA 5THKA 3U1VA 1SCNE 4AXBA 3TLEA 4X00A 4QDZA 1KZGB 4KPEC 4HRYA 2V03A 1FYDA 1ZKDA 2GJ9A 4AZTA 4D0GA 5CFPA 2Q28A 2QTZA 3Q15C 1OYVA 3AWIA 1HNNA 3OFJA 4CKBA 4L0QA 4BLWA 4C3OB 1HY3A 2OXRA 2WV7A 2VEDA 4YLGA 4YGYA 1V4NA 2FYTA 4IJUA 3PPYA 4NYJR 3H4TA 3HCAA 1QBGA 1CS4C 1RP1A 2QSYA 4BMPB 3KLMX 4F1JA 3G89A 2UUBB 3F6BX 1R0KA 2XI4A 3VO8A 4QT0A 4KH1A 4YR7A 3MTJA 1L7PA 1TKCA 5AK3A 1QFZA 1VLLA 1SA0A 4QVGA 3HPQA 2HA2A 4W8GA 3CURA 1AQIA 2HAEA 5JAZA 2OO5A 3I73A 1ISJA 1UBRS 4CKEA 1H9CA 1O95D 2D2XA 1TQ2A 1NYRA 2AC7A 2I6GA 1S4MA 4KX3A 5EMNA 5JPIA 2BSQA 5HUQA 2XT9A 1Q0HA 2HA5A 2Y77A 4S04A 4O4IB 1XU7A 1ZD1A 4CV2A 4ETMA 5MN5A 3UBTA 3V97A 4EB6A 3I30X 4QXOA 4UE3S 3OTIA 1JAHA 2PX6A 3HH8A 3FUVA 1E3EA 1VGQA 4L02A 1YDEA 1I4LD 1MW9X 3OOWA 4PHHA 5E9AA 2DFTA 2C4UA 2V9ZA 4U7JA 3QU7A 3TSYA 1CY0A 4ZXFA 2IP2A 3AGQA 2QPOA 3GJTA 4TTTS 3RIXA 4CMEC 4J2OA 4PIMA 5JNTA 5CB0A 2Y9PB 2QLBA 1FYFA 4Y9RA 1NVUQ 2NPFA 1IZ0A 3VYSB 2VUIB 2A1UA 2B4QA 2A0FA 3CVXA 3A10A 4AJHA 5C1PA 5K3EA 1E62A 2CHGA 2VAMA 1NBAA 3TLJA 1OI3A 2ONCA 1NJ5A 4GBGA 3B1KA 1IG0A 1TT5A 3S40A 2W9XA 3PTAA 1G66A 1XX6A 1FU8A 2G07A 2PVPA 2IUFA 4Q4HA 4RMJA 2XUOA 5BV7A 3ZWOA 3G9UA 1N5IA 1NSYA 5GPBA 2P1RA 3VOAA 2P4SA 3HI4A 2GEVA 4F3TA 4B4KA 4FIDA 1KO5A 2FPPB 3UJCA 3HP4A 3QWHA 1V4VA 4OIMA 3DBIA 1NI5A 3BSYA 4LHVA 2HK7A 3NYQA 2G9NA 3EA5A 4GZMA 2RJNA 1ID8A 4XSVA 1DOAA 4HB3A 3ZJ4A 1U2TA 2GAJA 4JSYA 2AOXA 1Z2NX 4REOA 5WRFA 1AJEA 1IULA 2WA1A 1UJMA 3DGEC 4HLQB 1H2RS 3WRVA 3QWAA 1K6EA 2J6CA 3WJ1A 4F91B 1M5RA 1YJAA 5HG0A 3PQ8A 4WBNF 3GN1A 3X3HA 4LTDA 1Z2OX 4NJOA 1NVBA 4EW6A 2BJWA 4MLPA 1OV4A 2JRCA 3D4BA 4TWBA 3A4IA 3EPJA 1AQUA 2OENG 5C5DA 4MQ6A 1WB4A 3CB2A 1C2YA 1IHDA 3EXIA 3HZHA 2FUNB 2QLMA 3MIZA 3EZFA 4MQMA 1F8YA 3M89A 1BDJA 1E2PA 1N57A 1UZLA 2DWCA 3R6LA 4O4HB 4NK4A 2F7SA 2VDKB 4IMPA 5KREA 3FJOA 3EEFA 1P73A 1Y89A 4HFNA 5AESA 1KDTA 4DLTA 1UBEA 1VDZA 3OZWA 1N3BA 4RWEA 5LNK1 4P58A 2XCSB 3KU4A 4FNMA 1RABA 2J31A 1PS9A 3LW7A 3GEBA 5IDVA 5BWLA 1QNFA 2IK8A 4RD4A 4PAQA 2X8BA 4RFSB 1KRXA 1HMYA 3T1NA 1JTEA 1TIKA 4EATA 5JFOA 4GZ5A 1XG5A 1DXHA 1JW9B 2HLDD 1USUA 2WAMA 2DJIA 3FOBA 1ZOLA 1ILEA 4TMKA 2UYGA 1JBQA 4H7IA 2NPOA 4MGHA 4S2UA 2O0JA 5A3VA 4QECA 1N0UA 3L8FA 3OT1B 4GI5A 4CF5A 4YS6A 8ABPA 1JR3E 3BRWD 1V48A 4L9SA 3VTAA 4U00A 3RRFA 1W73A 1OLSA 2CZCA 5LBIA 2YR0A 3OA0A 1Y6FA 5HFNA 1H94A 2ECFA 3ETCA 4EGSA 4K6HA 3ST7A 2CLSA 2VS1A 3W1WA 4FBMA 1L9KA 5AJZA 1B3BA 5FLXA 5EPUA 3EXHA 3KJNA 3E9MA 2I7CA 3B6JA 4P53A 5CIWA 5CLQA 4ZOBA 1FZQA 5K3SA 1TUGA 5A6SB 2ZTMA 1C9KA 2PL3A 3QRWA 3ZUGA 4XWGA 3TRHA 2YQ5A 4O8CA 2ZVJA 1U9IA 4WN9A 1NMYA 3HEBA 3L1JA 4FCCA 4OB7A 1KSGA 1GFWA 1ZFNA 1CULC 2G77B 5CURA 1E2BA 1ZGGA 3W5JA 5ALUA 2QDXA 3PWZA 1IHUA 4TRMA 1J1UA 2HU8A 2VFAA 2W8BA 3DAPA 2AOWA 4K0RA 1NRJB 3RS3A 3PTZA 4BRWA 2YKGA 2VPZA 1KP3A 4WNCA 4N0MA 4FYHA 1AGNA 2BRUA 2A14A 4QBIA 1NVVR 1PVVA 3ZLVA 3U5TA 4EG0A 3CVVA 2FE1A 5K5EA 2ZSHA 3QW2A 4M1YA 1IBRA 1W88B 3KBBA 5HUHA 4W1PA 4AG6A 3O8OB 3C7TA 2GWRA 4QBGB 1ZOPA 3PEYA 1FQWA 1A7JA 1WVMA 4D4MA 4DZRA 5DXJA 2QJFA 3ADBA 2GJ4A 2JGIA 1TOAA 4HDSA 1SR8A 3I6QA 4H17A 4PX3A 5L40A 3A31A 3ON5A 3G5TA 1O57A 4RV9A 3WISA 5ADWA 4ZV7A 3D6JA 2GF9A 2YV3A 4HVAA 3QA3E 1LLDA 1UDBA 1Q15A 5EVCA 3GJ4A 4TL7A 3QPVA 5LQUA 1K92A 2ILTA 2JS7A 3OJEA 1CEXA 2HKIA 5EQTA 4YP1A 5I6DA 3GLFE 1W29A 1QB8A 2ZE7A 4DJDC 3ZVKA 1DAGA 2RGWA 1IU9A 3KUXA 3ZLUA 2KHZA 3HBMA 2FFQA 3BKWA 3KIPA 3OX2A 4PAWA 3WHLA 4EECA 1WULS 3DXXA 4HXYA 1WVGA 2P69A 4KMOA 5HCUA 4EG7A 3GP5A 1FSGA 1JFLA 3DZCA 3FPBA 3O3OB 4ZVSA 3U5ZB 1Z0IA 2ZAOA 3ETHA 1PZFA 1S2NA 3WB1A 4Y9UA 2RBEA 2VJDA 3Q5DA 3G2LA 4FWBA 4EVQA 2HJWA 5DLYA 2J41A 4Y6GB 2PUCA 1V37A 2W6ZA 2QDKA 1PFQA 4BN4A 3AQIA 4JQCA 5HMLA 3U31A 2YHSA 3ABIA 1NASA 4QVKA 1QP0A 4ZAZA 3C43A 4MDHA 2GEKA 3U44A 1TAHA 3HDJA 3ISVA 1GNTA 4J4HA 3D8UA 2VJMA 3THWB 1FMJA 2DH5A 2YZGA 1W0JD 4UAGA 4ZV4A 5L3RA 2WD7A 3V6MA 3K09A 4H0CA 1AZSC 2IPXA 2ISSD 2QTFA 4WHMA 3W7AA 1CQZA 2VXCA 1CZHA 1DZIA 2P9GA 4ZZIA 3BHMA 4NDAA 5I01A 2CHQA 2Q6LA 4K9OA 2IEIA 1L4KA 2FEPA 3DGFC 4CL8A 3A9WA 4CEJB 4B3TB 4NQZA 3KQMA 2D2IA 2CVZA 2I2BA 3R40A 4WN3A 3KEMA 1BKSB 4R7ZA 2HFKA 3TCXB 5ITVA 1XZNA 4M4SA 3GLHA 2PGAA 4WERA 4EBBA 1P0MA 3BIWA 2ZGVA 5FUBA 2FW8A 2O52A 2WQ7A 3E61A 1B14A 4OLJA 4EFLA 3EQ7A 3RRZA 4XYLA 1KQGA 3KQLA 3B85A 1PFKA 2QG9A 3B1WA 3P0HA 4JSRA 2HMWA 1EQAA 3GUUA 4KODA 4NLLA 4F72A 3P26A 4L4YA 3ZDZB 4A7PA 5JC8A 3QYPA 2EW8A 1A82A 4HDCA 2J30A 1O9BA 3B6IA 4N8EA 1NXXA 1ZJ6A 1T2VA 3K4PA 3KL2A 5CP8A 1EX1A 4AYXA 5DE3A 2QD5A 4KJZA 3STWA 5GADl 1E0SA 3CKLA 4IS3A 4CW7A 2FR8C 1YRWA 2JFPA 2Y4NA 3AB7A 3DTTA 1P61B 4O08A 4QUDA 4DNPA 3V1YA 5JZSA 5K8IA 3FROA 3ZW8A 4CLRA 1CQJA 3PJDA 4NJMA 5IVDA 5FPTA 3H8VA 2G63A 1ECPA 3JQFC 3FWHA 1ODFA 3R6TA 1XFAA 4WCFA 5BN5A 3NVMB 2IELA 2EHJA 4WK0B 2P68A 2L0XA 1Q3KA 2Q7OE 4LSWA 3UYKA 5ENDA 4AUNA 4NULA 4GVLA 4P34A 3BORA 1GGEA 4C29A 2COEA 3FNBA 1NVEA 1N9ZA 2I6UA 3R09A 4B4VA 1EWYA 1TYCA 2OQRA 4PQRA 3KDPA 4XCVA 1UP4A 5DNYB 1JL3A 4LPSA 4NYIQ 5AW2A 3GLGA 2A9JA 1E1RD 1P2SA 5KCZA 1B26A 2WWTA 4WTOA 4WCVA 4ALLA 4EMUA 1W0KA 1G42A 5CDFE 4JJKA 1CTQA 4TYYA 1MPXA 2AZTA 4P84A 4ZOEA 4E09A 2I6SA 1VGVA 1TMOA 1IB6A 4X66B 5KQPA 1I36A 2Y6UA 2A5YB 2A1TS 3SP1A 5KJFA 4S35A 1KSHA 2RK4A 3S8EA 2FR8A 3AFNA 4UEJA 1HYHA 5LQSA 3WRWA 1T13A 4OJQA 1NHWA 3FJ1A 4LQ4A 4MVJA 4PQEA 5EWLB 3C3DA 1RACA 1XUOA 3WGZA 1T36B 1BXZA 3AQ4A 4B35A 4YT8A 4Z7QB 1KWKA 4E11A 4DIDA 1HQKA 1KJ8A 1VMKA 3JAWB 4JUFA 3U61B 4G37A 2GHTA 4PV7A 5TVGA 3AWDA 4JXXA 2BSAA 1D2HA 2G6TA 3P0JA 3GP8A 5KYUA 1JVBA 4I4NA 1XZEA 5LP1A 4WUTA 4RTSA 1BD3A 3KZMA 1O94A 1SCUB 1XA4A 2YWRA 1WG8A 2WICA 3GZ4A 4MAFA 2NQTA 1AUOA 3GEPA 1SVWA 2O4UX 1BHQ1 1QFXA 2EJBA 3BMNB 3GRPA 2RDMA 3IAM1 5EZSA 5ILGA 1UDAA 3NKVA 4R8LA 2O7VA 2F1OA 5G53C 4EUHA 4D4GA 4W9NA 1F1BA 2PNFA 3O4VA 1RYZA 5U9CA 1NIJA 3A0RB 1DKNA 1G5IA 3GLKA 1Q95A 4RKFA 3HWX1 3BGOS 4EY3A 4MUYA 5C7OO 1SXIA 4DIBA 2QY6A 1OWLA 4N0EA 1YDFA 3NGXA 1BA2A 4ZMSA 4IGIA 4NPCA 2NMVA 1BS2A 1F2TA 1ICEA 1YK0A 3D6AA 3QMWA 5TQ0A 1FE8A 5EA2A 1QE5A 1RC0A 2C3YA 3D4NA 2BMVA 3I9V6 4KP7A 2BMJA 2IOFA 4NZOA 2JRLA 4YASA 1YJ8A 3S55A 1XMIA 1AMNA 1ODSA 1CRWG 1W85A 1JALA 2C2GA 3T1QA 3LC1O 5CVEA 5EE3A 3U4CA 2VQ3A 1LCIA 2WVAA 4V1CB 5TT0A 2XGSA 4YRGA 1TMGE 1Z4NA 3OQBA 3A6JA 3UHAA 4BFXA 4BRZA 2WAOA 4B17A 1O0CA 2X8JB 4GVXA 3B20A 2PUHA 2PD3A 2XY4A 3QOFA 1FSPA 4Q4CA 1Q0TA 2BL4A 1V8DA 1CX9B 4HWGA 1JPUA 5B3LA 1DCKA 1YK1A 2HPZA 2PMDA 3KUCA 5GQSA 4JI8B 2H00A 4IQ8A 4F96A 1V5IA 2EARA 4EA7A 1O9HA 1ADJA 3W2IA 3B6EA 4GQBA 5L4SA 1W94A 2G06A 5T3UA 1XEXA 4YUXA 2AN4A 2G9VA 3BICA 1RCUA 3OJXA 1UR5A 5ALRA 2PRSA 5DXFA 1NHGA 3V48A 3D1JA 4L07A 1LBQA 2YDXA 3NP7A 2ZIWB 4QDXA 2FRVA 4DIMA 4DV2B 5DM1A 3HVHA 5IZCC 3PXXA 4TN5A 1GQOA 3GRAA 2LP4Y 3C5VA 2A5JA 3DCJA 2IX9A 4N0QA 4KFUA 4F4JA 3JW8A 2UXBB 2A9KA 3JYLA 1JIQA 2FWBA 2WWGA 3LY9A 1TTQB 1E1YA 3E1SA 3PUKA 4ZQEA 5J40A 1DS6A 3ACBA 4IFTA 4AU1A 2PRZA 2RGBA 2FXVA 4L5AA 3E0XA 5AI9A 4FGZA 2IHJA 1TZ2A 3S3TA 3WGVA 5CA0B 2QD4A 5ALYA 2F3QA 2E5LB 1ZH0A 5KAPA 4R5HA 3PGLA 3NIBA 4UDXX 2VA8A 2XA2A 2R5NA 3EWNA 5E1DA 4LXTA 2V9PA 1JYSA 4E4TA 3NFRA 2VNIA 1V8ZA 4HX2A 4UAVA 5BV2P 3QY0A 3BUSA 1PFYA 4LHYA 1VIVA 3QEKA 5AICA 5KTSA 2OCLA 5LYYA 4CTNA 1MG5A 4M7PA 4NYMR 5LQKA 1WPQA 5D5HA 1Y3BE 2CEAA 2QUBA 2YUIA 4JKOA 5E1OA 5JWOA 4GPZA 4RHXA 4OFXA 2ONJA 1S5PA 3H4IA 3I52A 2IU3A 3VI3B 1JF8A 3OMWA 4Y0AA 3ZIAD 1Y1PA 3QKIA 4OMDA 1A9OA 2UXDB 3EZLA 5T4BA 1NWCA 2R85A 1JHYA 3OESA 3PWKA 1OB5A 3ZV7A 2P9ZA 4UQOA 3CQ9A 4X7BA 1JEJA 1FSFA 5A9SA 3HVUA 5FF9A 2ARKA 4HBGA 4IYRA 4D9NA 1CR0A 3N7TA 3GELA 3PE3A 3GFFA 1R5OA 4PX5A 4P3NA 2G6BA 2BFCA 3LX5A 4BPRA 4ENUA 5AW4A 1QTQA 3H2BA 1FYVA 4OSOA 4ZT2A 5JAIA 3DV0B 2R2AA 3TL6A 1K06A 7REQB 1XAIA 1G98A 4PHGA 1SVNA 2WUWE 4D9JA 3U7FB 2X6QA 4Y1GA 3ZEAA 4K88A 1XVAA 3CLSC 4IH1A 4DLBA 5JATA 5JZVA 3RAJA 5GM1A 5GV7A 3AJ8A 3HACA 2W2LA 3NETA 3OWHA 3WGGA 5LKRA 3L8HA 2R00C 2ODWA 3EGEA 1A71A 3UT5A 3J81A 1XTZA 4UD2A 3EBPA 5MN6A 1P80A 2PBZA 2PUBA 1KXJA 5BP7A 1TJ4A 1SZPA 3NAQA 1EHYA 2CMFA 4EKDA 2VDWB 3N3BC 4CM6A 4D8YA 3HKCB 1GKUB 1JKJB 2UKDA 3R7LA 4DDTA 3RC2A 1OH8A 1HNXB 4WY8A 3LOPA 5H70A 5JNUA 3I5XA 1TE2A 3NBYC 1UOEA 3IMEA 1XK6A 2ZJ4A 3INGA 3DBVO 2R62A 4RM3A 4DA4A 3WYBA 3PCRB 4XSHA 3DTYA 4GXTA 3NXKA 3RSZA 2EBWA 4MUKA 1VHJA 2I78A 3D2CA 4JP5A 1Q7GA 3CVUA 4P8RA 5K8JB 4YRTA 3MJ4A 4FFRA 3PLRA 1W35A 4WA7A 1PSZA 5I4KA 1NTRA 4YIHA 2G9QA 4U7PB 3RKUA 1J2YA 1PR9A 4XKJA 2FWNA 5JSYA 1EBBA 1OPRA 4URUR 3Q11A 1ZD5A 4IDHA 1G9XA 3FGPA 5AKIA 4F38A 1G7CA 3QP9A 1W5TA 5ES4B 4DSUA 1L6RA 2PGLA 2GB4A 1TJNA 3EJWA 1QHIA 3ZWXA 3B9RA 2PO5A 3H04A 1P1BA 3P27A 3PFHA 3V6LA 1WF3A 2ECPA 2ZZKA 3O26A 4YJ3F 3MCWA 1C8BA 3VU3A 5BMVB 1G2PA 1W5EA 2VYNA 3WIOA 4TWZA 5EHGA 2VJCA 3MWEA 3T54A 2I8AA 4ZU1X 5L7TA 1AMUA 3U1TA 5CU7A 4BNTA 4JDPA 4ARVA 4GPBA 4EOGA 4B48A 1J42A 4H27A 4OB8A 3LP8A 1GZ4A 1WUKS 1RKBA 3E9NA 1J8MF 2BM0A 2X1LA 3CLRD 3MPOA 4D9HA 1HBJA 4KXFB 3VJMA 4UOEA 2X42A 3P0RA 4R4JA 2JIZA 2CT8A 4BX2A 4JJFA 1QK4A 5JQGA 1QVWA 3AFMA 3M0EA 1LX7A 1NR7A 2E3JA 5A5DA 3RVKA 3ZDBA 3ZE8A 3P97A 3HU2A 2OG1A 3NV7A 2W93A 1GTRA 1JR6A 1EIZA 3M33A 3G13A 1F9AA 1KY5A 3CPJB 4CM1A 5JDIA 2XHEA 4L4SA 1IY2A 3G5MA 4QPJC 1U0TA 1OVMA 3OVMA 1IN7A 1DG3A 2J5RA 4QU9A 3U80A 4A6PA 4AY3A 3LFTA 5GINE 1T5OA 1MU0A 1RYMA 1SVLA 4WGGA 1NF9A 1FUIA 2CJYA 3GF4A 4PE5B 4ZVVA 3AF0A 1P17A 5KCMA 5JNRA 1LLFA 2A9FA 3HJNA 3NM4A 4I3GA 3OOSA 4R8RA 1USWA 1P7WA 3TF5A 4W1QA 4JEUA 5KNCA 1PWEA 4R2IA 1ZP6A 3G0BA 2A9OA 1BRTA 2PX8A 2RAUA 3TSZA 3IOEA 1BIFA 1KC3A 2PAAA 4GUAA 2DX7A 4NDNE 1L4EA 4BB0A 1AGPA 1CUWA 2V6JA 1U9YA 5AM4A 2KI5A 2QW8A 2VPQA 2C5GA 3WL6A 3KWMA 4FZ5A 5SZIA 2VO1A 4PINA 3BG5A 1LV8A 2EBHX 2DBVO 2EGGA 3UATA 3A06A 5BWOA 5K6RA 3GFRA 3IP9A 5B2FA 4I9HA 1RZRD 2I6FA 4QUGA 4HAIA 1GZ7A 3QA9A 1PS0A 1JYFA 4CT5A 4DR2B 3W5CA 3LWBA 1K5HA 1K86A 2A59A 1LWOA 1HFEL 4HDNB 3MS2A 3OU7A 2RC6A 4HZIA 4P81A 4QPPA 3VKUA 5HKKD 1KYTA 3I58A 4G84A 1PZGA 4CVNA 3K9WA 3T52A 3QKSB 4BNDA 1T4CA 5A9RA 5K09A 4LZPA 1YFKA 5HE8A 1GNQA 4FI3F 1N6IA 1N2OA 2VP9A 5D6NA 1NBOA 3TOCA 4NMLA 4LUCA 1T15A 3WKCA 3UK0A 3PX7A 2RGXA 1C5KA 3CB4A 4YWJA 2NUTA 2JD2A 2ZI9A 1U2RA 2OVBA 2P9HA 1JE1A 4X94A 3SYTA 4ALNA 1TKAA 5JEDA 6AT1A 4QUBA 2BEWA 4MKIA 4RLHA 1S01A 1CQPA 5ED0A 4NZZA 1Z6PA 1XTSA 5JXHA 3Q41A 3TOSA 1MC8A 3MSXA 1SBCA 2PX0A 2BM1A 2HF7A 4HNHA 3P9XA 1GV1A 5B3JC 2GN4A 5KWSA 5EAIA 2ODBA 3VDMA 2VJOA 3GYBA 4YMSA 4AJJA 2PN1A 1ITZA 2D8MA 3P4XA 4AF7A 2Z4TA 1YU6A 1JEQB 2NU7A 5JG7A 3WGKA 1RRPA 2H1OA 4Q1EA 2LUOA 3B3QA 1KEKA 4YI3A 4IDGA 3TRIA 4PZ9A 2O5CA 5BV1A 1QHHA 1FBTA 1FY2A 1SA0B 5KOHA 4F6RB 4DLYA 1US8B 5AIBA 3CT6A 3EEQA 4E88A