3B5JA

Crystal structures of the s504a mutant of an isolated abc-atpase in complex with tnp-adp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
243
structure length
243
Chain Sequence
HHDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-hemolysin translocation ATP-binding protein hlyB
publication title Water-mediated protein-fluorophore interactions modulate the affinity of an ABC-ATPase/TNP-ADP complex
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 73
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2007-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3b5jA00
4DJTA 4Q1DA 2WTUA 4XD7A 4Z1MD 5EP4A 1Q20A 3AB3A 4YXWA 2JDID 1AIPA 3IILA 1TX4B 5EP1A 3VKHA 3ZQ6A 3GFTA 5EXPA 1T0JB 1KAOA 2YOGA 5FOVA 4GT1A 1UF9A 3RRYA 2FNAA 3GLHB 2OO7A 2V3CC 3TH5A 2ZM5A 2X1VA 4ZDJA 3UK6A 3P4XA 4QOSA 4ACAA 2FGKA 3ZGXA 4MUAA 2NOAA 4EKDA 2BC9A 1DARA 2QMOA 2JJ1D 3TSOA 1M8PA 4TWZA 1MO6A 2PL3A 2WAXA 1OPXA 4LV6A 4F4JA 1N5JA 4B35A 1A5TA 5KPDA 4Q47A 2QE7A 4HB3A 1TQ2A 2V54A 4JVLA 4C0JA 1CLUA 5JHHB 3RWMB 5BYKA 3K9GA 1YR9A 1P7CA 2ECKA 2QTVB 2YWHA 2CCJA 3EIEA 1P3JA 3D31A 3OFNA 1Z6TA 3FB4A 3M0EA 2WICA 1GDDA 2C8VA 4PANA 1HT2E 4Q1EA 1GAJA 3CX7A 2QTFA 2ZYUX 1CR4A 2PT5A 3V00A 3U60B 5E3HA 2ZJAA 5BXQC 3WNCA 4GFDA 4IOJA 1KSGA 1U9IA 4D2IA 1X1SA 2HCBA 4U5XA 3B9QA 3RLFA 3THWA 2A78A 4TMXA 3N2EA 2VRWA 4B73A 4A15A 1Z6AA 4D80A 3ZIAA 2YNMA 4DLWA 5DLQC 3PCRB 5H8WA 1KYIA 2ODBA 5DE3A 2V7QA 3V4RA 2OT3B 2QEQA 4KVGA 3L8YA 2FX3A 3B1WA 4EQ6A 2XJ4A 5FFMA 2NMVA 1G3RA 3SJCA 1F60A 1Q0UA 1RIFA 2ZR7A 621PA 2DBYA 2Q21A 1Q44A 2ZVQX 2X8AA 3GD7A 3W6NA 6Q21A 2NZ8A 4D4KA 2WMOB 4TYQA 3KXLA 1W36B 2IS6A 2H57A 2WAYA 1XCMA 2YYZA 3WY9A 4NCKA 4HLQB 1RW4A 4QL3A 1E79D 4OQFA 1T3HA 4P4UA 1RJ9B 4HDCA 5EE5B 2ZJOA 3A8TA 1G5TA 1YZLA 1KJZA 2R65A 4I1SA 4YDSA 2IS1A 1JJVA 2F1RA 3LWNA 4L9SA 2PJRA 2REOA 3JVUA 4O0MA 4HAVA 4BLSA 1CJKC 1ZRHA 4Q03A 3W3ZB 1ZNXA 4AIIA 2MMCA 2JDIA 4Q4AA 4JLVA 4D25A 1E98A 2W2VA 4HDOB 1NKTA 2RHMA 5A4JA 4R2IA 3RABA 2A5GA 4HEJA 5DNYB 1VCIA 3SI7A 3RC8A 3CM0A 1LY1A 2WPDD 2ZI3A 5FBRB 3CZQA 4QGFA 2WWYA 3AM1A 3AVTA 1AKYA 3AP3A 2BBSA 2JEOA 2GWHA 3AVXA 2FE4A 1BYUA 5LD2C 1KKLA 1G7RA 2QL6A 4A6XA 2QBYB 2YHSA 5BN4A 2ZJBA 2BMJA 3G5UA 4W5JA 4WXPA 5FTJA 1YR6A 4JLBA 3RRMA 2JJ1A 3RVBA 5EE0A 1NN1A 3NBZC 1YVDA 4KV9A 3EASA 3K1JA 4P33A 2DWQA 2WIBA 4JL6A 4LJYA 2OFXA 3E2IA 4HYYA 1R0YA 4P0TA 3K09A 4QJ3A 3PENA 1C4OA 3K09C 5IF9A 1XTQA 2FFQA 2FSHA 1E2EA 4MKHA 4JIMA 1SKYB 5HZKA 3C14C 2QZ4A 2DWOA 2IF2A 2QQ0A 4B2PA 3IO5A 5J4HA 3OAAD 4MRVA 4DSUA 3IO3A 5HE8A 1FTSA 1CTQA 1M7GA 3CF0A 1G8FA 4Q9LA 3TSZA 1BIFA 1L4UA 1N0VC 2GCOB 2GESA 4OL0A 4PQYA 3TQFA 4D0LB 4UNRA 2XB2A 2ZJZA 4M1OA 3RANA 1LS1A 4LV5B 5LB2A 4D4LA 1GILA 3FVQA 4ARZA 2IYUA 2ZXUA 5L3QB 3NEJA 1EFUA 1KI8A 4XH9B 4XWKA 3SZRA 3EZ7A 5JS7A 2BEKA 3X1WA 4MITA 4M1MA 3T5GA 4XIGS 4Q4JB 2P5SA 1XFAA 4PC2A 5L3VA 4Y0AA 2XTMA 3W8NA 4J0QA 1NSFA 4EJSA 3PUZA 2AL7A 1LFDB 4EJSC 1OV4A 5JEEA 4KAXA 4CEIB 1N5KA 1FFHA 2C04A 1XTSA 1FX0A 1E79A 4ZIRA 1XEWX 4TL7A 4M1TA 3ADBA 3F3YA 3FFBA 4LYAA 2HYDA 4BFWA 3SBEA 5D3MB 2QU8A 4TZ0A 1GSIA 2H16A 2ZSDA 2KB0A 5K8TA 3IIJA 3AKEA 1UBGA 3MGCA 5AK0A 3ZS9A 3AVVA 3LV8A 5FBWB 1NMYA 1L4YA 1XEWY 1ETUA 4GZMA 4L8GA 2NPFA 1CRQA 2R44A 2FFHA 1AA9A 3SHWA 3K70B 2ZYWX 4G5OA 1OXXK 1MR3F 3KQNA 1T6NA 1ZYUA 3EPKA 2DPXA 1P6XA 1AGPA 4HLUA 1IXRC 1P75A 5TV2A 1KJYA 1P9WA 2ZRMA 4TLEA 1I4DD 1K8RA 4PXAA 5IHPA 4Q01A 1ZU4A 2O0HA 2ZRHA 2I1QA 3FFAA 3PXGA 2F43B 3O8RA 5KSOA 2FMXA 2ZSFA 2WV9A 1N6RA 2RGNA 1AS0A 2A9KA 3U6KA 2IYQA 5EUMA 1X1RA 5F9HA 2QUZA 4B47A 1OH7A 2IS2A 4BEJA 4B32A 2HEIA 5L8VA 5M04A 2ZU0C 4A6PA 1XJQA 3NH9A 1EFCA 2EFHB 3EIHA 4LYHA 4ZPXA 3EC2A 3QF4B 4DHEA 4WIAA 1Q1EA 5JLJA 3AF2A 4HDQB 1IAQA 1VDZA 2QAGB 4RZ2A 1ZM2A 2P65A 3K0SA 3B1XA 5AJZA 1WCV1 4WW0A 3OAAA 4R2HA 3BORA 2QSYA 5SZIA 3I61A 3T06B 2OXRA 1TADA 2YWFA 4OYHA 1GG2A 2CDNA 1DOAA 4RD6A 5B58C 3FMIA 3NBYC 1UKZA 1YZNA 2G3YA 4N1AA 2VLIA 2EWVA 4OHWA 4B34A 1IJFA 1UKYA 2NG1A 1D5CA 4B44A 1Z47A 5EXSA 3W9YA 1HV8A 4AD8A 4A2WA 4Q02A 3OEED 1KZ7B 2EFEB 2OSBA 1QHIA 3KTAA 2LKCA 4JZKA 1NLZA 2FA9A 2FZLA 4LHYA 2OCYC 4LOAA 5EQTA 1XF9A 4QKQA 2FSGA 2KBEA 1AZTA 1KAGA 4A8JA 1MT0A 4A8JC 4TL6A 3DM9B 1HTWA 4V0ME 4PFSA 1XTKA 2BM1A 3GPLA 1PLKA 1T8TA 3IIKA 3R7WB 5C1BA 4V0OA 5JHGB 1IN8A 5FPKA 2ZS8A 1G5RA 3FMPB 3PIRA 4O2RA 3NKVA 4ASUD 1VHLA 2AN9A 2GJAA 5ANRB 2Z5FA 3OIYA 2QBYA 1Q57A 2P6RA 2IHYA 3LRPA 1XXHB 3C5CA 4B71A 2XNDD 1T4GA 2RB4A 3LFUA 4Q1CA 4FMDF 4UNSA 5DI3A 2G9NA 1VYTA 3VU9A 2ZRJA 4IOLA 2B6HA 3AVOA 2IK8A 3T35A 4DZZA 4M9XA 4NMMA 2IXGA 4ZDIA 4DDWA 1E9CA 1GP2A 4IXMA 3GCGA 3UWKA 5JECA 2ANBA 4CT5A 1QZXA 3IBYA 3QVUA 1NY5A 2ZRNA 1PZNA 3GFPA 2CCKA 4M22A 1XCGB 3ADCA 2VH5R 3A1SA 3HU2A 4MKIA 2EFGA 5DYIA 5J4LA 2ZPTX 3PR1A 4MKGA 4BFUA 4Q7MB 2ZI5A 1W49A 4HUQB 4OI4A 3AV0B 3QPWA 4UNPA 4OQMA 1R8QA 1EWRA 3ZZ0A 1ZM9A 4OQLA 3GP8A 3TLXA 1OIVA 4TMKA 4JLPA 2QSZA 5BQ5A 1GNPA 2O0JA 4XVUA 2E9SA 4B2LA 1OT3A 2ZS9A 4XWOA 2J5XA 1Z2CA 3KB1A 5CYOA 4Q4JA 2B8TA 2ATVA 1NMXA 3A37A 5FPYA 1R5OA 1Z08A 3QI2A 1A1VA 2CK3D 3U44A 1KO7A 4HB2A 2VHCA 4NYIQ 1E9RA 5IDVA 1P2UA 4CEIA 4BFVA 1CJUC 4NDZA 1II9A 1XD9A 4RFSA 4QG7A 4FD2A 4TTPA 1NN0A 3SJZA 4RJLA 2ZE8A 2IA5A 2EYUA 2Z83A 4DCVA 3RDPA 4PO8A 2QP4A 3TIFA 2IF0A 5JCPA 2GEVA 3K8YA 4M1KA 2P6UA 5DHAA 4ZCIA 1PVOA 1II0A 1YZTA 3CB4A 3OEEA 2Q6TA 3BWDD 1ZJ6A 1JXMA 1FMLA 1HY3A 1WDTA 3TW4A 2IUTA 3B2EA 2YVUA 4NYJR 2J1LA 1OIWA 4A0RA 3THXA 2XAUA 2GJKA 3KXIA 1XEXB 2VBCA 2W2TA 4QXAA 4BWYA 3MD0A 5K8IA 4LCBA 1U0JA 3FYHA 3PFIA 2QPTA 4ASUA 1JEDA 4PX9A 4DBLC 3U4QB 3GMTA 3U5ZB 4FI3C 4QJ4A 3BB3A 4QNRA 1F6BA 4UXJA 3T12A 2D7DA 2XZLA 2W6ID 2XITA 4CYMA 2F9LA 2XNDA 4V0MA 3MRSA 1VG8A 2G77B 3IQWA 3LQQA 1RYFA 2YINC 3TE6A 5TMPA 2WSMA 1Z5ZA 1SVIA 4EAQA 2XXAB 3KJGA 2DB3A 3EWSA 2J7PD 3REFA 4KVAA 4C0KA 3BBPA 2A2ZA 1XZQA 5FOWA 2WSSD 1KIMA 4NKRA 4LK2A 821PA 1YZUA 1R0ZA 2HJVA 4LRWA 3VAAA 1H8HD 1JALA 3QKSB 4N3NA 3HR7A 1KY3A 2ZRPA 2ZE6A 5KU1A 1DBSA 3LX5A 1LTQA 5FBQB 4B43A 2WOJA 4DRZA 4C30A 5K8LA 3ECCA 2CXXA 3SS8A 2RGAA 4WAUA 4JSYA 2EFDB 2I4IA 3J81k 1HE8B 2KSQA 1LF5A 3LVQE 3BH7A 1OSNA 3AUXA 4HZUA 3RRZA 4HATA 3WNDA 1W4AA 3GLIE 1OXSC 3KKPA 1G7SA 3CKLA 2JLUA 5E4FA 2ZE5A 2VSFA 3R20A 2ZR9A 1Q21A 1LS6A 3QEOA 2AK2A 3I72A 1U2RA 1NVVQ 2CK3A 1MRSA 2BDTA 4DLYA 1ESNA 2J9RA 3DDCA 2C99A 1G19A 1QBKC 3LAWA 4HAZA 4C4PA 1C9KA 3EX7C 3R7WA 3TQCA 1T5LA 2PX3A 3NC0C 3C5HA 4RD0A 5J4KA 2ZI4A 2PEZA 1ZD1A 1QHHB 1G3IA 4UJ3A 1KOFA 3OHMA 4O2LA 3U7HB 2V9PA 3AEZA 1P60A 1Z0KA 2IUSA 1UPTA 1WMSA 3NIBA 3NHBA 3R9WA 1IXSB 2KE5A 4HI0E 1TQDA 1E4YA 3I73A 4BRUA 4TMZA 3C15C 4Z8YA 3NC1C 1HE1C 2WWXA 1GOTA 2GAOA 2P67A 1E2PA 1Z0FA 3HPQA 3FHTA 1K6MA 4OHXA 5GJWC 4QGAA 3MJHA 1M2OB 4JL8A 4NL4H 1QHXA 2VL7A 2ZYTX 4M9SA 3HU1A 3ZVRA 2QQEA 3SNHA 1N5IA 2HCJB 2QM7A 1ZBDA 2AWOA 4U02A 5KSPA 2YOHA 3Q7PA 1E9FA 1HUQA 1M7BA 2OBLA 3LO5A 2V6IA 5DGXA 4BGDA 5FPTA 3CX6A 1W4RA 2W6IA 1MKYA 2BMFA 4OK5A 2QI9C 1SVOA 5EUQB 1VG9B 4BFXA 1TL7C 1SVKA 2ZRCA 4A1FA 3QKUA 4O3MA 4YXWD 1JECA 1GTVA 1II8B 1HEIA 2D2EA 2ZUBA 3DL0A 5CK5A 1KI3A 1E0AA 2J7PA 4A82A 3OE7D 2F1IA 2HXSA 1SGWA 1F2TB 2WSSA 3ZVLA 4HAUA 2HF9A 1J8YF 2GK7A 4KSCA 1N6OA 4GBMA 4EUNA 2QP9X 1H8HA 2ONKA 2VPPA 5KOYA 1NG9A 2GTPA 5A5GA 2WWIA 3F0TA 2FG5A 1XRJA 2BVNA 3CUEF 3U7EB 1E1RA 3W5IA 3MAAC 4Q7KA 4QGHA 4DLXA 3CRVA 3FE2A 4QGGA 3A58B 3P32A 1EK0A 2PCJA 1I2DA 1XU4A 2JJ2D 4L15A 1B0UA 1OLOA 1SVSA 4QFMA 1SHKA 1VG1A 4MRSA 4C7OB 1R4AA 1ZM7A 4KITB 4US1R 1CIPA 4LJ4A 1EXMA 1TAGA 2J0UB 3SJAA 1KGDA 2FH5B 2ZRGA 1BKDR 3OFND 3VHLB 1V43A 3U3JA 3TMKA 2R6FA 1NNEA 4EIWA 5AJXA 3IEVA 4ZI3A 3AVWA 1G8YA 2OBMA 4TZ6A 3BGWA 4KFSA 1KI7A 3CNOA 4WVFA 1XEXA 3GLIA 3VKWA 3A4MA 1OE0A 3T15A 2D2FA 3THOA 1RVDA 3EIQA 3D8BA 4C0AC 1CU1A 4OHVA 2G1KA 4MYHA 1LNZA 1G4UR 2OE2A 1DADA 2RGGA 3U4QA 5FBLB 2AD1A 2A30A 1NN5A 3TW8B 5HKKA 1EESA 1VIYA 2WMNB 3KKNA 3WYFA 4WA7A 4CEJB 2PLFA 4BLTA 4PO1A 4PQRA 5DSZA 4JKYA 1E2JA 2MSEB 3WRYC 4BZXA 2O8EA 4IDQA 3JZAA 4MYCA 5CJPA 3QOFA 4NZYA 1WB9A 3AVUA 2GJSA 3K0AB 3LW8A 4M9ZA 3TBKA 3N70A 3MFYA 1J8MF 3KKMA 1E2FA 2WJJA 4B3DA 3H0KA 4UKDA 1ZCAA 4JLNA 3SDZA 1IN6A 2NGRA 3OIWA 4XSGA 5BWMA 1XPRA 2P2LA 2ODEA 2EW1A 2PZEA 3Q5EA 3AGQA 4DLVA 2OCBA 1PJRA 2F9MA 3V9PA 2G83A 1Q1ZA 4R98A 3LW7A 1ZIOA 3FTQA 3LH5A 4L4UA 2QA5A 5GJBA 1YJ5A 1UADA 3AH8A 2CBZA 4GOXA 3PV0A 4OQNA 4DT1A 2VP9A 2R6CA 1ZU5A 4HAYA 1E2DA 1WP9A 3VMFA 4EPVA 4EPTA 2VP2A 3PITA 3OE7A 1M74A 4HAXA 1FUKA 3FHOA 3D3QA 3A1TA 2VIIA 4URXR 2BJVA 3VX4A 3BOSA 1EFRD 3EC1A 3QXHA 1JXOA 1AJEA 3Q3JB 4G0NA 1ZP6A 4QBHA 2PZGA 2NQ2C 1NBME 3DMDA 1KI4A 2VP4A 5DIFA 2EFCB 3L0OA 2H5EA 4NH0A 4YLGA 2Q3HA 1U90A 2G1JA 3I5XA 2VF8A 3H86A 1F48A 1GUAA 1KI9A 3GJ5A 2JJ2A 1G21E 5FR1A 1HYQA 4FIDA 2UKDA 2Q9BA 4IEEA 1GKIA 1NBMD 4GPTA 4NU0A 4A0FA 3HPRA 4UXHA 2W58A 4OK3A 1OH6A 5BYJA 2QROA 3CBQA 3LLMA 721PA 2GXAA 1TNDA 3RS2A 4XVRA 4E09A 2IW3A 3TRFA 2OLJA 3MUFA 1S1CA 1T0HB 1GRNA 1NI3A 4HB4A 3GQBA 1U9IC 3TVDA 4NCNA 4JT2A 2V8OA 4DCTA 4E5UA 1KTVA 1IHUA 3GLHE 4PC3A 1HH4A 4I4LA 5C4GB 1KO8A 4PZZA 4CF7A 2QAJA 1E2QA 2C96A 4HLDA 2WM9B 1D9ZA 4BQSA 1E2KA 3Q85A 1OYWA 1P9RA 1Z29A 1FQJA 2QMEA 3L82B 4C0QC 2AFHE 1NSTA 2V1XA 4LHXA 1T9HA 4NYMR 1IY2A 2REXB 1MABA 5AJVB 3CF6R 1JNYA 3T61A 2R6GA 4QBGB 5TVKA 4Z51A 4KSBA 1P4SA 4MH0R 3KQHA 1E0KA 1I2MA 1XZPA 1KHTA 4BFZA 2FFAA 4DKXA 3HDTA 3CR7A 1M1YE 4NHOA 4B3BA 3BD9A 1UAAA 1W46A 2PLRA 2W6JD 3U6BA 1XMVA 4Q9IA 2QRNA 1P2TA 4JJKA 5LBIA 3B1YA 2OHFA 4QBIA 3U7GA 4C7OA 2CCGA 3QKRA 1HQCA 3KJHA 2ZRFA 3R8FA 2G6BA 3W3AA 2J0UA 1KI6B 2OAQ1 1EFRA 4ESHA 2X77A 5FI0B 4G5QA 5KHOC 4DB4A 1DAKA 5KTYA 4Q1BA 3H4MA 2NO9A 5DI9A 1OFIA 3RNLA 1SHZA 2OCAA 2VTKA 3K0FA 5JJKA 1XCPA 2VA8A 4O25A 3SYKA 1SULA 4DWJA 1AK2A 4OI1A 4US0R 4PC7A 4RD2A 1KY2A 4ZI2A 5JSZB 2BV3A 5EE3A 1SQ5A 2Z4RA 1G6OA 3BB1A 3IHLA 1Z6GA 4PPFA 2IYWA 3EPHA 3OEHD 3MG9A 1O3YA 1EG7A 1NBMA 3WXMA 3ZD6A 4M0LA 1N6NA 2ZRBA 2B92A 2O8BB 1U98A 4GNKA 3K0AA 2BEJA 1ZCBA 3TJZA 2RGXA 1I4TD 1G6HA 1W36D 4IKEA 3ZJYA 2BWJA 4GZLA 4LHVA 2PJZA 3T1TA 1VYVA 3M6AA 3AGPA 1UFQA 2BHRA 2WJGA 3F8TA 5UKDA 4TQAA 2JLYA 4R9UC 2O0KA 3MWLA 1KNQA 1GNQA 1IQPA 1XD2B 1Z07A 2Z43A 3NHAA 1WQ1R 4H9GA 4PAMA 1JPNA 4PPNA 3EW9A 4QJ5A 5CIWA 4ZKEA 5G53C 1CJVC 3RAPR 3MWJA 4RCYA 3KZ1E 2FSFA 521PA 3WMEA 4BEBA 3QKTA 5HCIA 2J41A 1T3LA 4BUJA 1MO3A 1BO6A 3MWYW 4IVPA 3NH6A 4MGKR 1P2SA 1F5NA 2FWRA 1F3OA 4ACBA 1FPMA 3MSXA 4YONB 3DZ8A 2ZU6A 4C0BA 3GJ6A 3GLHA 3K0EA 4L16A 4AYXA 2NO0A 2OEPA 1KDOA 1VKJA 2ZROA 3QNUA 4GSYA 4Q9KA 4KBGA 5H1YA 2IXEA 4LSGA 1NG1A 4Q4LA 4I99A 1YR8A 4RZXA 1E32A 2WZQA 1BH2A 3IUYA 4EFMA 1RRFA 1SKYE 1UM8A 1VHTA 4PR0A 1YE8A 3PEYA 4BE7B 2W6JA 4KI0A 5JCZA 3ADKA 2V55B 3DZDA 1S3GA 4LUCA 2W00A 5TY0A 2ZRDA 4PSVA 3ZZTA 2Q3MA 3N2IA 3RS4A 1ZINA 1IONA 3X1XA 2A5FA 3RWOA 4Q4HB 4HLUC 3GJ8A 2ORIA 4TYYA 1X6VA 2CLCX 4V03A 2LCFA 4Q19A 3Q72A 3ETLA 4WZ6A 2DFKB 2R6AA 3UIEA 5JWOA 4MGIR 1NL3A 2JIZD 5JRZA 3QPVA 2ZJ5A 4DLRA 3UPUA 2RGNC 4KCGA 3L2OB 4NBSA 2I3BA 4XJXA 3EZ2A 4NP6A 3DVLA 3UWOA 3AQ4A 3KDSE 2ZJ2A 3O8DA 5CB8A 3LVRE 4XWAA 4B75A 3OEHA 4EPRA 2AHOA 2NIPA 3QXSA 4Q21A 1Y3AA 4FMCF 4B3XA 1G3MA 2J7KA 2IYXA 3CO5A 4BZPA 1A7JA 2IHBA 2XOKD 1E1QD 1E4VA 1KDPA 2OM2A 2OLKA 2ZANA 3C41J 3L0PA 5C18A 2AFIE 2I1VB 4IDPA 4FCTA 3CH4B 3EZ9A 4JLMA 1W36C 1OW3B 4KO8A 1LB1B 1N2CE 4Q18A 5CLLA 4ILEA 4JLAA 4M1YA 1FOEB 2RGDA 2BKEA 4GP7A 4WZAE 3CZPA 1CJMA 3NXSA 3SYLA 3X1YA 2IBMA 5KDOA 4LHZA 1ZM3A 4DCUA 3EG5A 1RJ9A 3TSWA 1E3MA 3BB4A 1T3SA 4YMWA 4ABYA 2V4ZA 4QM6A 1R7RA 1US8B 1HQYE 1A82A 3K9LA 4W5WA 4F92B 2GILA 3AP1A 2FEOA 3PEUA 4NPHA 2ZRKA 5L3SB 4GMDA 2D4HA 1QHYA 1G1MA 4DSNA 4KU4A 2C95A 1CBUA 2QGNA 1A2KC 3HYRA 3K70D 2XB4A 1C1YA 3P26A 3PEVA 4S2EA 3QVVA 3UMRA 2WWWA 4D4JA 2IX3A 3ASZA 4LHWA 3BK7A 3CPHA 2H1LA 1W5SA 3KL4A 1H65A 1Z8FA 1AQYA 4Q9HA 4ZO4A 3TK1A 3KUDA 4RFVA 2PMKA 4B6EA 5F98A 1E6CA 3AF3A 2J87A 1KSJA 1OB2A 1UBCA 1XJCA 2GZAA 2W83A 5H70A 2VP6A 2FN4A 2IYTA 1Q12A 4MDFA 3RS0A 5E7JA 3FHCB 1GITA 1A2BA 1S4QA 1R10A 3WNBA 1I4LD 4PSAA 3SFVA 1NMZA 2AR7A 4DDVA 3P20A 1Z0AA 2AK3A 4G5SA 5J40A 1ELOA 2H17A 1P5ZB 3QQ5A 4LJAA 5EZ5A 3NTUA 4A9AA 4P31A 2ERXA 1XMSA 4B3GA 2MSCB 1KSFX 2ASEA 4ZDWA 1OH8A 1NP6A 2GF0A 4V02A 1G20E 2ZSAA 2ZJYA 4LYFA 1WRBA 2IT1A 5G40A 3REGA 5HCNA 1TQ6A 1KO4A 3B13B 4BPBA 2J0QA 3AKDA 5IRCD 1TEXA 2JIZA 5CYPA 2GCOA 4C0HA 1OB5A 1CULC 3I8XA 5IT5A 5AJYA 1KO1A 1J99A 2QTHA 2ZAMA 1P2VA 4JLJA 1XD2A 5L3QA 3BH0A 5G41A 2HT6A 1RRCA 4A36A 1PUJA 1KMQA 4PO9A 4BFSA 1IXZA 1VCNA 2GXQA 3QUSA 3P1JA 4DSTA 4LBWA 4HAWA 1B23P 4B33A 3VNVA 2XOKA 1E1QA 4II7A 3KB2A 4PPGA 1NJGA 1XXHE 4AYTA 3UANA 1JAIA 2WBLC 4K46A 2RGBA 4G1UC 3SU8A 3MLEA 1CS4C 2F1HA 4D81A 2H8KA 2PZFA 5FTNA 1SKQA 3AVQA 5KNCA 4OHYA 3SR0A 2WVJA 4LWZA 2CE2X 2JASA 3BE4A 5CJ2A 2DCUA 1TEVA 5D3MA 2C2HA 3KX2A 3QENA 2VF7A 4A4DA 3WMGA 3CPJB 4XSHA 4QHSA 5FOXA 3ZQJA 1KMHB 1N25A 2HLDD 1N0WA 2Q0HA 5EE9A 4ZCMA 2REBA 4JMPA 2O8DB 1YKSA 3TKLA 3CH5A 3K70C 3TAHA 3VR2A 4IDNA 4TTRA 2UZIR 1L2TA 3VKGA 2JLSA 3THYB 4DCNA 2GDJA 4OBEA 4URWR 3SBDA 1XMJA 2QORA 4V0KA 1S2MA 1J7KA 1GL7A 4KFTA 4QBFA 1ZVQA 2F43A 1P9NA 2IS4A 1RKBA 2BBTA 2AXNA 2IYZA 4A0HA 4KJZA 4ZCLA 1G3QA 1QRAA 3EPJA 2YKGA 4I1VA 4Q7LA 1R5NA 4PC1A 2QT0A 2OFOA 1DE0A 1Z06A 4M2LA 4XTCS 1OXTA 5FL7D 3DKVA 2CVFA 3GJ7A 4XVQA 4YQFA 5FH9A 2H92A 1MOZA 3QF4A 4JYCA 1QDEA 1G17A 1E69A 4V0NA 4N0DA 1TMKA 1VG0B 2P6NA 3IKJA 4GMXA 4MUBA 3AVYA 1K5GA 1PUIA 2QAGA 4E22A 1AM4D 2QAGC 1W2GA 3L8ZA 3AF4A 1XP8A 1T8UA 4JVNA 3T1VA 2TMKA 4HUTA 4FMDB 2CMKA 4X8OA 1E1RD 3WHLA 4N0EA 3N5CA 3QEJA 4IFBA 5FL3A 2PCLA 2YV5A 3OIVA 4FCWA 1US8A 2ORWA 4B6FA 1QVAA 3FMOB 4PAQA 3IEUA 2D74A 2H18A 5C2JB 4X8MA 2PBRA 1XJ0A 3Q5DA 5HR5A 1NY6A 3ZZUA 1KK2A 1TUEA 1CRPA 4F91B 1HA3A 5DH9A 4I1OA 1YQTA 4RY2A 5G3YA 1SXJB 1UKVY 3IPXA 4Q1FA 4Y0VA 5KUTA 2IYRA 3SQXA 1ZW6A 1ZNWA 1QG2A 4OKSA 4JYBA 5FUWA 1EGAA 1G8HA 3S1AB 5F3WB 1KK0A 2N42A 3NDBB 5CITA 1E9BA 2IYYA 5FBVB 3EPLA 4JVMA 5HE9A 4MYUA 1Z0JA 2AX4A 2D06A 3SFZA 4PZYA 3RS7A 1FP7A 2ZEJA 5HKKD 4PTLA 5JJIA 2JLXA 4BASA 1XXHA 3HU3A 1SVLA 4ZV4A 3Q8XB 1RFLA 2C5LA 4CW7A 2P0EA 2HLDA 2OXCA 4AKGA 1S96A 2CLSA 4RCZA 1QHGA 3U3OA 5KDLA 2ZITA 4LJ8A 2XEXA 2VHTA 1E2LA 1CR2A 4CRWB 2W0MA 2CL0X 4YDHB 3L0IB 2ZI9A 5F2EA 3U7FB 2KJQA 1GKYA 2C98A 1G4AE 4PAOA 5TXGA 4FMBB 3LDAA 4GL2A 2CL7X 2J0SA 1Q22A 4OQXA 4BLPA 1WA5A 5ELXA 1CP2A 4IDOA 4OK6A 4HUQA 1GL9B 4B3FX 1RRPA 2VHUA 5TDHA 2DYKA 1Q1BA 5B30A 2GZDA 4POAA 1BYIA 4FWTA 1G8GA 1ZNYA 5FL7A 3RSLA 1FZQA 4Q1AA 3UATA 2IYLD 2O8FB 4B48A 3VNUA 4JBYA 4RSGA 1X8LA 1GRRA 4IHQA 4AYWA 1KDTA 1JAHA 1GZSA 4TMWA 4M53A 4D0NA 4LBYA 2R8RA 3B5JA 3CR8A 2BKUA 4LPSA 4M21A 1AQUA 3ICEA 1NN3A 1W4BA 1YZGA 3GLFB 3DM5A 5EJEA 5KNDA 1FQKA 3HR8A 4U7DA 2WHXA 4DLUA 4TSFA 4UJ5A 3PJRA 2ONJA 3BFVA 1IOZA 2J0VA 1ZNZA 1QG4A 1KMHA 1JI0A 4IFEA 1WXQA 1QF9A 1XX6A 5BN3A 3RHFA 1NLYA 3W6OA 1YHNA 3U3RA 3EZ6A 1R6BX 3OIUA 1VTKA 3A1WA 3IPYA 5AUPB 1VCMA 1JB1A 4ZDKA 3EARA 4JBXA 2BMEA 3K0CA 4OI0A 1LW7A 1GRQA 3EA0A 1X3SA 4IEIA 4B76A 5AUNB 4DEYA 4AI6A 3GJ4A 3NVAA 4NYIR 3RRNA 1ZD8A 4EPXA 4Z54A 5C46F 3CRQA 1DPFA 4HSEA 3LA6A 1G9XA 2XXAA 3GLFE 4AWXA 5LD2B 2HT1A 221PA 1YU9A 5LDDC 5AR1A 3TR5A 3KQLA 1RPZA 2CE7A 2GF9A 4DLSA 5J47A 5SZHB 5F9FA 1E9EA 2B21A 1IN7A 3B1VA 4UXIA 2Z0MA 3HJNA 4TT3D 5CM8B 2YOFA 2GBLA 3BERA 3QKSA 3LX8A 5JMTA 2GBLC 3EXAA 3AKYA 4QHYA 5DYGA 1W0JD 2KBFA 1ANKA 1E0JA 1OIXA 4DIDA 3I92A 2GETA 4DLZA 4EFLA 2WKQA 4H1VA 2HJGA 5FPSA 3PUWA 4RKFA 5FR2A 3WP1B 1MH1A 1U8YA 5CDFA 1TU3A 3FPAA 3WBKA 3VR3A 4MGZR 4QRHA 3FMFA 1U8ZA 1E2GA 1OYYA 2C9OA 5FTKA 2VHQA 5GJVC 1W0KD 3ZVMA 1UJ2A 1G291 3FKQA 2AKAB 3KXKA 5HTKA 4ARZB 1N3BA 5DO9A 1KJWA 2JATA 2X2EA 4LPKA 2J46A 2RHDA 1D2NA 4GP6A 1R0XA 5CLQA 3X1ZA 3DPUA 2ZI6A 4S35A 4TMTA 1DG3A 4KFUA 1D6JA 3S1AA 1IN4A 2XX3A 3WYAA 1QHHA 3DOEA 1NVWQ 2XZPA 4LYJA 3WP0A 1E9DA 2Z6VA 3AP2A 3NBFA 3DMNA 4R71A 3PEWA 4OJKA 1P72A 2OV2A 1IY1A 1HURA 4MQBA 3C7KA 4EJSB 1VYUA 2OILA 4FN5A 2IWHA 4RD1A 3HYTA 2CHVA 3SC3A 2C78A 1LF0A 2GCNA 4JBWA 2WWHA 1Z3IX 4QHTA 5LPNA 1FX0B 1A4RA 3C8UA 4ZIRB 1D2EA 4URUR 3VQTA 1WBBA 4JLOA 5EXTA 4AKHA 1YRBA 1XDBA 3DEFA 3PUVA 1K5DA 2ZETA 1TF7A 5FUYA 1PLJA 1G18A 3IDQA 4BRWA 1P73A 2QP3A 2DR3A 1E96A 2XTZA 3ADDA 2Z4SA 2QNRA 4CZ2A 2IEYA 1G3UA 4YMUA 1NVVR 2N46A 3I4LA 4AC9A 4BLQA 2CJWB 2CL6X 3T1QA 4C2TA 3T5DA 4W7SA 3A6PC 2ZE7A 5JWRA 3PVSA 3W5JA 2JCSA 3EA5A 1II8A 1AKEA 1ZC3A 4BLRA 4W9MC 1OF1A 1F2TA 3LD9A 2O8FA 1W47A 4TL9A 3QY0A 2ANCA 2KI5A 1CEEA 2V6JA 5E7MA 1E2NA 1V5WA 1W4CA 2H7VA 1W48A 4TT3A 1NRJB 2A5DA 2D62A 3FOZA 5B57C 1JEEA 2YC4C 3DKPA 1TTTA 3CLVA 4ON9A 3TVTA 3G0HA 1W0JA 4LZZA 3SJBA 2ODWA 1GIAA 3GLFA 4EPWA 1S1MA 3EZFA 4DLTA 4M1SA 2FPKA 1DTSA 1P61B 2BCJQ 4LBZA 4BFYA 1S3SA 1UKEA 3HP1A 1VIAA 4LJ7A 1KK1A 1E9AA 3CIOA 4U00A 5FOTA 3DHWC 3QPUA 3CONA 5L3RA 2XZOA 4IOKA 2LKDA 2G88A 3LNCA 4QM7A 5HZHA 1VCOA 4AKIA 3SYNA 3ONWA 4TMVA 1W0KA 1DAHA 4MA4A 3QG1A 2GK6A 4TTQA 1SZPA 3CF2A 3R9IA 3I5YA 1GWNA 2OBNA 5CIQA 4YMSA 3I3SR 3X1DA 3C16C 4K81B 4Z1MA 2ZR0A 4F7WA 3KTAB 2OCPA 1YZQA 3V4FA 3H84A 5EP3A 3KKOA 1U81A 1XWIA 1W44A 2GVDC 3A1UA 1RRGA 3FWYA 2GEUA 4KLZA 5FI1B 2YC2C 4A8JB 5E7IA 4CEJA 4UNNA 3WMFA 5JI3E 1WF3A 4I1UA 4FXPA 1M7HA 2RGEA 3QJYA 5JRJA 3QF7A 3QG5A 2D3WA 1FW6A 4LJ5A 1UEIA 1M34E 1R8SA 1YRAA 2ZSBA 2J3EA 4PC6A 5KSZA 4B3CA 1RE0A 1S8FA 3DOFA 4C0LA 4W5HA 3W90A 3GEIA 4L9WA 3ZS8A 4B2IA 2C9CA 4NCIA 4AK9A 3KQKA 4TL8A 5DI3B 3FGNA 4DUGD 1QHSA 3VU9B 4G5RA 2BMDA 2ZSEA 3UG6A 2ERYA 2FJUA 4NE2A 3KJIA 2BJWA 1W2HA 5FTLA 4GRAA 1TU4A 2E1RA 4XTRA 1G8PA 2HYIC 2ZI7A 3UMSA 1COWD 4RZ3A 1OFUX 3KUCA 1IY0A 5KO2A 1IN5A 1VPLA 1DVRA 2Q9AA 3HWSA 1W7AA 1TF5A 4KYIB 2EWWA 4JLDA 5FOSA 1JQJC 3BRWD 1ODFA 4QNMA 3TUJC 3ZYCA 2SHKA 4OHZA 5A0FA 3X2SA 5KNBA 1N6LA 1QHNA 2VQSA 4DIEA 3VX3A 2ZRIA 2BOVA 4NYJQ 1BMFD 2JJ8A 5JEDA 1XEFA 4F93B 1AS3A 1J90A 1SVWA 4OJQA 5KPJA 1XD8A 1UDXA 4P4SB 1FMJA 2HV8A 1XMIA 4KXFB 2ZS7A 1F2UB 2NO6A 4TN1A 2OZEA 3M1IA 4QC2A 1XPUA 2WOOA 2JLRA 1RC8A 4AG5A 2OUKA 4GI7A 3SEAA 4KYUA 3MCAA 3U44B 5KDDA 3SQWA 3G82C 2J59A 3T34A 1NVXQ 1Z83A 1U0HC 4P3YA 5IK2D 1S9DA 4RFSB 2QPAA 2ZIAA 3W34A 1U8AA 1X8KA 2ZUDA 4IOMA 4URZR 3KFVA 5GVSA 4RZUA 4I81A 2FZ4A 4JJZA 2O52A 3GJXC 1DAFA 4IDHA 1TQ4A 3TGPA 4WOPA 1OXVA 1R5BA 4BFTA 2EU8A 2GKSA 3O47A 4Q66C 4RD4A 3U3MA 2GAAA 2WJVA 2F55A 4YMVA 4RKEA 1Q3TA 3THXB 3O8BA 4EFNA 2A5JA 2CJWA 3H2YA 4IXNA 4Z8XA 5J4VA 2WPDA 1JJ7A 2WKPA 1AZSC 2J45A 3LBNA 1KI1A 4KLNA 3VTKA 5FOUA 2NO7A 3A1VA 3B7GA 1RYHA 2R9VA 3ZLJA 1IBRA 2QGZA 5K8UA 1G64A 1KKMA 2IYVA 3BC1A 1UEJA 3IGFA 2NTYC 4JKIA 1XNJA 4URYR 4UNQA 1ESMA 4FW9A 4K8OA 3SHFA 2F1JA 4G3XA 1T91A 4DUGA 2WJHA 1E94E 3RC3A 5SZJA 4PHTA 3RS5A 3LY5A 3GEHA 1PV4A 2HXYA 3TR0A 3MWKA 1Z0IA 4LV8B 2DWPA 1YZKA 3SE0A 3ZDQA 5AUQA 3GJ0A 4X8HA 1QVRA 5J5CA 1COWA 3LXRA 1NIJA 4CGZA 1GL6A 1N0UA 3IQXA 4DDTA 4CEHB 2K5UA 5C4MA 2VP0A 3Q9LA 2A5YB 2FV8A 4RD3A 5JBQA 1E2HA 4DCSA 1MO5A 2FFBA 2G0TA 3ICQB 1KI6A 2NZJA 2AKYA 3CX8A 2ZTSA 2WJIA 3L0SA 3MMPA 1BMFA 1CXZA 1JPJA 1KO5A 4NTZA 4HZUB 2GA8A 4PPQA 1S0UA 1ZM4A 3AKCA 1L8QA 3TUZC 3NDPA 4WXRA 1NKSA 4BLOA 2GJ9A 5EP2A 2FF7A 2WKRA 2JLWA 3E1SA 421PA 1ZC4A 3IBGA 1OXUA 4ERNA 1OH5A 1Y63A 5JSZA 1EX7A 4JVSB 1IM2A 2N1BA 3D7MA 1JR6A 2JLZA 2VSXA 4Q5IA 4LI0A 3FDIA 2DY1A 3R9XA 1Q3HA 4LGMA 2BBWA 2W2XA 2X19A 4TLAA 3KFXA 121PA 1N6HA 4Q9JA 1DAEA 1JR3E 2BIFA 4HZIA 2GHIA 4TYNA 3EWAA 2QG6A 5IK2A 2O8BA 3RSOA 2HUPA 5CK4A 4AKEA 2CVHA 3K9NA 5FUXA 3B9PA 4KFRA 2HDNB 2ORVA 4JT4A 2A7QA 1ONBA 1R0WA 2MMGA 1LV7A 3C4JA 2PEYA 3Q7QA 4CT4B 2FEMA 1EX6A 4P32A 2B7CA 2IEZA 4HLCA 3VFDA 1UBEA 1DAIA 3LXXA 2XNSA 2B8WA 1JR3D 1WE2A 2GZHA 4MRRA 3GFOA 2CHGA 2ZRAA 2C9YA 5DHFA 1KK3A 3IIMA 5KSYA 4H1UA 4C3ZA 1DO0A 1OJLA 4ITRC 4LC0A 3GJ3A 1MRNA 4DEXA 5JS8A 1P62B 2JAQA 2FU5C 2UVQA 2RCNA 3M4YA 4CDGA 1DAGA 2IC5A 2G0NA 4ZKDA 4LC1A 3SN6A 5AWFC 4PZLA 3AVPA 1J2JA 2F3RA 1ZAKA 4RVCA 2GCPA 4TYWA 1Q1QA 3KQUA 2A3RA 3AF1A 3LBHA 3NEYA 3B82A 2R62A 3KJEA 4EDHA 1EFHA 4DXAA 5KYKA 2DFLA 3IHWA 1S9HA 1D9XA 1JQLB 3QXCA 2QN6A 4YC7A 2NO1A 2NPIA 4P4SA 3U61B 4FMCB 1FUUA 3UG7A 3CNLA 5AUOB 1EWQA 4AURA 1Z28A 5G3ZA 2JLVA 1F2UA 4LX0A 3TAUA 1XB2A 2DFTA 1U0LA 3E70C 2ZQ5A 3U2QA 1Z0DA 4TYPA 4DVGA 5JFGA 1VECA 1E0SA 2VYFA 3FKSD 3SOPA 2PMDA 5EZ6B 4MRNA 4CVNA 3VR6A 1KNXA 4Q4HA 5TARA 2FDCA 4C2UA 2JLQA 1IJEA 1KSHA 1GVNB 3GEEA 1MV5A 3CPEA 2F7SA 4M9QA 3GLGB 4NCHA 2VHJA 3B8HA 1NVUQ 1UDWA 2IWRA 1AS2A 1OFTA 2XTNA 3BXZA 1N6IA 4JLKA 1G5PA 1O87A 1R2QA 2CNWD 1OKKD 4TLBA 4LDJA 1U94A 1OHHD 3BJIC 4TLCA 3GLIB 4DC9A 4E07A 2O8CB 2ZUCA 2ZAOA 4V0LA 1YR7A 2JGNA 3T1OA 2YZ2A 2ZRLA 3QSYA 2GXSA 3QBVA 4F38A 1PLLA 4M1WA 3BH6A 3CRW1 4MGYR 1G41A 1XBTA 4M4SA 1J70A 1GFIA 2JA1A 1Z2AA 3AF0A 3P27A 3UKDA 5HPYB 1ZMXA 2ZVPX 1XTIA 3EAQA 4US2R 2O8EB 1JR3A 4TQUS 1WBDA 2CLDX 1RZ3A 1XTJA 3MJRA 4OI2A 2Y8EA 1UBFA 4TSFD 1AGRA 5GADl 4GOJA 3ZH9B 1E2IA 4JL5A 3JVVA 5DN6D 2XSZD 3ZVNA 4BECA 1GKUB 3QIAA 2P5TB 1ZD9A 5L3SA 3VR1A 2AXPA 4JSTA 4CEHA 2GVZC 1DEKA 3GLGE 4G01B 3PUXA 1ZIPA 2FPLA 4JS0A 3RYTC 3AUYA 1U99A 2OESA 3OF5A 4IVRA 2Q9CA 2CHQA 3UXMA 5FPHA 2B7BA 3VHXA 2UZ3A 4TQ9A 4D0GA 5B64A 2L0XA 5AJWA 1KDRA 5B2ZA 4AY2A 4DT1B 1H8ED 1TF2A 2BM0A 2OAP1 4KODA 2QENA 5TB5A 2P3SA 3P4YA 1D2MA 1X8JA 2WIAA 2XJ9A 2YWEA 4IRUB 4PHGA 2VSOA 2R6DA 2C77A 2ZREA 3QBTA 3I8SA 3K53A 1FP6A 2ATXA 3BFKA 4YMTA 5D3QA 2PH1A 3VR5A 2Q3FA 2FSIA 2OG2A 4LJ6A 2IL1A 2ZYVX 3FKSA 2F6RA 4URVR 1M6NA 3OESA 3VR4A 1L7VC 2EVWX 2V1UA 4LY6A 2VP5A 3BFXA 4L5BA 1N6PA 4TLDA 3I62A 3B78A 3PG5A 4PSKA 5CDFE 3BAFA 1BS1A 2WWGA 3ND9A 5P21A 2OFWA 4Q00A 4F4IA 1TUIA 3QXJA 4NYMQ 4C0SA 3RS3A 3BIFA 5E95A 1BOFA 1XTRA 2RH5A 4A2QA 4A0GA 1SXJE 2QRZA 1NLFA 2LWIA 4UQOA 4D26A 1DAMA 4Q7JB 5J4YA 2D7CA 2CNWA 3U3KA 1FNMA 1E99A 1OKKA 3CNNA 3D6TB 5DISB 5SZKB 3W6PA 2E87A 4G5GA 1OHHA 1X86B 4LBVA 3CWZA 4KHZA 3A36A 3LLUA 1JBKA 3O8CA 4NONA 1W5TA 1Z22A 4WZBE 4DB2A 2PX0A 3THWB 1HT1E 4EPYA 2X2FA 1SXJD 3A4LA 2ZJ8A 1CF4A 2QMUA 4IW3B 5H68A 3ZD7A 1CJTC 1FTNA 1TPZA 2PT7A 1SVMA 3E5HA 4KBFA 2EQBA 5GJCA 2O5VA 1Z6YA 3LBIA 2FPMA 3A4NA 3B60A 3L43A 3B85A 4XD7D 3TNFA 4EQ6B 5JWHA 2IYSA 3CW2A 4NCJA 8OHMA 1Z63A 1DS6A 4GDFA 5LB4A 4P4TA 3DO6A 2DHRA 1MO4A 5DN6A 2XSZA 2YJTD 3LQRA 3B1ZA 4MYTA 4ESVA 3WHKA 4F4CA 1MABB 1Z6XA 4Q48A 2KWIA 1G16A 2AWNA 2VEDA 4GOKA 1G7TA 4FCVA 4E03A 2EYQA 1G7CA 1CR1A 2QM8A 5BN5A 4XOIA 2RGCA 1DG1G 2O8DA 2GEDA 2R2AA 3ND8A 2WWFA 4WBSA 4A92A 3THYA 2QPOA 1H8EA 5BW8A 3QE0A 4D6PA 3R8CA 4Q4AB 2FGJA 2GXUA 3KKQA 3W8RA 3K0CC 4DDUA 2RKOA 1GNRA 3I1FA 1T5IA 3QKRB 3GLGA 2QE7D 1OFHA 1AN0A 3UMFA 3CWQA 4PHHA 4MRPA 2XGJA 1LVGA 2FOLA 4CIDA 1EFTA 2IXFA 2QT1A 1N5LA 4FWIB 1KZGB 3H1TA 1E2MA 4IJMA 2GJ8A 4D4MA 2GNOA 2QMHA 5CM9C 1CR0A 1NJFA 2HF8A 3QXXA 1NF3A 2DFNA 2VO1A 2W0SA 3PQCA 4LJ9A 5JZVA 2O8CA 3K0FB 5EE1A 1E9SA 3PUYA 4DSOA 3CRMA 2QY9A 2BBOA 5JJLA 3JZMA 5EXXA 2WJYA 4MKFA 1VMAA 4R7ZA 3ZIAD 4M8NE 5JI2E 1XPOA 4B74A 3WRXC 1KI2A 2V7QD 3F5FA 2C03A 2ODNA 1N6KA 1DELA 2IUUA 4AG6A 3WBJA 2RMKA 2YWGA 1ZUHA 2CEAA 4HB0A 5GVRA 3NG1A 2BCGY 3NWJA 4D82A 1GM5A 5CB6A 3K9HA 1W1WA 2GRJA 4PQFA 2RAPA 5FTMA 4IVQA 3WYGA 3ASYA 3B6EA 1FL9A 3I32A 4FINA 4X8LA 4PHFA 1D8TA 4BZQA 4MDEA 1ZUIA 1SXJA 2MSDB 3CRRA 3NBXX 1NIPA 1SXJC 3OZXA 3TUIC 1FNNA 2AD5A 4C9BA 1DO2A 1CKEA 4A2PA 2F3TA 5FUVA 1ZUNB 3BS4A
chains in the Genus database with same CATH superfamily
4PEVA 5KYUB 4DJTA 3AR7A 3WAKA 3LDUA 4Z1MD 4UHBA 1XPJA 1Q20A 3CURA 3IILA 3ROGA 5EP1A 5IMBA 4BMSA 3BMOB 1YQQA 4EG7A 5IUKC 1B6RA 1G6Q1 2WTBA 3ROQA 3HKBB 3GLHB 4U6NA 5EJ2A 2RG7A 3A3PA 2I9KA 2V3CC 5I7AA 1EVKA 3UEOA 3EH1A 5EMMA 1T10A 2ESRA 3DLAA 2FGKA 2HR1A 1DBQA 1M2VB 4EGFA 5JC1A 2B98A 2DQSA 2BC9A 2Y9PB 2E18A 3D3WB 4ZGBA 2JJ1D 5IZCA 1MX5A 3KZOA 4BCDA 4P0QB 1M8PA 2B25A 4M46A 4XM0A 1M8FA 1T9BA 5CDTA 4BPRA 5CDGA 2QE7A 3HB0A 1O9BA 2V54A 1L5RA 2XMRA 3IAUA 4HXFB 4K5QA 4N9QA 1U2DA 4UVHA 2J67A 3SQNA 1XAHA 3VZRA 3AFHA 3K9GA 5BYKA 5HRAA 1P7CA 1ORDA 2QTVB 3OFNA 1U1CA 4K86A 1P3JA 4L8FA 3PPWA 1CF2O 1Z6TA 3ADOA 2WT9A 3IAFA 3OPNA 3UWDA 4DJFC 5JXIA 1GDDA 1PYOA 1THMA 4IMIB 2VT6A 1HT2E 3EFEA 1EVEA 4K6HA 2OP0A 3ANXA 3BFJA 4Z2YA 5CFQA 2ZYUX 3QFCA 4TVBA 5B37A 2ZJAA 3ACBA 2VUSA 3U7JA 4IOJA 1EWKA 4RIHA 1V47A 1U9IA 4BO7A 1YV9A 4D2IA 3O2QB 1DKPA 4U5XA 5JNWA 5EIXA 1RXVA 3LPNA 1V7PC 3MS7A 4GOLD 4MEAA 3N2EA 3THWA 4FDLA 4C4OA 4Y2RA 2XGSA 3BJEA 5CFOA 3JD0A 1G2QA 3JYOA 4QT4A 3ZDCA 2YNMA 2AW5A 3AY6A 3OJXA 1J5XA 4PBSA 4UMVA 5DLQC 4D4GA 4W5NA 3SXUB 1N2BA 2DTEA 3P97A 5C7IO 4QDJA 1OBHA 1Z35A 3JYHA 4MHTA 3JRWA 8LDHA 1TJ5A 5KTYA 1G42A 5I9IA 4II2A 3OPXA 3HSYA 2DBYA 2Q21A 2ACVA 4BNYA 2ZVQX 4KGDA 3DDZX 2RJ3A 1RJFA 2ISCA 3K6SB 3SR4A 4BNKA 3AY7A 5IJ0A 1AXGA 1L3BA 1IM5A 2P79A 3PC7A 3U4GA 1HDEA 5DT9A 4PYLA 3T38A 1YONA 4F6RB 5EZSA 10MHA 1RR6A 4NCKA 5EJ6A 4HLQB 4RQUA 2QMZA 4MVJH 1WSAA 1T3HA 2R8XA 5ITWA 4HDCA 4FE4A 1RRVA 1HE2A 1IK4A 5BT9A 3ZG6A 1G5TA 2R65A 3S2ZA 4B6OA 3T3DA 2O2HA 4BNMA 2F1RA 2F8TA 1QONA 3JVUA 3C3XA 2W11A 2YY5A 2XB9A 3C98A 3EXIB 1CJKC 3HWWA 3BZBA 1S5PA 4Q03A 4AIIA 4HDNB 3E5MA 4EZBA 3PFKA 4TKVB 1V8DA 2ZR8A 3IPAA 3KOXA 4FOTA 4P2GA 5ECDA 1L1EA 2Z5GA 3G49A 1SK9A 2V58A 5J2UB 2POQX 1NKTA 1PUXA 2RHMA 1IJKA 1O6ZA 1SXHA 2EZUA 4UEKA 1Q5PA 2QX7A 3TPZA 2R8PA 5AP9A 3CSSA 4EKEA 5CXXA 3ZD8A 4QU0A 3DFFA 2ZJ1A 2O5EA 3COZA 4DJEC 3LL7A 4QGFA 5FBRB 2JNWA 4XGQA 1KOGA 2PSHA 5ADHA 3FYSA 1EDZA 4Z0HO 5IC5A 4W8HA 4DIUA 1P0FA 1GLNA 1JVSA 1FUEA 2CJYA 5E2AA 3LY8A 3UY4A 3OLWA 2QL6A 3WWDA 3ZBUA 2OCIA 3TW6A 4HNTA 3G5UA 4W5JA 4WXPA 1PL7A 3PU6A 1ZEJA 3KCQA 2JJ1A 4OAOA 3RRMA 3RVBA 5JXWA 4GKJB 2I54A 3MTEA 5DHQA 5HOEA 4KV9A 4EVIA 3EASA 3PQ3A 3K1JA 1RAAA 3OQMA 1DXOA 4D3YA 3OEYA 3KR2A 1WVIA 1OA0A 4J03A 4N39A 4IO0A 2JGDA 3E2IA 5F23A 3KZCA 3UVEA 1JIXA 4D0SA 3ELBA 2X0FA 1XZFA 3FTDA 4DOMA 1E2EA 1U3TA 3H04A 5CFMA 4JR0A 1JAYA 5KJFA 2IF2A 2GYVA 2BTOA 1CP3A 1UFRA 3IO5A 3MELA 4NZNA 3TNJA 2FSVC 1QE3A 4BVGA 3R5FA 4WNYA 1SKUA 2XF2A 3AR4A 3OAAD 5J4HA 3VPFA 4DSUA 3BEOA 3DXXA 3IO3A 1U1FA 1CTQA 3MJFA 1V4BA 2Y27A 3F4LA 3FX2A 4N4AA 1ZRMA 2LW7A 4BNTA 1CQJA 3Q8MA 3RANA 5EHXA 1L8AA 5DDIP 4RNDB 5CUQA 2FW9A 3L40A 4X20B 2ZXUA 3B3GA 2P62A 2QNBA 2M2IA 1M72A 4J2TA 1EFUA 5AVWA 5BMVA 5K0SA 1KERA 4FFMA 4MINA 2PGNA 1NYTA 1HGXA 3MWGA 5JIBA 1YD7A 3DQPA 1IEVA 2C4WA 2MSNA 3IOYA 2VF5X 5K3FA 3X1WA 1P44A 4M7PA 3T5GA 3ZXYA 4G09A 5HBGA 3GXOA 3T99A 3NAZA 3CGGA 4BV3A 4UOZA 2X5XA 4YJDA 5L3VA 1CETA 3JWPA 4Y0AA 5C8ZA 5LIRA 1YB4A 3PHGA 3CPSA 3RUEA 4EJSA 3PUZA 2AL7A 4YWHA 2I87A 1ABEA 2QHXA 3NATA 1U7DA 4H7FA 1N5KA 4L9RA 4XUGB 4YHBA 4CEIB 2XYHA 1N8KA 2PL9A 4MQFB 6GPBA 1T8YA 1Z0ZA 1I9CA 1V1MB 1PJAA 1YDEA 3GFQA 3HCDA 4M1TA 4P98A 4Q39A 1UFOA 3EN0A 4LYAA 4U7GA 3EGWA 4YCBA 1AQIA 3ZD9A 4TZ0A 1SBNE 3SYTA 1DLJA 1E6EA 4I14A 4DL9A 4JDUA 4EHNA 3LOUA 1UWVA 1Z13A 5BOVA 4WUTA 3ICPA 5AK0A 4EENA 2BYTA 3G2LA 1NMYA 3I1IA 4GZMA 1IUOA 1WOYA 5DWVA 3HK2A 1CRQA 1KMIY 2IX9A 1AA9A 2VJAA 3DZIA 4HNAA 2R1ZA 1PG5A 2CGEA 2HMSA 1C9MA 1ZYUA 2XGOA 3EPKA 3A6JA 2QTVA 2WJPA 3P45A 1U7XA 1Y82A 4R51A 1P75A 1TDJA 5TV2A 1G8AA 2ZRMA 4TLEA 1XVUA 4G9BA 1A8QA 4PXAA 4NPAA 5IHPA 2C97A 1Y8QA 3R5KA 3VPSA 1NAIA 1OLUB 2I1QA 1A0OA 1XVAA 2BELA 4Y9RA 4ZOBA 1ZEMA 2F43B 3PXGA 5IVHA 2FMXA 2KHZA 2WV9A 4M9CA 5CFNA 1N6RA 2RGNA 4YV1A 1SU4A 5DBEX 3QUAA 4X6LA 1QIIA 3CBGA 2IYQA 4S1NA 2BGUA 2IHJA 3QA3E 3HWRA 4R1NA 1OH7A 4TMTA 1QHEA 4BEJA 4C3OB 2HEIA 5F1YA 4BTEA 3C85A 4BOYA 2R1UA 3EIHA 5IM5A 3SXUA 2IKQA 3EC2A 3OECA 3BGOS 2YJ3A 3DG9A 2FR8A 3V7UA 1W5EA 1Q1AA 2WD8A 4RY0A 2V8BA 1YA4A 3PEEA 4GLOA 2MU1A 1B8PA 1VIMA 1NZJA 4GLFA 4EX6A 1ZM2A 5TE9A 2A6PA 3W7VA 4RGVA 5BOSB 3R3SA 3UMJA 3K6SA 2NVUA 3G0GA 2EKZA 1RQNA 1X1TA 3OAAA 2QSYA 3I61A 2Y77A 4REMA 3T06B 5FLYA 2WHPB 2VOEA 2EF1A 4MR8B 5JVDA 1V39A 3WWOA 3V8PA 2Y3IA 4AVYA 3KOOA 1BXZA 4GWLA 2PWPA 3A6KA 4RD6A 5EAIA 2YDYA 3QNWA 1TM4E 4QQ8A 4U7JA 5JD4A 4CODB 1W0CA 2RJOA 1ZOPA 4OHWA 3TQSA 1IPHA 2HLNA 2NG1A 3VHQA 4JGGA 3BIWA 3RYHA 1Q7RA 2ZBRA 1LWOA 2C4NA 3ETEA 3JALA 3O74A 4YTEA 4A6DA 2OSBA 2LKCA 3PK0A 4G0ZA 1ML4A 3G2OA 1K7YA 4JCCA 3DTVB 4LHYA 3QVJA 4TKVA 1Y3CE 5EQTA 1NXQA 1M33A 3I9NA 5J2UA 1J8VA 3IAS6 2DWUA 4A8JA 1ONPA 1UXKA 2BR3A 4H7EA 1E66A 3UJPA 2BM1A 1NM5C 3IMCA 3R4VA 4TZKA 4Y67A 3JQ6A 1PLKA 5DNVA 4BKUA 1XZDA 1UQTA 3PDWA 4V0OA 3W5DA 5JHGB 1IN8A 1LUAA 1L4FA 3R6DA 3RTAA 1JIJA 5FPKA 4D44A 1G5RA 5E7QA 4DQ0A 2D0IA 2FPPB 3TTSA 2AN9A 5C51B 1CYEA 4U2BA 4DLNA 1CQXA 4NOLA 5I8WA 4NU8X 3ICWA 5D84A 4DTCA 4OQ4A 2JB9A 2X23A 5INTA 2P2CA 2Y0PA 3GLFA 3TOZA 2Q2OA 1T4GA 2RB4A 2ATEA 4Q1CA 4UNSA 5EIBC 1BEZA 1YIOA 5FYQA 5AW3A 3D81A 2RK4A 4RMNA 3QFHA 3QBDA 1VHWA 2HIMA 3TIVA 1WMBA 2B6HA 1K8XB 5LQCA 3KYBA 1RKQA 3LUBA 2X86A 3K8OE 4WK4B 1N8SA 2IXGA 1QFSA 2CEKA 3UJCA 3GCGA 5SY4A 2A0YA 2KYRA 4Y3UA 3CZ4A 3PDJA 3ZNPA 4DJDC 2AQHA 4EYQA 2D5IA 4AS1A 3KQPA 1NXWA 3ELDA 4HG2A 2ZRNA 1PZNA 3GFPA 3FETA 3KTFA 4W1QA 1W5BA 2X13A 3DE5X 4MV6A 5DHRA 3STHA 3A1SA 3ADCA 3L7CA 5HYVA 5GIOE 5H9VA 5T4FA 2OD7A 4AN0A 3PR1A 3PEFA 4Q7MB 2ZI5A 4UNPA 4I1YA 2GGSA 4FBGA 1RM3A 4X20A 2VNAA 4XRRA 3VTAA 3GP8A 4ZOAA 1N5MA 1OIVA 4JLPA 3KR1A 1GNPA 2O0JA 2QUHA 2QXYA 3DULA 4YR9A 4B2LA 1CT9A 1OT3A 1D6SA 3JQ9C 1I7DA 3IV6A 3IVCA 1ATZA 4CPDA 4M0FA 5CYOA 4YJFB 3O0TA 3A37A 3FWNA 1NMXA 2PUHA 3T7JA 4I9UA 1R5OA 3DEAA 1NJ1A 1Z08A 3NWOA 5LZ7A 3U80A 4KX3A 2MYTA 4E12A 4HB2A 4C7JA 2VJNA 3N6RA 4I8XA 1T9DA 1ISIA 4P83A 2H48A 2Q6IA 5EJGA 1P2UA 4OHRA 5H3HA 1WNTA 2A0WA 4BFVA 4F4HA 1ZHOA 4CEIA 4DNOA 1P2FA 2WI8A 3CLUC 2ZZKA 4KXMA 5FYDA 4GSKA 3R7LA 1UJ4A 5LJIA 4YCNA 4QG7A 4FD2A 3B1JA 1V1MA 2FI1A 4EYSA 2ZE8A 2R5NA 1Y3FE 2Z83A 5E8RA 5EC8A 4N47A 1SKBA 1Y9AA 1YUBA 3UT6A 2QP4A 3TIFA 1B73A 3WB9A 5JCPA 1XNHA 5KREA 2P9CA 3D3JA 3K8YA 5M3BA 1IIRA 1YZTA 3LHDA 4MARA 1VI5A 4N82A 5TS3A 5DT2A 5K4GA 3K8ZA 1YS7A 3ID6C 4OTZA 5IEJA 1FRVA 4RE6A 4UAGA 4JHLA 4PWYA 5BN3B 5EIWA 4OXQA 1D2CA 2JGLA 3CU5A 1V11B 3THXA 1KR5A 1NPTO 3LXUX 1JQ3A 1TUBB 3F74A 4DR7B 5EMHA 2GJKA 4IQ0A 1QIJA 1XEXB 2W2TA 2PMEA 3TZCA 4BWYA 1UT5A 3MD0A 2W2NA 1OV6A 1U0JA 2RBGA 4B6SA 1MVLA 1BE0A 1YBMA 2QPTA 1WVMA 3KYDB 5JLAA 4AAYA 2WVGA 4DBLC 3U4QB 3U5ZB 3SXJA 4CMEA 1Q17A 1S02A 3GRKA 3OOHA 4JXKA 5GY7A 3PNVA 2I0FA 3BB3A 2QQGA 3H2ZA 4QJ4A 1DWOA 3AY3A 4MWTA 2W6ID 2DOKA 3EVGA 1J0CA 2WEKA 2YZKA 3QI7A 4QTZA 1WWKA 3E3MA 2I76A 3P52A 2WSMA 1Z5ZA 1NJ8A 2XUFA 1XOIA 5H59A 3L5KA 4KO4S 5K8VA 1ISGA 3BBPA 4LQCA 4DQLA 2WSSD 5EN4A 3RS9A 3X2FA 5JBNA 3RASA 4LRWA 1T34A 2IXAA 2E48A 1H8HD 3DKRA 5KKCA 1DTWB 3ECAA 3HR7A 4BX9A 1KY3A 1SKMA 1S8OA 4UFOA 1R6UA 1X1QA 3ZV5A 4J0IA 1Y3BE 3OCCA 4BGVA 3ZQ4A 3ZE0B 2XUPA 4HH1A 3E9CA 4XM1A 5ESWA 5LYJB 3IUQA 2ID7A 4WAUA 2O0LA 1T1JA 2EFDB 2HXGA 3J81k 4B82A 1QJCA 4W5QA 4TTIA 3LVQE 3RRZA 1OSNA 3WJ2A 3NDJA 5KQSA 3WNDA 3V4ZA 3WS7A 3ZNOA 4PRZA 3EVTA 5CD1A 2DP4E 2O5RA 5L4SA 1Y7PA 2EKPA 2VSFA 2ZE5A 1WX1A 2D1RA 3LIPA 3WNVA 3R20A 2ZR9A 4BE4A 1M6EX 2H2IA 2JFUA 3CVUA 1MZPA 4P84A 3DTVA 3IRVA 1LS6A 1V5GA 5EWMB 4E2YA 2A9RA 4PRYA 1CUIA 1UEXC 3I04A 3R74A 3I72A 4BC1A 1ZXLA 1U2RA 2XQFA 1MRSA 4DLYA 1I1OA 4L50A 2BGGA 4HAZA 2Z2IA 5LP6C 6REQA 3VJKA 2K87A 1Q74A 2AJBA 2XD9A 3G1WA 4RD0A 4ETWA 4BATA 4TMYA 2B99A 1KPGA 4R8VA 4UM8B 2EJCA 4BVJA 1P45A 1OBOA 4G1MB 2HQBA 2QN1A 3L1UA 4U6QA 5F7XA 4KG7A 4YB8A 2XQIA 2PHZA 3NIBA 5D51S 3NHBA 3TSYA 5ARCA 3EODA 4EYOA 4KE6A 1E4YA 1EE9A 4BRUA 3FF1A 1I4OA 3ENQA 3IDFA 3SC2B 1URPA 4WV3A 2QR5A 4ND6A 1NPYA 3GPDG 3PNMA 1EFDN 1V8ZA 3NALA 1XTUA 1E2PA 2HWUA 1PNQA 2C31A 3BREA 4QJBA 3HPQA 4OHXA 5GJWC 1ULZA 4FHGA 3LWZA 3ORFA 3U81A 4J29A 3ANNA 5HUHA 5JY1A 5JTTA 1H4VB 3CZ5A 4AY5A 2J5BA 2YN4A 5TMDA 1AUXA 1DKLA 1S4MA 3EEBA 4QXMA 2O2JA 4PV7A 1ZBDA 2HB6A 4U02A 4LOIA 5KSPA 4ZFNA 3NW9A 3SKXA 3TLKA 1M7BA 5DGXA 5C37A 1CG6A 3CX6A 3G9XA 1VKHA 2A3NA 2W6IA 5A3QA 3ESZA 3P19A 1EVQA 1Z18A 3W5BA 1MKYA 1XZGA 1ZGZA 5J1TB 2GK3A 1V2HE 2O7RA 1VG9B 1SVKA 3QKUA 1TU0A 5TMEA 4BKMA 4C7BA 1JECA 2D2EA 2ZUBA 1B8OA 3C7DB 3DL0A 3SZLA 3HSSA 1B74A 2W4QA 3SC6A 3MFQA 2Y0DA 3SHQA 3A14A 2WSSA 4UMDA 5BQXA 2Q3LA 3GZNB 2HF9A 4FQ5A 4KSCA 4YJFA 5LQKA 4JXJA 3RVMA 1RSZA 1H8HA 3OQ1A 5ITZA 1YCFA 4X3PA 1NG9A 3PVCA 1GN8A 2WWIA 4JJ6A 3F0TA 5K01A 4DMLA 3UPTA 4IH1A 2PZ8A 1E1RA 4FJ0A 4UHJA 3TZLA 3HDJA 3V1KA 7GPBA 4CKWA 4FFRA 2PY6A 1Y4SA 1ZGGA 2C29D 5AHRA 4C2AA 3A04A 4DA8A 1ULTA 4QGGA 5SICE 4DA4A 4N3BA 3UAXA 1G98A 2JJ2D 1YDFA 1SVSA 2G40A 1OZGA 1WCXA 1XNRB 1PNVA 3GG2A 4MRSA 5DGCA 1R4AA 3GAZA 1WXFA 2APJA 2YICA 4KITB 4LJ4A 1RBQA 1TAGA 4M9UA 2AC2A 2ZRGA 1BKDR 3PE3A 4QBTA 3VH1A 1USGA 5AJXA 4ZI3A 4AQDA 2OBMA 2W9XA 3O73A 1NX6A 1V11A 4TZ6A 3RUHA 1ORWA 2NV0A 2WKSA 4QO7A 1TK9A 1GPWB 2H4JA 2IVZA 1N2GA 2NZXA 2QRHA 3EXHA 4N6GA 4YJ3A 4XDYA 3V4VB 1F8XA 2D00A 1XEXA 2Q1SA 3NYRA 1EB9A 1N4AA 1OE0A 1WXEA 3AWIA 2IH2A 3AI2A 2JPDA 3EIQA 4K6CA 4C0AC 2AGVA 3LA8A 2G1KA 2R68A 4QICA 4UD2A 1E4OA 5D5HA 3KYDA 5DYYA 3ZE1B 4DNPA 2P4HX 2OPHA 2M9MA 3U4QA 2AD1A 2W8BA 3UT0A 3AJAA 5KEIA 3NGLA 3ZV7A 4UTPA 3WYFA 4BX2A 2IU4A 3DEJA 2BDUA 1SOUA 1B7GO 1N2ZA 2HRCA 4WOBA 3V9PA 4UW9A 5LMZA 4O4IA 1EA7A 4ROSA 4OSOA 3FWHA 2P0AA 2MSEB 4CM4B 3WRYC 4BZXA 2I66A 3JZAA 5JO0A 4X7PA 4GC9A 2H7XA 4YASA 3N70A 2FE1A 1QYXA 5HQ3A 1J8MF 3R6LA 3BVPA 1ZN2A 3H0KA 2FZKA 3NYQA 4KJXA 5BWMA 3OIWA 4U63A 4XSGA 3JYNA 3ZTWA 1DQNA 4TMFA 2P2LA 3MTIA 3ZE8A 1KYVA 2HNAA 2ODEA 2EW1A 1DTWA 2PRJA 2WD9A 4GXNA 1GCOA 3O2NA 4FYPA 4K9QA 7AT1A 3NRCA 2FUG1 2YWJA 3EJWA 2WYHA 4R98A 3ZBQA 5T41A 1CY2A 2ZBFA 3LH5A 4O0LA 3A9WA 1I7QB 1CRLA 2QA5A 1YJ5A 1J49A 3AR8A 5LYJA 3K9WA 1R8YA 1GG5A 4GOXA 5E6UB 2Z6QA 4MP8A 2XQKA 3E9RA 4KDEA 3VR0A 4DT1A 2G07A 2R6CA 2F1OA 4E15A 3KCNA 4EPVA 2C4VA 3P94A 3ZWBA 3A6EA 2VP2A 1C1HA 3E3AA 4P4LA 3JYPA 3W2GA 1O4VA 1KAQA 3VMMA 4LE1A 2R1TA 4Z4HA 1IZ9A 1NSYA 2NT3A 4PY2A 1G8SA 2BJVA 3EDCA 5GP1A 1P2DA 3BOSA 4HFJA 4ZODA 5EWMA 3VX4A 2BFWA 1EFRD 4FYKA 3UV7A 2C4KA 1YQDA 2HPVA 3GGJA 3QXHA 4B4OA 1W8DA 2DQZA 2VDLB 3Q3JB 1PR6A 4G0NA 4ZALA 4QBHA 4NBLA 4Y2SA 2ZYRA 5ILGA 2AZDA 4ER3A 2WP0A 3DE4X 3AHEA 3L0OA 1BCRB 4ARVA 2H5EA 1IDN1 3D59A 3GNTA 2OOSA 4FNMA 4I50B 1APBA 3KAKA 1CW2B 3H86A 3OU7A 2OMEA 4CIXA 2JJ2A 2PUBA 3WGIA 3N6VA 1JZTA 3NJ8A 2QLFA 3WL6A 1HYQA 4IEEA 2ZIZA 4Z9AA 1QORA 3OQIB 1GKIA 1NBMD 2H2WA 3BX1A 1VMEA 3ENWA 3O9ZA 2OXEA 3HPRA 3I05A 4G4GA 4MYSA 4UXHA 3HYLA 1PTKA 1U3CA 4RWEA 4LF7B 1EP9A 4O1MA 2R1VA 1EMDA 4J9VA 4O4LB 3LLMA 1EZ4A 4OFWA 1O08A 1SUEA 3UPDA 2ICAA 1E8NA 5HFAA 1O5OA 4TZTA 1OQAA 2IW3A 4MULA 2JHPA 3GFRA 2OLJA 1WKVA 3JARB 4KXWA 3OOEA 3PHBE 1F8UA 4TVOA 5IDQA 1IVYA 4ID9A 4G97A 4OB6A 4BX8A 5C1OA 3CZAA 2WF7A 3GQBA 3HC7A 4RDHA 3ZI4A 1UT8A 4DANA 1H6CA 1PZEA 2V8OA 4JT2A 4P7BA 4E5UA 1MCZA 1DZ3A 2IZ1A 2VJKA 4R1LA 4RIIA 4CLOA 2H3EA 1JG4A 2C83A 3D7LA 2XLBA 3MZ0A 5DX8A 1ACMA 4EW6A 3NT5A 3UJ3X 1D9ZA 5TGZA 4LISA 1Z29A 4CR6A 5LWQA 1OVGA 3TDMA 2AG6A 2QMEA 4EGJA 3BDAA 1OAOA 3B6JA 1UOEA 2V6GA 2YMMA 3ESRA 1FXSA 5A9RA 1CZUA 1KF0A 1NFQA 2UUPA 3NHJA 4HWKA 5FLXA 1NC1A 3REQA 3HY3A 4NYMR 1GYQA 1QG6A 5AJVB 1ECLA 4AN1A 5DLYA 3MVEA 4DWVA 4OXYA 2ILVA 3FOAA 4YRDA 3DDOA 3M6MD 4U3JB 4EVQA 1P4SA 3FBGA 3I58A 4MH0R 3OTGA 1XZPA 3PCXA 3BTOA 3M3DA 3BQ9A 2FRDC 2FFAA 3WSVA 3HDTA 4DKXA 2HPZA 3VTFA 4TSRA 3BD9A 4B6RA 4C6HA 3NCHA 2QN2A 4TRJA 2PLRA 4X54A 1W8IA 3ABQB 3BTUA 2W6JD 1L5WA 4BWFB 3U6BA 4FR0A 2RAVA 4Q9IA 1P2TA 2JGRA 1G66A 3BMQA 3HUTA 4F86A 1RXYA 2JD2A 3PUJA 4QBIA 1SUIA 2AMVA 1JV2B 2O05A 1HQCA 3C6BA 2C5GA 1XMQB 5CTAA 2ZRFA 9MHTA 2IHVA 1RM4A 5K05A 4X1OA 3PUIA 1T25A 2FDRA 4CTJA 5DSXA 2ZCUA 4L27A 3PWKA 1EFRA 1R37A 2X77A 3IERA 4Z9FA 3WR5A 6LDHA 5C8YA 1BJTA 4HYQA 1OFIA 1V71A 1GQRA 4HN4B 5F78A 4CR8A 4JYAB 3LCCA 3LCMA 1K88A 1EAYA 1N7IA 2CF6A 3K0FA 4X9XA 1O6CA 2VA8A 2Z56A 4EX7A 1SMKA 4O25A 2JGJA 1PN3A 3B5IA 4KUHA 4M7WA 4DWJA 4OI1A 1KY2A 4ZI2A 5JSZB 1OWNA 5EE3A 3FAKA 2FOIA 3PDIA 5DV9A 3AIKA 3IHLA 1I30A 3RU2A 3VNSA 2RHJA 3EPHA 2CWDA 3OEHD 3PC3A 3WXMA 1NBMA 5DOVA 3FTEA 2PYIA 3L1HA 4CM4A 1IEXA 3EWNA 4WTOA 2ZRBA 4G26A 5PNTA 3HTXA 4ZXFA 3LX6A 3LYLA 2O3TA 4HH0A 3DYBA 2X9QA 3ILHA 4OUDB 4IJQA 1ZCBA 3Q88A 1H2XA 2H1SA 5DXJA 1ZR2A 3NP7A 1YJCA 2DPGA 2RGXA 4B46A 2JRLA 1PZHA 3INTA 3ER9A 4Z9YA 5U4XA 4ESOA 4Y6OA 4RZSA 3QBEA 1W36D 4GZLA 2J3MA 4LHVA 4CMKA 3BGIA 3H8VA 4OOFA 1MOSA 1WVGA 2MSLA 5LP1A 3HG7A 2XBMA 4IXWA 1UZAA 4MA0A 1C0IA 1FSGA 4LKRA 2BHRA 4LVOA 2JLBA 4R9UC 1CJCA 4AU1A 2O0KA 2V7WA 2ZB7A 2Z43A 4H9GA 1U4OA 3VJLA 1QFXA 4J2HA 1WQ1R 3L9XA 4PPNA 1JPNA 4QJ5A 3EW9A 4RHFA 4TRNA 4XASA 5HFNA 3RAPR 3MWJA 1UXGA 1YMUA 2FSFA 4N6OA 1JMKC 4JI0B 3WMXA 3QKTA 4UHDA 1PS0A 1UJCA 2LE0A 4OA8A 1HLGA 3L7AA 1E5XA 1QP7A 1P2SA 5IHXA 1I6WA 4HMQA 3PRYA 2XXJA 4ACBA 1C8BA 1FPMA 1Q92A 3F4KA 3MSXA 4YONB 4A91A 4RV9A 3VV2A 4FNGA 4ETIA 1OYOA 1WKCA 2HIAA 3LX4A 4L16A 2E5FA 4PN7A 4CKCB 2Q3CA 4WPGA 2I55A 2VDKB 3A3KA 4H0NA 4B7AA 2ZROA 1L3CA 4Q9KA 1A9OA 2YIDA 4KBGA 2JBHA 4NFSA 2IXEA 4MPDA 4CLRA 5BNZA 4Q4LA 1KH1A 3EAFA 3ZYZA 2FZCA 1E32A 3UJDA 1BH2A 4UU7A 4EFMA 1D6NA 1RD4A 1BCRA 3CUTA 4S2UA 3RSFA 3VZDA 4BE7B 4J7UA 2W6JA 3OZAA 2R7AA 3DE2X 1MMFB 4BTLA 5JCZA 3ADKA 1MU0A 1YFKA 4QOJA 2H0QA 5HP4A 3DZDA 4WZAB 4D02A 2DY0A 2W00A 2PS0A 1VL0A 5TY0A 3VH2A 1NVMB 1D2HA 3WO0A 1LSSA 2Q3MA 3RS4A 4DC1A 5AKIA 1ZD3A 1MVNA 1YL5A 4HZGA 3IHTA 4HLUC 4TYYA 2ORIA 5A03A 2I80A 4V03A 5FRDA 4Q19A 1U2GC 1Z25A 2GB4A 3FJ1A 1ZXXA 2FPWA 2YZMA 4QVKA 4RWZA 1ORTA 1YL6A 2JIZD 5JRZA 2I7DA 3AFIA 3ZWNA 4L4XA 3UPUA 2ECQA 2GN0A 4NBSA 3AILA 4XJXA 4NP6A 1L4LA 2QI9F 3DDNA 3UWOA 2G25A 3O8DA 4Y9SA 3VZSA 2NZ2A 1QKJA 2HK7A 3IT2A 4HO1X 4B75A 3OEHA 2NIPA 3A6DA 4I08A 4Q21A 4BKRA 2FMKA 1MFPA 1G3MA 2J7KA 2IYXA 3G3EA 2X0NA 3NPAA 4O08A 5FAKA 4J94A 4X6XA 2CFOA 1E1QD 2WJ6A 1IATA 4EO9A 5EFZA 3I6YA 4DLBA 2QLJA 5MFZA 2AFIE 2P77A 3KJXA 5EQJB 4BNIA 4CV2A 5LQAA 5F3RA 2YWCA 4KO8A 4HF7A 1KXZA 1N2CE 1GUZA 1F0PA 1LVHA 1BA2A 1FOEB 1JGTA 2BKEA 1K7FB 2H4ZA 4X1YB 4BTVA 1CJMA 1X7XB 2GPWA 2J3LA 3SYLA 3X1YA 5KDOA 3VVCA 2QL5A 1T2NA 4LHZA 1RJ9A 1AV6A 5AVYA 1GGJA 1E3MA 4ABYA 4IJ6A 2UVPB 2V4ZA 4RJ2A 1R7RA 2Q9UA 4B31A 5DIZA 1Y1RA 5F5XA 1OUMA 2FLVA 4BKPA 1M1ZA 3GFSA 1ZI8A 1CC1S 4R2LA 3L6RA 2PT6A 3ZJ4A 2G06A 4MB0A 1C4XA 2SBTA 2Y6UA 2PU5A 3ZGZA 5EINA 5ARDA 5L3SB 3PD0A 1CK4A 1P6QA 1V95A 4DSNA 1LRLA 4KU4A 4EJMA 4XPIB 3VSDA 1I0ZA 1CBUA 2QGNA 3Q6NA 3JX9A 2MYUA 2V97A 4R2KA 3P26A 2XZDA 3GA0A 3GT7A 4RS3A 2MJLA 2Y1DA 5LQNA 1EDEA 2WWWA 4EB6B 2IX3A 1Z39A 5TEWA 4UDNA 3BK7A 3DNMA 1W5SA 4N65A 1H65A 5ILQA 2Z04A 4UHFA 1I51A 1LU9A 3OCUA 5F98A 3AF3A 2C4MA 1C3OA 1IHOA 1Y3HA 1JILA 3E18A 3L6CA 2AH5A 1XJCA 2GZAA 5DYTA 2VP6A 5JAUA 1SG9A 1WBJB 2DMRA 2IYTA 2B4AA 4QVGA 4UPVA 4Q7EA 4H1HA 2B69A 2YIMA 4U2EA 4EMSA 1GITA 1A2BA 1X92A 2QTZA 4FEEA 4O4IF 4ZICA 2VZ0A 3ROPA 3SFVA 3F73A 2AR7A 1DXHA 1BW9B 3CF4A 3N2GB 4OBXA 2AK3A 1VHQA 1QPBA 1PFKA 4LJAA 3C3WA 5LKAA 1DWQA 3GQVA 3MPOA 5EZ5A 4YRPA 2DR0A 1XMSA 2MSCB 4BQNA 4BN0A 2ASEA 4OUDA 1PHPA 2GF0A 4W5RA 2HUNA 1L7OA 3LPAA 2CXRA 4NBNA 2ZJYA 3BT7A 3B2NA 1C9EA 1KKUA 3V9AA 2IT1A 2VK1A 1C3VA 1TQ6A 3WIBA 1KO4A 4X0EA 4DCJA 3H05A 1E6LA 2JIZA 4C0HA 1CULC 3AEQB 3IELA 2JFBA 3CFYA 2QW0X 1ZWLA 3I8XA 3G2IA 1VA4A 1WLYA 4BQIA 1I10A 1J99A 1KO1A 2Q7XA 1P2VA 2XB6A 3LUCA 4LSMA 2TYSB 5JMOA 5ITVA 4ZC8A 3O1HB 5G41A 1BHQ1 2HT6A 3WYDA 3A3YA 3ORSA 4MHOA 1IXZA 4LDPA 1VCNA 4EL0A 5JAOA 3GWZA 1F38A 5BV7A 1FPQA 3H4TA 4M37A 3P1JA 1P7ZA 4AJ1A 4DM3A 4LBWA 3WMWA 1B23P 3VNVA 3V2UA 1E1QA 1H2AS 1UBHS 2YHBA 1IRXA 3AY0A 3NTVA 4IDDA 2WYIA 3KB2A 3UV6A 4PPGA 1Z12A 2H6EA 5JCOC 3FCCA 4WLUA 2OHXA 2OQVA 3ZCXA 1N33B 1JAIA 4A0QA 4G1UC 1NZDA 1GFSA 3MLEA 3SU8A 4YMGA 3O21A 1B16A 3B6ZA 4G0OA 2PQMA 4Z3KA 5BSKA 2H8KA 2NTJA 1SKQA 1TW2A 3AK4A 3JYQA 2DFVA 1IBKB 3EJ6A 2WVJA 3O2SB 1QM5A 1KEZA 1WMEA 2FN3A 3PYMA 3JVEA 5LUBA 3B70A 5C1IA 4GR9A 3T3GA 5ALHA 1N3IA 2H5IA 3G79A 2R00C 1DC4A 1KMHB 2WT4A 5EE9A 4WACA 5IDXA 4WZAA 2D5LA 4ZCMA 4BAGA 2B2NA 3K2QA 5JNTA 4FYYA 1U4SA 4MW4A 3TKLA 3K70C 2O8DB 1LW6E 3N59A 1ZBQA 2OAEA 1L2TA 3DLBA 3SF0A 2ZLBA 4NCAA 3VU0A 2NUPB 4U7FA 5AJUA 1JPUA 1LBTA 1N2EA 2V9ZA 3QFRA 2VQ3A 3SBDA 4MO9A 3W77A 2NV2B 2QORA 2X1LA 1JHAA 3H87A 4V0KA 1T9KA 3WLLA 2GPYA 4IIXA 5I6DA 1ZVQA 1BXRB 2BTQA 1VKRA 1P9NA 3QEMB 4GI5A 5CTJA 1RKBA 4U8HA 2G72A 2PMFA 2IYZA 3DT8A 2IS4A 4ZCLA 4IZHA 3LZCA 1SC9A 1FU8A 4KLCA 5EPEA 3RC2A 3N7UA 4E5KA 1GNLA 1Y4ZA 4RAQA 1RZRD 1PQ4A 1Z06A 1M8JA 4IDGA 4M2LA 5AI4A 2D6FA 2Z4TA 3S81A 5DNCA 1X77A 1T4MA 1PT7A 2Q1UA 3N05A 3TMAA 5EERA 1T15A 3GJ7A 1PW5A 3JASA 4B8WA 1YQ9A 4ND5A 5C7YA 1QQ5A 3GY0A 3KVOA 4EHHA 5FH9A 2H0RA 3TG2A 5LQMA 4I7EA 3CZRA 1TTQB 4GMXA 3TCKA 1MPTA 2ZYGA 4OQPA 1IQ0A 1OZFA 4YBZA 3L8ZA 3IPLA 5DP2A 4UREA 3AF4A 3MERA 1JDSA 1LLDA 4KVFA 4PNZA 4RTRA 1HDXA 4Z0PA 1XRPA 1O96A 2INGX 2D2VA 1CNMA 2VNHA 4KC0A 3UGTA 3GO4A 2HPHA 4E5YA 5ITSA 4RL4A 4MXDA 3R7FA 2OB2A 3OZFA 3L8EA 1YUMA 2R25B 3EVCA 2PYDA 4IFTA 3AR9A 3OIVA 2QAIA 4L5YA 4O33A 4Q6BA 1VPVA 2I2WA 4WASA 1L5KA 4Y7DA 2IDMA 2ORWA 4B6FA 4XVCA 2H18A 3CXRA 3ZHRA 4G4SP 4X8MA 2H1WA 1U7UA 2OGWA 3I53A 5F2KA 2ERCA 4XPIA 1KK2A 1TUEA 1CRPA 1JHQA 1RP1A 1S3FA 4CL8A 3ET5A 1J0XO 1I24A 3TJMA 2P9EA 5FADA 1EFPA 2PXXA 1UC9A 2SICE 3K5WA 4Q1FA 2IU0A 4DTIA 4IYJA 4L85A 2F8MA 5C8YF 3SQXA 1S8NA 3TZ6A 4EB6A 2N1MA 2ADMA 3RHZA 4BQEA 4JYBA 5FUWA 4OHFA 1XROA 2I67A 3S1AB 4J07A 1M2HA 2N42A 2PS1A 5ENVA 2C3PA 4GR5A 1VPTA 4L0QA 2IYYA 3JU3A 4RDIA 4ZVUA 4WDQA 5HE9A 5CITA 5CVTA 2AX4A 4CMBA 1TM2A 3SFZA 4N0MA 3UXHA 4PZYA 5BUSA 1FP7A 1Y5MA 4R68A 5HKKD 1R8XA 1XXHA 2E4ZA 3MMXA 4L51A 3JTEA 5HJ2A 4CMJA 1U9YA 1KARA 3ZH2A 2EF0A 2ZKLA 3FNQA 3R6WA 3OM8A 1QP4A 2P0EA 1NT4A 3DYIA 3E8SA 3JZFA 4C7MA 1BU5A 1BW9A 1S96A 4N7BA 2CLSA 2HJ9A 1DDOA 2I6TA