3B5JA

Crystal structures of the s504a mutant of an isolated abc-atpase in complex with tnp-adp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
243
structure length
243
Chain Sequence
HHDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Water-mediated protein-fluorophore interactions modulate the affinity of an ABC-ATPase/TNP-ADP complex
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Alpha-hemolysin translocation ATP-binding protein hlyB
total genus 73
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2007-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3b5jA00
5JRZA 2WKQA 3M6AA 1TU4A 3Q85A 4QHTA 1CP2A 1T0JB 2QE7D 1N0UA 2I3BA 1S3SA 1CRQA 2FX3A 2WWXA 1NN5A 4XTRA 3CNLA 2OILA 4OJKA 2VP5A 3OIWA 1FP7A 3DVLA 2IEZA 2WWWA 4V0NA 1OFIA 5C18A 3ZS8A 3LXRA 1IQPA 1KO4A 5J4LA 1IONA 4HZUB 3T15A 2W2XA 3R8CA 1UBFA 2JLRA 2YWFA 3E70C 2IT1A 4MRRA 2NOAA 1Y3AA 4KSCA 5TARA 1E2EA 5EZ6B 3C5CA 1E9BA 5AJYA 1OXVA 1JAHA 3B9QA 4A0RA 4DSNA 2YNMA 4NHOA 1MO4A 2CL7X 2J45A 2WIAA 1CJUC 4HLQB 5CK5A 3T1OA 4A4DA 1OYWA 3W6NA 3KDSE 1LF0A 4BWYA 1RIFA 2Q6TA 4RZ2A 2ODEA 1SVMA 1E0KA 1MV5A 3DKVA 3FFAA 3Q72A 3OFND 3ZIAD 2A3RA 1G6HA 4DCNA 4DB4A 2D62A 2Q3HA 1J70A 2WOOA 4HI0E 1QG4A 2QL6A 2GVDC 1QHYA 2CVHA 2CDNA 3SBEA 4XVUA 1NG1A 2IWHA 1OIXA 1Q22A 4M21A 1OV4A 1ZNYA 4NE2A 1OE0A 4ASUA 3EC1A 3SJBA 2VH5R 2ZRDA 1RKBA 1TAGA 4HZUA 1M1YE 3LBIA 1Z29A 3KQUA 2HF8A 2J87A 2C5LA 2I1VB 4AY2A 2WAYA 4BZXA 1YE8A 4US2R 3RWMB 2GCNA 1KI9A 2N42A 4G5GA 4NONA 1MABB 3K9NA 1XCMA 3EX7C 5FOVA 2V3CC 1YR7A 2GEDA 3LW8A 1NIPA 2FFHA 3NTUA 5FL7A 4A2WA 3R9XA 2J3EA 2OLJA 4AIIA 4U00A 1S3GA 3K0FB 2BM0A 3A4MA 3BJIC 3I72A 1OB2A 4KBGA 4GP7A 3GLFA 5M04A 3KZ1E 3U4QA 2V6IA 4JL5A 1ZW6A 3GLGB 5L3QA 3ZZ0A 3U7HB 1HE8B 1KSHA 2WKRA 2XITA 1JJVA 1JQJC 5KHOC 1AK2A 2Q3MA 5KDLA 4HLDA 3A1VA 1K6MA 1LTQA 2OUKA 1IXZA 2IYUA 4Q4HA 2BCGY 1GWNA 4CIDA 3FDIA 4RY2A 4LY6A 4YMVA 1E1RD 3C16C 2GF0A 2ORVA 1N5JA 1EFTA 2G6BA 5G3YA 4Q48A 2O8BA 3ZIAA 2QBYA 4N1AA 2QU8A 2QMUA 3QIAA 2ZE8A 4DLUA 3GCGA 1RRGA 1UPTA 4IFEA 4R2IA 5TDHA 1EFUA 2WIBA 3CF6R 4OQMA 1U0HC 2Q9BA 3THOA 2F55A 3ZZTA 4B76A 2ZI3A 1E4YA 1EFCA 2BBOA 1YHNA 3ECCA 2EFGA 2J7PA 3NG1A 4HB2A 1TL7C 4NCIA 1NP6A 1OFHA 2H1LA 5FOUA 4Q7MB 1G41A 1W46A 2ZE5A 1P5ZB 3CB4A 4RKFA 1KAGA 1P2SA 2YV5A 4FI3C 5D3MB 2IF0A 3GMTA 2GWHA 2KSQA 1UAAA 1N6LA 1T5LA 4P0TA 4OK3A 1NIJA 3GD7A 5FH9A 4IDHA 4OQNA 3DM5A 2NIPA 3AF1A 3X1DA 4EPXA 2SHKA 2QE7A 4DWJA 5HTKA 1Z8FA 2J0VA 2HLDA 2Q0HA 3AF2A 3LQQA 3T34A 3VKHA 3SU8A 3VR6A 1DEKA 1GTVA 3PR1A 1SHZA 4L5BA 4QHYA 1SZPA 2JJ1D 5SZIA 2AR7A 4NKRA 4O0MA 2J7KA 3L2OB 3CF0A 4F4JA 2B21A 2GAOA 5HE9A 4IXNA 4E07A 2W6ID 1UKVY 1W0KA 4BEJA 1LW7A 1UFQA 2JJ2D 2QSZA 2W00A 3SI7A 3TVTA 2D7CA 1CEEA 1CF4A 4ZDWA 2EWWA 4CDGA 4WXRA 3WBJA 3E2IA 3Q5EA 3KKQA 1NSFA 4UJ5A 4YONB 5JEDA 1KJZA 1DAMA 4HZIA 2WKPA 4X8LA 4KU4A 2F1JA 3SC3A 1ZJ6A 4TMWA 1BYUA 1G5TA 2V4ZA 4HLCA 4B3CA 2J59A 4Q4JA 3SBDA 2JAQA 1KNQA 3WMEA 2QGZA 3RSLA 3MJRA 5DI3B 1XZPA 1ZC4A 3UANA 2O8BB 1M2OB 3THWA 2JLQA 2ZE6A 1HUQA 2BDTA 4MH0R 3S1AA 1IY2A 2QGNA 2JLSA 1SQ5A 4JVNA 1OB5A 2O0JA 3ASZA 1IN6A 1OXTA 3I5YA 3WNBA 3SJCA 1T8TA 5JS8A 421PA 3CWZA 4G0NA 5B58C 3BK7A 3PVSA 1VPLA 1E2NA 1GRRA 1G1MA 3DZDA 2VP4A 2NGRA 3I73A 2WPDD 2VHJA 3MMPA 4XH9B 4JLJA 4L15A 4V0MA 2OBNA 2PEZA 2ODBA 4ZDIA 3GEHA 1S1MA 2VHTA 3EPHA 4LHXA 1D9ZA 1TU3A 3MWKA 3AF4A 4PPFA 5CITA 5E3HA 4L8GA 2IYLD 1EWQA 1OH6A 1T3LA 3TBKA 4GMXA 1Q1QA 2QMEA 4A8JC 4ABYA 4DCSA 1E0AA 4NYIR 3I61A 3K8YA 1VDZA 2HYDA 3SJZA 1T5IA 4CZ2A 1KGDA 1SXJA 2ZRLA 4GRAA 1VG0B 3KKNA 3PITA 4LYAA 1M7HA 1ZP6A 4PC1A 1ZNZA 3JVUA 5FBWB 3SEAA 2JGNA 1G7RA 5FL3A 3I8SA 4A1FA 1YKSA 3G82C 1WBDA 1XTSA 4D80A 3OIYA 1Y63A 4KJZA 3X1YA 2FN4A 5KSPA 4CEJA 1IN7A 4ACAA 4LYHA 1GSIA 4HB4A 4BLRA 4MKFA 1XPRA 1AKYA 2FF7A 1E9FA 3KKPA 1K5DA 2ZXUA 1VIAA 1ZU5A 4OHXA 2DWQA 4MKGA 2OLKA 4TMZA 5GJVC 1U0JA 1W49A 1XJCA 5AR1A 1BYIA 4C4PA 1YR8A 2WWYA 5L3SA 2QQ0A 2QG6A 2VEDA 1EWRA 4PPQA 1W2GA 1YR9A 3B78A 4QRHA 1W0KD 1AJEA 5DH9A 2YOHA 2WMOB 4NCHA 4Q9HA 3AVVA 1P73A 2G77B 1E0JA 2W6IA 3WYGA 1JJ7A 5AWFC 1GUAA 4LX0A 5DIFA 1T6NA 4LZZA 5KTYA 4QJ4A 2JJ1A 1KI3A 3FMOB 4YMTA 4EPRA 3CLVA 1FL9A 3GLHE 2DY1A 4Q9JA 2JCSA 3CH5A 5JBQA 2V1UA 2GXUA 3K0FA 1D6JA 4MYCA 2QENA 1Z6XA 2IK8A 3BB3A 1DAGA 4JSTA 2ANBA 2QZ4A 4B74A 2NPIA 2VF7A 2MMGA 2R6DA 3EA5A 3O47A 1GKIA 1GVNB 1ZCAA 2IS1A 3JZAA 3FPAA 1R5NA 6Q21A 3OEHA 4OI0A 3I92A 1E9AA 3R8FA 1IAQA 5FFMA 3IPXA 1DO2A 1LFDB 4GZLA 1U9IC 1A7JA 2ZS8A 1W36C 2CNWA 3SYNA 3T61A 2IXGA 2C9CA 2ZI4A 1F2TA 5AUQA 5C2JB 1NJFA 4M8NE 2PLFA 4XTCS 2BM1A 1NN1A 3LW7A 1GKUB 2ZRMA 4LI0A 2O8CB 1JECA 4DLZA 3NBFA 4I81A 2WWIA 2RGBA 4JYBA 1QHSA 1XJ0A 3MLEA 3IKJA 1YQTA 2BEKA 3UIEA 1JPJA 3K0AB 2OAP1 4XWOA 4BZQA 3AVYA 5ANRB 5K8TA 1OXXK 3B1YA 4LJYA 1QDEA 4TYYA 1PLKA 2GDJA 1RRCA 2CK3D 1NBME 2FNAA 2ZJOA 4NCJA 2F9MA 1XCPA 5FPYA 4MGIR 4BLSA 2WVJA 4LRWA 3N2EA 4A6PA 1COWD 2CJWB 4PTLA 1NVVQ 2OXCA 2GZHA 2AWOA 2QROA 2FPLA 3A36A 4JLBA 2QBYB 3IUYA 3OESA 3U2QA 4P4UA 1C9KA 1CIPA 3Q5DA 1W4CA 2ZJ2A 5H8WA 2YYZA 4B44A 3QG1A 5CJ2A 5EE9A 2OESA 1GM5A 1T0HB 1QVAA 1WCV1 2PT5A 2WSSA 2QMHA 4RSGA 3TW8B 4L4UA 3SFVA 4A2PA 5JCZA 1XTKA 1UBGA 3KUCA 2IXEA 4DDWA 3TMKA 1DOAA 1JI0A 3OIVA 4Q47A 3ICQB 5UKDA 4OHVA 5JJIA 2ZRAA 3PEYA 3JZMA 2CLDX 4PAMA 3LVRE 4DXAA 3UKDA 3R9IA 3TQFA 5EXTA 4MGZR 3TVDA 2RGXA 4RFSA 1K5GA 1SXJC 3H1TA 1G3RA 4XIGS 4A8JB 5J4KA 5IRCD 2A30A 4F93B 1XJQA 1G7SA 3NBZC 3CIOA 1DAKA 1Q1EA 3CWQA 4NH0A 2C03A 1EFRD 2ZTSA 1UDWA 3ZDQA 2P3SA 3KL4A 4LWZA 1CJTC 1BOFA 5KNDA 4P3YA 2PX0A 1M7GA 3FHOA 5LBIA 4WXPA 2J1LA 3SN6A 1LS6A 3QBVA 4YMSA 1IY1A 3RWOA 1HQCA 1CULC 4LBZA 3CPHA 2UZIR 4DLWA 4FW9A 5EUMA 2GHIA 2WSSD 4YLGA 1SULA 5ELXA 4IRUB 4B2PA 3QQ5A 1D9XA 2QTHA 3GJ4A 3GJ0A 4GMDA 1G3QA 2DFKB 2J41A 2Q9CA 4KO8A 5G3ZA 3ZGXA 5KPJA 4ERNA 3WNDA 3NBXX 4FMCB 5EE5B 2O8CA 4Q1DA 1G4UR 2CJWA 1JQLB 2JEOA 5JEEA 2XZPA 1IOZA 1NJGA 1T4GA 2GK7A 2P6UA 3AB3A 4IFBA 2XTMA 4OL0A 4DLTA 4L9WA 4YXWD 2A5GA 1NN3A 1PV4A 5KYKA 3C41J 2WBLC 5FOSA 3NC0C 4PPNA 4GOXA 1KAOA 2A5YB 2C8VA 3W9YA 1KY2A 1W48A 1OSNA 1Q44A 3DM9B 4JIMA 4TLCA 3AQ4A 4BPBA 2XGJA 4DB2A 1ESMA 1D2MA 1QHHA 1WA5A 3I8XA 4Q01A 3ZVLA 2RB4A 3H84A 4QC2A 1Z6YA 4G5QA 1ZYUA 2BBTA 4U02A 4LYFA 2XXAB 5JHHB 3F8TA 2IUSA 621PA 1Z0FA 3IQWA 5FUVA 1LY1A 2CHGA 4GOJA 5DO9A 4A0FA 2CCKA 1II9A 4C7OB 3CRMA 2ZUCA 2KB0A 4HB3A 3ZVRA 2XOKA 4PSAA 3L0SA 1VECA 4Y0VA 4HDCA 2ZSBA 3H86A 1AS2A 1XEXB 3H4MA 2MSCB 3RRMA 3TAUA 4ZPXA 4QG7A 1H8HA 1RVDA 5HE8A 4DCVA 5BN5A 1N5IA 1MR3F 3SE0A 1AIPA 3QKRA 3LVQE 2IX3A 5EP1A 4P32A 1GL7A 4BFSA 1TX4B 2PX3A 1UDXA 4XD7A 2BVNA 1I4DD 4BE7B 5KDOA 3K0EA 4PAOA 3U7FB 4D82A 3TUJC 1T9HA 2I1QA 1XTIA 4NDZA 5KOYA 2HXSA 3BFKA 4B71A 2Z43A 2WJVA 3U6BA 1LVGA 1ZVQA 1VG1A 2QP9X 4OQLA 5SZHB 4LJ5A 2HXYA 4OK5A 4CEHA 4LJ8A 1ANKA 1HA3A 1E1QD 1Z6GA 3RC3A 3TLXA 2Z4RA 4B3DA 4M1SA 3V4FA 2QN6A 1CR0A 2GJSA 4RVCA 1II8A 4BFZA 4HUQA 1W44A 2UVQA 3OHMA 3EIEA 4JKYA 1HURA 1H8EA 3A58B 1KHTA 4CW7A 5JWHA 3AGQA 2IBMA 3WXMA 3DPUA 4B3XA 2FZ4A 2ZR0A 2FFBA 3FYHA 2ECKA 1SVIA 3B8HA 4CYMA 1Z28A 4JBXA 1N5LA 4Z8YA 4LJAA 2AFIE 2WJHA 1NLFA 3RLFA 4F4IA 4QL3A 4AYXA 5FUXA 1RJ9A 3BE4A 5JMTA 3FMFA 4R98A 2F43A 1UEJA 2A9KA 4LOAA 2RCNA 1R2QA 1SHKA 1TF2A 3IGFA 4NL4H 1HT2E 3PXGA 4KVAA 3R7WA 4E03A 5L8VA 3K70B 3IDQA 1NLYA 4M4SA 4TL7A 4EPVA 4TMVA 1N6NA 2ZRCA 5CK4A 4URXR 1LV7A 1XEXA 4ARZB 1DG1G 3C14C 4NTZA 1Z6TA 2GXAA 2ZSDA 4HB0A 3NH6A 1R0XA 1JEEA 3QPUA 2F3TA 1X86B 4Z1MA 1SXJD 1E9EA 4GOKA 1N6KA 4NBSA 3SQWA 1TQ2A 5FOWA 1KI1A 2FU5C 4HAUA 1HT1E 2H7VA 3LQRA 4D0GA 2EFDB 4UNNA 4LPKA 4UNRA 1Z0AA 2BMJA 2ZRPA 2XB2A 4NYJR 3FVQA 1W0JA 2B92A 3C8UA 3AVUA 1A4RA 1KI7A 3QXXA 3TJZA 2ZI9A 3PENA 1OJLA 4HSEA 3SDZA 2HF9A 2P5SA 1Z63A 1CR2A 2WWFA 4W5JA 1TF7A 4KFUA 4AG5A 2D74A 3A6PC 4B35A 3R20A 5BYJA 2WM9B 4LHWA 4ZDJA 1XD8A 4MA4A 3I32A 3K0CA 1T8UA 4MDFA 4CRWB 2ZITA 3QF4A 4QGGA 3DMDA 4RCYA 2IYZA 5IDVA 2B7BA 4OHZA 4ARZA 4EPYA 3E5HA 4D4LA 1ZM3A 3FKSD 5AUOB 3PEWA 3QKSA 4DLYA 2QA5A 4CEIA 2IXFA 5GVSA 4POAA 3I4LA 2RGDA 5JRJA 1R5BA 3B1VA 2RGAA 3RS5A 1G18A 1HYQA 4TLEA 1MOZA 2AWNA 4JBYA 3A1UA 1JNYA 2O0HA 1XZQA 4M1MA 3EPLA 3B85A 4BLTA 3I3SR 2QPTA 3PFIA 4DDVA 5JHGB 5BN4A 2OO7A 3CZPA 4IOMA 2ZAOA 4PC7A 3T35A 3BH6A 2OCPA 1XBTA 3IILA 5HCIA 2ATXA 4M9SA 3RS2A 1ZD1A 1QZXA 3VR3A 4B47A 4DSUA 3CRRA 4KV9A 3L0OA 5B30A 3TIFA 3O8RA 2BOVA 4GFDA 4TWZA 1KIMA 2ZPTX 2CE2X 4AKEA 1ZINA 1GG2A 3O8CA 1ZMXA 4AYWA 3BAFA 1OW3B 5KPDA 1BS1A 3FKSA 1VHLA 4LHVA 4PFSA 1FMJA 3CRQA 2O52A 1DPFA 3GLIE 1TQDA 1W36D 3G5UA 2H5EA 1SKQA 2ANCA 4V0KA 3GFOA 1E2LA 2PEYA 2WV9A 5KDDA 1FW6A 2QRNA 3LO5A 5CYPA 4IVQA 4C0KA 1JXOA 1O3YA 2QTFA 2ZJZA 1XD2B 3LWNA 5JFGA 4LBVA 1FOEB 1P61B 1GITA 1NMXA 221PA 1P2VA 5EJEA 1UJ2A 4GP6A 4A0GA 2IYQA 1XU4A 2G0TA 2BCJQ 4FN5A 5FBRB 3NC1C 3KTAA 2HCBA 3W5IA 2GBLC 1VIYA 2FGJA 4NMMA 3V00A 1P72A 5GJBA 5A5GA 2RGGA 3A4LA 3HU3A 3CBQA 1EGAA 1U8AA 2EQBA 5DYGA 3UWOA 3KXLA 1HH4A 1FMLA 1YZUA 2R2AA 2WICA 4AKGA 3B13B 1Z2AA 1IXRC 3SYKA 4ITRC 4LC0A 2RGNC 2ZETA 3EW9A 4JSYA 3LBHA 1BIFA 2IC5A 4A0HA 2FFAA 5GJCA 3VR2A 3CX8A 4KYUA 4QJ5A 3L8ZA 3QVUA 1L2TA 3AV0B 4A92A 2HT1A 1QBKC 4JVLA 2NQ2C 2ZROA 1ESNA 1KI8A 1OIVA 5FOTA 2YC4C 2FEMA 2OAQ1 1EFHA 1H8ED 3TSZA 4A2QA 3AVPA 3FKQA 1A5TA 3EASA 4IOJA 5A4JA 2J5XA 2Z0MA 2BMFA 4V02A 3VQTA 2PCJA 1HTWA 3GJ6A 4MITA 4XVRA 1S9HA 1E1QA 4AI6A 4N0DA 4RZXA 4EFNA 2GJ9A 3SHWA 5EP2A 1RFLA 5E7MA 4BASA 1XTQA 3AVOA 3BRWD 3MD0A 3VTKA 4AKHA 2BC9A 4G5OA 2KE5A 3B2EA 3LV8A 4H1VA 2AK2A 3AP2A 4Q02A 3FWYA 1KK3A 2CVFA 1NL3A 2QM7A 2ZJ8A 5DGXA 1XEFA 3EZ9A 2JATA 2IW3A 2BMEA 2FEOA 3C4JA 4OKSA 5DISB 4ON9A 2FMXA 2IYSA 3TNFA 4FMCF 5JCPA 2VP2A 1W4BA 3U7GA 4JL8A 4TMKA 3GEEA 5IK2D 4TZ6A 2VP9A 3B5JA 1WP9A 2JASA 2W2VA 4URYR 3QKRB 3HU2A 3OIUA 3Q7QA 4LJ7A 3ZLJA 3B1XA 4ASUD 3KXKA 1VCMA 4CEJB 2H8KA 1K8RA 4Q4HB 4JVMA 5FBQB 4BECA 4HAXA 1FQJA 2PMDA 4D4MA 2F43B 2FV8A 3UATA 3ZJYA 1E6CA 1XEWX 4Q9IA 3T5DA 1ZRHA 2OHFA 1YZLA 4PO9A 4M1YA 1P4SA 2E87A 3EPJA 4UKDA 1FNNA 2W2TA 1Z0KA 4D4JA 3NEJA 2BV3A 3WRXC 4URVR 1II8B 1E2JA 3NHBA 1SXJE 3ETLA 4ZCMA 3IEUA 1NN0A 1VCNA 3FE2A 1OHHD 5D3MA 1SVWA 2JJ8A 4C0AC 1BKDR 2QI9C 2VO1A 3NKVA 2CBZA 2WWHA 4HLUC 4MUBA 5LDDC 4HAWA 1DBSA 2Z83A 5HKKA 3P27A 3MJHA 3BBPA 2IUTA 4H9GA 4KLZA 3KKMA 1E94E 4I1UA 4C7OA 3U3MA 121PA 4BRWA 3A37A 3P4YA 3K9LA 4YXWA 4Q7JB 2C98A 3LRPA 1R0WA 3HYRA 4IW3B 4KFRA 2HV8A 1F60A 4FMDB 3GJ8A 1YJ5A 3X2SA 1L4YA 1EK0A 2RGEA 3TKLA 4ZIRA 3SQXA 2V9PA 3KX2A 2ZIAA 4A6XA 2D3WA 2VHUA 5HKKD 3TSWA 4LYJA 4P31A 2G1JA 4BLPA 1GNRA 1GILA 4D25A 2PH1A 3CPEA 2BJWA 1B0UA 1OHHA 3UXMA 2C9YA 1NVWQ 1KI6A 5HCNA 1KDTA 1A2KC 3T06B 2C04A 3HPQA 1Q3TA 4JLAA 1G19A 3FMIA 2DB3A 3GLFE 1KJYA 1R10A 1Z47A 3LX5A 1TQ6A 1US8B 4LUCA 4OK6A 5KU1A 2AD5A 2DYKA 2XSZA 3BOSA 3TK1A 4OHWA 2IYRA 3T1VA 4X8MA 3GLHA 2KWIA 2ZRNA 5E7JA 1E2DA 4O3MA 3OAAA 1DE0A 5BXQC 1CU1A 1JBKA 3S1AB 1MH1A 4QGAA 3CNNA 3UWKA 5FUYA 1WBBA 5FTKA 4X8OA 1UEIA 3WY9A 2C96A 3GQBA 5J4VA 3RVBA 4R7ZA 1Q3HA 3RSOA 1Z5ZA 4A82A 1F5NA 1XB2A 1NVUQ 2VSFA 3ZQJA 1N6PA 2Q3FA 1W5SA 1X8JA 2NG1A 4Z8XA 2XX3A 4G1UC 2X2FA 4JLOA 4F92B 1XDBA 2REOA 4XJXA 5BWMA 2H17A 3NXSA 2EWVA 2P65A 2IUUA 4ZCIA 1QHXA 2GF9A 4URWR 3W6OA 4Q1BA 5J40A 3HPRA 2ZRHA 2ZS9A 3F5FA 1Q1BA 1GIAA 3W8NA 5HR5A 5J4YA 1HEIA 4ESHA 3BORA 1US8A 4CF7A 2ZI6A 4NYMR 3WRYC 3DKPA 2CK3A 1MRNA 1QHNA 3MUFA 3MWYW 2XTZA 4FMDF 2ZSAA 3PUWA 3EWAA 1OH8A 3WMGA 5FR1A 3GLGA 2K5UA 1W36B 1DAFA 1Z0IA 1Z22A 3AKDA 3CPJB 4IDPA 4DIEA 4B2IA 1S96A 4YQFA 2XJ9A 3JVVA 1Q0UA 2I4IA 2QAJA 1MT0A 1UKYA 4RFSB 4FINA 3MAAC 3CZQA 4MUAA 2WOJA 3BFXA 5CYOA 5FBVB 1CRPA 4EFMA 3U3JA 5SZJA 2IYXA 1ZM9A 4ESVA 4NP6A 3O8DA 3W6PA 2OT3B 4XWAA 2O8DB 4EPWA 2CNWD 2B7CA 1KYIA 3N70A 1M34E 1R7RA 2DWPA 4D2IA 1R8QA 4IHQA 1TADA 1WDTA 1SKYE 5TY0A 4E22A 1ZIPA 4Q5IA 2D2EA 4JT4A 2ZYWX 4WVFA 1XWIA 2OFOA 4TL8A 4W5HA 1NMYA 1NRJB 2REXB 3VKWA 3EZ7A 1G8PA 4FMBB 1XMIA 3GLIB 4C0BA 1FX0B 5K8IA 3B1ZA 4BFXA 3A1SA 2P6NA 3CW2A 3KTAB 3RANA 5CB6A 3OEHD 1M6NA 1CJVC 4NU0A 3B60A 2P67A 1G6OA 1UM8A 1OFUX 2ZUDA 1KMHB 1ZCBA 3RABA 2AL7A 2ZM5A 3K9GA 3LLMA 4RJLA 4EJSB 3L0IB 2ZANA 3CNOA 3AUXA 1QHGA 1RRPA 4TYQA 5DYIA 1HE1C 2MMCA 1NKTA 3GJ7A 1T91A 4KCGA 5FBLB 5HZHA 2FPMA 3W8RA 3AVXA 1DARA 1RYFA 2JLXA 3ZVNA 1WF3A 3B6EA 2ONKA 4HATA 4US1R 3J81k 1PUJA 1L8QA 4BZPA 4IKEA 1LF5A 2EW1A 2XNSA 1I4TD 2A5DA 2X77A 2NPFA 2VP0A 1AQYA 1II0A 2FPKA 1J8MF 2O5VA 2GJ8A 4B32A 4BFYA 5F98A 4YMUA 1XF9A 2CL0X 3P26A 4BFWA 1SVKA 4LJ6A 5FI0B 1WMSA 2XTNA 2ZRJA 4JZKA 1XFAA 4S35A 2IWRA 3CO5A 3PQCA 2FSGA 3T5GA 3K0SA 2XXAA 3SFZA 4JKIA 2WHXA 2XNDD 2YZ2A 4LJ4A 4QBGB 3KQHA 1IN5A 2XAUA 1P9RA 1YVDA 3MGCA 2OCBA 2GETA 1XNJA 4KITB 2KBFA 2VRWA 3CX6A 4QM7A 1GAJA 1XXHE 2YWHA 4IEEA 3U3KA 4PZYA 3GLIA 1GDDA 1FX0A 3QI2A 3L82B 821PA 1ETUA 3ZZUA 1XPOA 3SHFA 3TRFA 3QE0A 1KDPA 2GK6A 4Q1EA 1UKZA 3VKGA 5DHFA 4B75A 3KFXA 1XMVA 2LKCA 3BH0A 3M4YA 2P2LA 4I1OA 1KMHA 1QVRA 2F1IA 1OT3A 4M53A 2W6JD 3RS4A 3TH5A 1J99A 3LA6A 1NSTA 4DT1A 4OI2A 4HLUA 2A7QA 1N6IA 1ZU4A 1N5KA 3NDPA 2NO7A 1G5RA 1E79D 2R44A 4LHYA 4EKDA 4GL2A 4A15A 2EU8A 2VL7A 4B73A 3A1WA 2DFLA 2O0KA 4EDHA 4JLPA 2XJ4A 3IBYA 4V03A 3KQNA 4K46A 2IYWA 4IJMA 2R9VA 4RZ3A 4URZR 2XZOA 1AZSC 1KSJA 5EXPA 1G16A 5GVRA 5CDFA 4W9MC 5AUPB 4PZLA 4HUTA 2O8EB 1H65A 1FUUA 3EA0A 4LGMA 4JT2A 1EG7A 4B33A 2HJGA 4Q18A 5FPKA 1RC8A 4NCKA 5DSZA 1G3IA 4E09A 1P75A 3WP1B 5AUNB 4IDNA 1S1CA 4DUGA 2ZVQX 3PUXA 2IYYA 1NMZA 4C0LA 2JLUA 4ZKDA 2J0SA 4JLVA 1XMSA 4ILEA 2ZUBA 2H16A 2KJQA 2RGCA 2VQSA 3WBKA 3H0KA 2J0QA 3W90A 2MSDB 5E95A 2ERYA 5G41A 1KJWA 2CCJA 3X1XA 3QUSA 4NZYA 1P3JA 3IO5A 1N25A 2JJ2A 4L16A 3UK6A 5CLQA 2AN9A 1TF5A 2BJVA 2V6JA 1F3OA 5SZKB 4H1UA 3BB1A 4MGYR 5E7IA 4KODA 1W47A 2G1KA 4KAXA 3T1TA 2AFHE 3OF5A 3AVTA 1DO0A 4RZUA 1TUEA 3LD9A 4TYWA 3BD9A 4TLDA 2EYQA 1X8LA 1R8SA 1CR1A 1PUIA 2BHRA 3C7KA 3KFVA 5KUTA 4QNMA 2CMKA 3QG5A 3QBTA 3AF0A 3D8BA 1HY3A 1NF3A 1XD9A 4TTRA 3GPLA 4JVSB 2FWRA 1DAHA 5BW8A 1ZNWA 2JA1A 5EXSA 2YC2C 3CR7A 3ADCA 3I5XA 4D26A 4TSFD 2X19A 2Z4SA 4UJ3A 5FI1B 2J7PD 1S4QA 4Q7LA 3I62A 5FPSA 1NY5A 2QEQA 2BEJA 1E9CA 4LCBA 2IF2A 4GT1A 1NKSA 4XSGA 3BXZA 4B43A 3THYB 1L4UA 4L9SA 5EQTA 1SVLA 2GZDA 3QEOA 2O8EA 1H8HD 4QM6A 4Q4AA 5IT5A 3TR5A 2QQEA 2AKAB 2YWEA 4BQSA 3NVAA 1G3UA 4V0LA 2V1XA 1E69A 2GNOA 3PG5A 2OBMA 2O8DA 3MFYA 5HZKA 3F3YA 3FB4A 3RNLA 2R62A 3A8TA 1G8FA 1N0WA 4O2RA 1GFIA 3TR0A 1PLLA 4TT3D 4CEHB 1E32A 1X1SA 2ZRBA 2YINC 3U44B 1N3BA 1KO8A 2GVZC 1U8ZA 2ZJYA 1MO3A 2D2FA 1AKEA 3CF2A 1R0YA 1DG3A 2GEVA 5CDFE 1FP6A 1E9SA 3ZD6A 3DDCA 3TW4A 1EESA 2EYUA 3A4NA 4B6FA 2QT0A 3QOFA 4D6PA 1Q21A 8OHMA 2VA8A 1CJKC 2IHYA 1PJRA 2R6GA 1KY3A 4G01B 3KUDA 1DAIA 2GCOB 4WZAE 4YMWA 3PUVA 1KDRA 4MYTA 5EP3A 3D6TB 3ZYCA 2ZEJA 4OYHA 1IY0A 3G0HA 1WE2A 4DCUA 4K8OA 2VLIA 2A5FA 2PZFA 4DRZA 1U94A 5H68A 4QKQA 2R65A 3LAWA 3UMFA 4M9XA 3GJ3A 3W3ZB 1NVXQ 5JWOA 3VFDA 1AZTA 1G7CA 5L3VA 1E4VA 4PHFA 1XTRA 3QKUA 3THXA 1CLUA 4ZI3A 1EFRA 4TL9A 3UMRA 3THYA 4C30A 1J90A 2IS6A 1OH5A 4BLOA 2WMNB 3WMFA 2IYVA 2ZE7A 4MKIA 5HPYB 4CVNA 1MO6A 4M2LA 4US0R 3OE7D 1G8GA 1KOFA 3BERA 3TSOA 3R7WB 2PT7A 1DTSA 4IOKA 3KB1A 4RKEA 4DDTA 1UF9A 1MKYA 1N6RA 2ZI5A 2ZR7A 3TQCA 1Z2CA 3MRSA 1VYUA 4OBEA 2PL3A 1ZUIA 1EX6A 3PV0A 2E1RA 4O25A 1TEVA 5P21A 1Z83A 5CIWA 4AKIA 4PHGA 2YHSA 1RZ3A 4TZ0A 1FUKA 4TMXA 5C46F 2NZJA 1IXSB 1Q20A 3QKSB 3HDTA 4CEIB 2GXQA 2B8TA 3PUYA 2OEPA 4MRVA 5KNBA 4HAYA 3TE6A 3ZD7A 3NHAA 1VKJA 3THXB 2FFQA 2OFWA 1NG9A 1E99A 1AGPA 2KI5A 2RHMA 1JR6A 3VR4A 3HU1A 4Y0AA 4AC9A 4PSKA 5D3QA 4CT5A 4JLKA 2GA8A 1Z0DA 3T12A 4GSYA 1E2KA 2BWJA 2ZRGA 5FTMA 3ADBA 4DIDA 1ZBDA 3RS7A 1FPMA 4F4CA 2ZVPX 4JJKA 2EFCB 3EZ6A 5K8LA 2PZEA 1O87A 4JBWA 2CEAA 3P1JA 1KO1A 1ZM2A 4IXMA 3WHLA 4MRPA 4ACBA 2A5JA 4W7SA 4EIWA 2W83A 3SOPA 3RHFA 1ONBA 4PHHA 3IIKA 3AUYA 5FOXA 2Z5FA 2ODWA 1P6XA 2DCUA 2BBSA 2VSXA 3DMNA 3Q3JB 3VU9B 1QF9A 1OFTA 4C0JA 1SVSA 4C3ZA 4EQ6A 2V54A 5EUQB 1C1YA 2ATVA 4BEBA 1BO6A 4DLVA 2G0NA 2D4HA 1W5TA 4URUR 2G88A 1E3MA 2D7DA 3TGPA 5IK2A 2FSFA 4TQAA 4TLAA 2VYFA 1GL6A 3M0EA 4WZ6A 3CR8A 5F2EA 1P2UA 2HT6A 2OSBA 5GADl 3OEED 3T1QA 3C15C 5C4GB 2X2EA 5C4MA 4OI4A 2OFXA 4WAUA 4DLRA 1S0UA 3GEIA 3BB4A 3QPWA 2G9NA 4NPHA 1GL9B 4WIAA 2JLZA 1CR4A 3AKCA 5JSZB 1G9XA 1IHUA 2CXXA 2VPPA 4WBSA 1E2IA 5TMPA 1T3HA 3A1TA 1SKYB 2C2HA 5G40A 1ELOA 4Q7KA 4MDEA 2CLCX 3QXHA 2QNRA 2R6AA 1GNPA 2GZAA 3W3AA 3EZ2A 3L8YA 2A78A 3VU9A 2JIZD 2ZS7A 5JECA 3B7GA 2O8FA 5JJLA 1IM2A 3ASYA 4OQXA 2C99A 5L3SB 2QP4A 4FD2A 5FPHA 1FFHA 1S9DA 1KI6B 3QENA 3AM1A 2ZJBA 2G3YA 4AURA 1F2UA 2QAGC 3QSYA 3LNCA 4FWIB 3WHKA 2FDCA 3ADDA 3SYLA 1J8YF 4TMTA 3D3QA 3VAAA 5TV2A 2F1HA 1GOTA 1E2MA 2ZU6A 5G53C 2PCLA 1NI3A 2B8WA 4P4TA 1TUIA 2W58A 5EXXA 3K70D 2OXRA 3R9WA 2QUZA 2YKGA 2WJGA 2HYIC 4PC6A 3P20A 5BN3A 4XOIA 2WAXA 4AWXA 2J9RA 2OZEA 2GILA 4JLMA 4QGHA 1X8KA 3RAPR 4O2LA 2UKDA 4CT4B 3AVWA 2ZRIA 3U44A 1KKLA 4GBMA 1U99A 2OCYC 1J7KA 3RS3A 4AG6A 1TNDA 1IJFA 5EP4A 4UXJA 3QNUA 2LCFA 5FTLA 3LBNA 3P4XA 3HP1A 4I1SA 2ZSFA 4MRNA 1MO5A 5EZ5A 5KNCA 2ZQ5A 4HAVA 4II7A 1G7TA 2ZSEA 4MRSA 4MGKR 2ZJAA 1FZQA 4EQ6B 1OXSC 4M9ZA 2AXNA 5JSZA 1L7VC 1UBCA 5AJWA 4F7WA 2GCPA 3IO3A 4HYYA 4W5WA 1U9IA 3AKYA 2PJRA 5JI2E 4DLSA 3RRNA 1XX6A 1VCOA 1YR6A 2TMKA 2O8FB 3TAHA 4IDOA 3QXJA 4V0OA 4DZZA 3NEYA 2JLYA 3BWDD 1CXZA 2DHRA 2QPAA 4OJQA 3PIRA 4QBIA 3DL0A 1KO5A 4MQBA 3MCAA 4AK9A 2CHVA 4EJSC 1KDOA 2GBLA 2GEUA 2EFEB 3CX7A 3CH4B 4RD1A 2IS2A 3HR7A 2ONJA 3V4RA 1ZM7A 2BMDA 2DFNA 1QHIA 4FCWA 2WZQA 1KNXA 4Z51A 4RD4A 1LNZA 4LBWA 2QT1A 3FMPB 4J0QA 4PQRA 2WJYA 1PVOA 2AHOA 4PO8A 5AJVB 2EVWX 3IIJA 1G20E 2YJTD 3CKLA 1YZQA 1P60A 4QBHA 4JLDA 2CE7A 3H2YA 2BBWA 1KK1A 1TQ4A 4DJTA 3QXCA 4DLXA 4EAQA 4LPSA 1M74A 4N3NA 1A1VA 1J2JA 3DOEA 4WW0A 5A0FA 2NO6A 3LY5A 4DC9A 521PA 1ZC3A 1YZKA 3Q8XB 1B23P 4I1VA 3WYAA 2V55B 1E98A 4FXPA 4KHZA 3CUEF 3LLUA 2YVUA 5FTNA 2P0EA 2ASEA 1E2HA 1R6BX 2OM2A 2WJJA 3D31A 3KXIA 5DLQC 2ZYTX 2FG5A 5EE0A 4Q00A 4GZMA 1W0JD 2LWIA 2QAGB 2KBEA 2FJUA 3B1WA 1LS1A 1U2RA 1QRAA 4LBYA 1VHTA 4PZZA 1KSGA 3U7EB 2IEYA 4ZDKA 1XD2A 1RRFA 4UXHA 5BQ5A 1NY6A 5JJKA 2Q21A 4M1KA 1GP2A 3U61B 3ONWA 3VX4A 3OEEA 1W2HA 3REFA 2Y8EA 4EFLA 5CM9C 2W0MA 2QY9A 4ZI2A 4QGFA 4D0LB 1RPZA 2ORWA 3MSXA 1IBRA 5L3QB 1AA9A 3EARA 2PMKA 5DN6D 4RCZA 1KTVA 1Z07A 2CCGA 2HDNB 1RE0A 3K0CC 3CRW1 4TYNA 2L0XA 2RAPA 3GLGE 3PJRA 1S2MA 2OCAA 3N2IA 1NNEA 4KVGA 2IL1A 1I2MA 2C78A 4B2LA 4C9BA 3FHTA 1OXUA 4ZIRB 4KFSA 3F0TA 3OE7A 3B9PA 1N2CE 1YZNA 3HR8A 3KJIA 2DPXA 1C4OA 4HAZA 3OAAD 2QRZA 3GLHB 1TTTA 2XZLA 4PHTA 5F9HA 1DS6A 2X8AA 4B6EA 3GP8A 4GPTA 1D2NA 1SXJB 1M8PA 2XSZD 1CKEA 3BS4A 1YRAA 1WXQA 4ZCLA 2WWGA 3VX3A 1G8YA 3Q7PA 3QXSA 5AK0A 4WOPA 1WB9A 1XEWY 3U5ZB 3UG7A 2OG2A 1A82A 1TEXA 2JLVA 1CBUA 3WP0A 4YDSA 4MYHA 2B6HA 1N6OA 2JDID 1BMFD 1NVVR 3WNCA 1JALA 3EAQA 1E0SA 5EE3A 1G4AE 1KK0A 2FSIA 3AF3A 5TXGA 4AD8A 4B3BA 3AEZA 2BKEA 3PEVA 4UXIA 3AP3A 1I4LD 2EFHB 2FGKA 1Q12A 1F48A 4M22A 3CRVA 3RYTC 4A36A 2MSEB 5FL7D 1T3SA 1FTSA 3DZ8A 2WTUA 2HLDD 4LDJA 1N6HA 2ZREA 3VNUA 5AJZA 1AS0A 4UNSA 4UQOA 4XD7D 5B2ZA 1GRQA 1G17A 1AM4D 1VG8A 2FOLA 4C2TA 5LD2C 2RHDA 4NYMQ 3RRZA 4XWKA 1N0VC 5FPTA 4Q1CA 1LB1B 4BFTA 1XP8A 2ODNA 4G5SA 5J5CA 1DVRA 2HJVA 1YU9A 4AYTA 3LX8A 4P4SB 4DKXA 3BC1A 4RD2A 5JI3E 1JEDA 1OKKD 2WSMA 3EIQA 2QAGA 2ERXA 2QTVB 4K81B 4Q4JB 1TMKA 5JZVA 1VYVA 2R8RA 1F2TB 2IS4A 4PX9A 1G8HA 3QJYA 4S2EA 4V0ME 4B3GA 5DI9A 4DBLC 4KYIB 3ZH9B 3OFNA 3AVQA 2F1RA 1V43A 2YWGA 4X8HA 1KI2A 4RFVA 4OHYA 1ZD9A 3MG9A 4OQFA 5C1BA 1E1RA 2N1BA 5FUWA 3NWJA 1ZAKA 2HCJB 1Z6AA 1VCIA 5DNYB 1OKKA 3THWB 4FIDA 3V9PA 5CM8B 1DADA 3SNHA 3X1WA 5IHPA 1DAEA 3EZFA 2J0UA 1XXHA 2AXPA 2CLSA 3IIMA 3K1JA 3QPVA 4Q9LA 1RJ9B 4M1TA 5H1YA 5KSZA 2FSHA 1F2UB 4TSFA 2AKYA 2P5TB 3E1SA 4KFTA 4RD0A 5CIQA 2QSYA 1VYTA 4QHSA 3IPYA 4WA7A 4G3XA 1OPXA 4DVGA 2C77A 3VNVA 4KSBA 4PQFA 5BYKA 1KO7A 5TB5A 3UMSA 4TTPA 4PC2A 1KSFX 1TPZA 4LJ9A 4BRUA 4DHEA 5KSOA 3W5JA 1BMFA 2JDIA 1HV8A 4A8JA 4QNRA 1R5OA 2V8OA 1BH2A 4BFVA 1JPNA 1RYHA 2ZAMA 3EXAA 2JLWA 1S8FA 2ZJ5A 1FNMA 1W7AA 4FCTA 2GKSA 1ZUHA 3UG6A 4YC7A 4RD6A 1ZM4A 1P9WA 3RRYA 2A2ZA 1E2PA 1G64A 4LV5B 4Q66C 1M7BA 4PANA 1GKYA 4TYPA 3IQXA 4Q1AA 4Q9KA 3VMFA 4D4KA 4TT3A 4DDUA 1ZUNB 1AS3A 1ZD8A 3OZXA 5JWRA 2NMVA 4HDQB 3U6KA 1G5PA 4G5RA 2H57A 2QM8A 4C2UA 3DEFA 4UNPA 5K8UA 3ND9A 3DO6A 5DN6A 4DCTA 1XMJA 3HYTA 4N0EA 1NBMA 1P62B 2LKDA 1IN4A 2V7QD 2H18A 2ZRKA 3BH7A 3MWLA 4TTQA 1PLJA 2VHQA 3AGPA 5KO2A 2PZGA 3QY0A 1KZGB 4DEYA 1I2DA 3HWSA 4FCVA 1WQ1R 2AK3A 2ZI7A 3FTQA 4JS0A 4R2HA 4ZV4A 1CTQA 2PLRA 4IEIA 3C5HA 3W34A 2FH5B 1UADA 4P4SA 1HQYE 1V5WA 1W4AA 2HUPA 5IF9A 1PZNA 1FTNA 1XCGB 2N46A 2W0SA 4LV6A 4TN1A 2C95A 1X6VA 2VP6A 3BIFA 5H70A 1OIWA 3KJEA 1YRBA 3KJHA 3KQKA 3M1IA 3FGNA 3BGWA 3KKOA 2NO1A 3CM0A 3GFTA 3O8BA 4I99A 1COWA 5JLJA 1E79A 2H92A 4GDFA 2NTYC 2NZ8A 4XVQA 1Z08A 2FA9A 3PUZA 1JAIA 2YOGA 1GZSA 2DFTA 4GNKA 4M0LA 3QEJA 3EIHA 3K09A 4JLNA 2DBYA 2W6JA 3D7MA 4LK2A 1Q1ZA 1E96A 1AN0A 2FZLA 3HJNA 1ZIOA 2QORA 4ZO4A 4KLNA 1JR3D 1CS4C 1KKMA 2J0UB 4Q4LA 1RW4A 4QBFA 5B57C 4RD3A 5TVKA 4IVPA 1OLOA 5J47A 4MKHA 3AP1A 4KI0A 1AGRA 1FQKA 2NO0A 3K9HA 1U98A 2GRJA 3GJXC 2G83A 2OE2A 1GRNA 3BFVA 1W4RA 1MABA 4PPGA 4TLBA 5F9FA 1AQUA 1X1RA 1U0LA 2XEXA 1QG2A 4Q03A 1D8TA 4LC1A 5DE3A 2IA5A 2PBRA 4B48A 2XNDA 4KBFA 4PXAA 1MRSA 4NYIQ 3NIBA 4LV8B 4FWTA 2VTKA 3ZS9A 4F38A 1VTKA 1D5CA 1KMQA 4R9UC 4DUGD 2GXSA 2REBA 3TUIC 3FHCB 1GNQA 2F6RA 3DOFA 5J4HA 4PR0A 1KZ7B 2AD1A 5CB8A 1DELA 3K0AA 4M1OA 5CJPA 4PO1A 1E9RA 1EX7A 2OBLA 3REGA 4E5UA 4U7DA 1U8YA 1P7CA 1E2FA 4C0SA 1Z06A 2ORIA 4BGDA 4NYJQ 3L43A 4Z54A 4C0HA 4M1WA 3VHLB 2WJIA 3LDAA 3N5CA 1G21E 3AKEA 3TUZC 4EJSA 2FE4A 3DHWC 3GJ5A 3I1FA 1G3MA 1U90A 5EE1A 3GLFB 2RGNA 4HUQB 1VG9B 3B82A 4HDOB 1E2QA 4TL6A 3SZRA 2DR3A 4NCNA 3RC8A 3SR0A 2QPOA 3EPKA 2GJKA 4DSTA 3UPUA 2VBCA 4BLQA 4M9QA 4BFUA 2QP3A 5AJXA 2ZU0C 3NH9A 3QF7A 3U3OA 4OI1A 2ZYVX 2VHCA 3QKTA 4MYUA 4EPTA 2VSOA 4KXFB 4WZBE 2ZRFA 2ZYUX 3FFBA 1E9DA 5E4FA 3SS8A 3K09C 1SGWA 3PEUA 4BUJA 3SJAA 2ZR9A 3LH5A 1YZGA 2F7SA 4Z1MD 2VF8A 2OV2A 3FOZA 1IJEA 1P9NA 4Q4AB 3VR5A 3QVVA 5LB2A 3NBYC 3U60B 5JS7A 1UKEA 4TQUS 4PAQA 5F3WB 4Q19A 1XPUA 3ND8A 1JB1A 4PSVA 3WYFA 4GI7A 4LSGA 1D2EA 1WRBA 4IDQA 4QFMA 1XTJA 3L0PA 5L3RA 1F6BA 4Q21A 2CHQA 4DEXA 1YZTA 2UZ3A 2C9OA 4JMPA 4D0NA 3KJGA 2E9SA 3IBGA 3K53A 4EUNA 1R4AA 3NDBB 3EWSA 1OH7A 1OYYA 2GTPA 4B3FX 2R6FA 3PCRB 5DHAA 1JR3A 2R6CA 4A9AA 3K70C 4QOSA 3ZVMA 5LPNA 1E2GA 4XSHA 1OF1A 5FTJA 1EXMA 1IN8A 4QXAA 2GESA 5FR2A 3ADKA 4QJ3A 1XXHB 3KB2A 3IHLA 4B34A 4R71A 3VHXA 4TQ9A 1KK2A 4JL6A 1X3SA 2GCOA 2WPDA 2PJZA 2JIZA 3Q9LA 2RKOA 4LHZA 2IHBA 3GFPA 4YDHB 3X1ZA 1U81A 5B64A 1CJMA 1Z3IX 2GJAA 2DWOA 1ODFA 2Q9AA 3ZQ6A 2J46A 2AX4A 1SVOA 4JYCA 2P6RA 3AH8A 1Z0JA 1ZNXA 1P2TA 3EC2A 4HEJA 3RS0A 4Q1FA 1NLZA 4UNQA 4D81A 3EG5A 4I4LA 3CONA 4F91B 3U3RA 5LD2B 1A2BA 2F9LA 2IYTA 4DSOA 1VMAA 1KI4A 2BIFA 3VR1A 5KSYA 4DT1B 1NBMD 2V7QA 2QMOA 3LFUA 4IVRA 1UBEA 5DI3A 3RDPA 4CGZA 3LXXA 2Z6VA 4JJZA 5GJWC 4C0QC 2F3RA 4U5XA 2RMKA 5LB4A 3P32A 2HEIA 3QF4B 2XOKD 4PC3A 1JXMA 3KQLA 4ZKEA 2CL6X 2NO9A 3MWJA 2VIIA 2X1VA 3IHWA 1Q57A 3ICEA 2BKUA 1JR3E 1XRJA 3U4QB 2YOFA 1G291 2XB4A 1R0ZA 2D06A 2GAAA 2RH5A 1W1WA 4P33A 721PA 3IEVA 5CLLA 1QHHB 4PQYA 4IOLA
chains in the Genus database with same CATH superfamily
5JRZA 1U6JA 2R79A 4IIEA 3ZCRA 3Q85A 2OO3A 1LLQA 4B46A 1KA9H 5DTQA 4AZ3A 5DVZA 4ZWNA 3KKZA 1VZ3A 4K03A 4EJ0A 5FX2A 1ZUNA 3B1KA 3GRPA 3N07A 5TMBA 1QHFA 4XTRA 1NN5A 4J0FA 3JQ8B 3M83A 1WZIA 3SHQA 5REQA 1FRQA 3ZS8A 4UDNA 2EC5A 3LXRA 4DR6B 3ABSB 1UZNA 2D1QA 1FFSA 1USGA 1Q1NA 2Q3LA 3P19A 3DJFA 4WCDA 5GZ6A 2X0EA 2HMUA 2PKXA 3R8CA 3T15A 4P58A 2IT1A 4YH1A 5LNK1 3J81A 2B94A 3D5TA 1Z6ZA 2VTEA 1KMIY 4PQGA 4B6RA 1E2EA 3C5CA 3EAGA 4HPXB 1GTZA 1P39A 5AJYA 3B9QA 1ACMA 1JAHA 2ZUEA 2FE1A 1NTOA 5E38A 3KCNA 2IHKA 1QFSA 1D0IA 1DAPA 1MO4A 1R64A 2CL7X 2HN9A 3M1AA 4NHOA 5H02A 4DLAA 4OX9Y 3KJFA 5HJ2A 1WW3A 4BWYA 2Q6TA 3PYMA 4ND6A 3I83A 1RHMA 4FGUA 1T1EA 4MR8B 1E0KA 5IWAB 4RPGA 1SXIA 3FFAA 1MC4A 3PPVA 5J5AA 3AXTA 5EUCA 2CFOA 1V7ZA 3MCVA 2A3RA 3Q87B 4U2BA 2HC9A 2VQDA 3PNLA 4HC4A 5IKXA 1J70A 2A9FA 4TV8F 3FCSB 4E46A 2ZXFA 2GVDC 2QQFA 3DMTC 4OPMA 4G2TA 3SBEA 2EQ5A 4KQIA 2LBPA 4RHXA 1OIXA 2CNBA 3DXYA 4M21A 2O2SA 1IG3A 1ZNYA 3LRXA 2OQIA 2UUOA 4LRUA 4ASUA 3SJBA 4WH0A 3W2FA 2VH5R 4J7UA 3SQMA 3DW3X 4HTFA 2Y1CA 4IFIA 1WHSA 3BHIA 5HQ3B 2CNLA 4R8LA 5CT8A 3BCSA 1J8QA 4MCJA 1A5AB 4YQYA 3HJUA 2V8BA 2XT9A 5FUBA 1VB5A 3D7RA 1OJ7A 2J87A 4H0NA 5E0OA 3Q6MA 3R7AA 2WAYA 4UTPA 2G6TA 3C3XA 3KETA 4L78A 4M3NA 4R7GA 3OURA 2GCNA 2N42A 4G36A 1RD4A 4J1NA 3WGZA 4DREA 4BNMA 1KOJA 1MABB 3CX4A 4K9SA 4CBVA 1XCMA 4DUYB 3SICE 3H9GA 1ZISA 3OECA 3GEDA 4OXKA 3EX7C 4A2WA 5FL7A 3R9XA 2B0CA 2IEDA 1FIUA 1UJCA 5A06A 3K4PA 3BJMA 1KJIA 3P97A 4EHNA 1I4OA 1EUQA 1YBAA 5GQSA 2HWWA 3O9ZA 1E8MA 1NBEA 2BM0A 2QL7A 1UP4A 5M04A 3KZ1E 5CA1F 3U4QA 3GLGB 1ZW6A 1K2VN 2W2KA 3U7HB 2P1ZA 1HE8B 3ZHUA 4KK4A 1JQJC 4WJKB 2F3QA 3ETEA 3A1VA 1I3MA 5IH3A 2JH3A 2B4AA 2VHEA 3MYRA 3WZLA 4GRDA 5LXTB 2BFDA 1PGQA 3ETCA 4Q4HA 1TYZA 1XCBA 3TX2A 3OQOA 3RRFA 1UEXC 2R1TA 2G4VA 1PYDA 2XD4A 4YMVA 1NR7A 2XGGA 1E1RD 1CT9A 1Z38A 3DFZA 3LDGA 4RH1A 5IN5A 4HGRA 2YHAA 1N5JA 5CHYA 1EFTA 1JW9B 5G3YA 2O8BA 3ZIAA 2QPLA 3O4RA 4N1AA 4OD0A 2QMUA 4PX5A 4ZCSA 2QBYA 1PG2A 3WXBA 2ZE8A 3BAZA 4DLUA 3PI7A 1MH9A 1XTUA 2P69A 3LFTA 3CISA 1UBJS 1O03A 3CLRD 4IFEA 3R6LA 3JWPA 1SK8A 5TDHA 2WABA 1EFUA 3MGBA 5K0EA 2JHPA 1Z26A 3COWA 4YRQA 4CDMA 2F55A 1TRKA 2BL4A 2BP7B 3I9V1 3RVJA 3ZDAA 2WF7A 3DBRA 1H2ZA 5FJJA 2VYVD 2BBOA 4IZ6A 3DZKA 4NV1A 2EKZA 1SRQA 2O8NA 4RW0A 3KLBA 4HB2A 3EHDA 4NCIA 4WCFA 1NP6A 4TKZA 3ICPA 2PGAA 3FRHA 4UEJA 3K2QA 4AVYA 1G41A 2ZE5A 4U6NA 2PG3A 3CB4A 5DTRA 5FB3A 1D4AA 1P2SA 3UW3A 2ZCVA 4BHTA 4IIJA 2IF0A 5F2KA 1AURA 1Z56C 3VDQA 1T5LA 4P0TA 3W2GA 2Y0EA 1GPKA 5BP7A 2G40A 1NIJA 3GD7A 3GDFA 2INGX 4HX9A 2BDUA 1PSWA 3PA6A 4EPXA 3NMUF 2SHKA 2XI4A 4Z0HO 2NZYA 5JSKA 1DXHA 5HTKA 1JZQA 4O33A 5BN4B 1MFZA 4A2CA 4M1ZA 3Q6NA 3ROEA 3BMOA 2DULA 3LI2A 4CLRB 5H4GA 3BXEA 5LYJF 1DEKA 1Y9DA 4X7MA 4RK1A 3EOAI 5M5BA 4GXTA 2NV2B 2M9MA 1QGYA 1EM6A 1Z35A 2OGUA 2FYTA 2DHQA 2JJ1D 4IIJF 4PIVA 4QQRA 5SZIA 1E63A 4DLLA 3Q3IA 2QUJA 1P44A 2IP4A 3HR4A 1H5NA 2J7KA 4FSDA 3L2OB 1Z0SA 4G5XA 2XD9A 4HFMA 4ILKA 5I3ZA 5KTSA 3PWSA 3SQLA 2PZLA 3C4VA 4E07A 2SICE 4ZI7F 4OBWA 3Q4GA 3IXMA 1USUA 3MCUA 4DRYA 2JF0A 2QSZA 1CEEA 2AJBA 2P6OA 5ILGA 4ZDWA 1JILA 4NOMA 4WXRA 4A10A 1RJFA 4UOEA 4DQKA 1CCWA 3KKQA 1YA6A 4UJ5A 4YONB 5JEDA 2YYAA 1KJZA 4CI9A 2WKPA 3SC3A 1ICIA 4HLCA 2WKSA 3UUFA 4Q4JA 3SBDA 4JITA 4FE4A 2G8LA 2PT9A 2MSLA 3NW9A 1Q0LA 1BDBA 3B9RA 3UANA 4JR2A 1H1LB 3C39A 5IYZA 2O8BB 3CG4A 2SKEA 1LJ8A 3CURA 3N75A 4ZCRA 2HNBA 2ASVA 2BEWA 3AR5A 4WOKA 7MHTA 1PVDA 1JDJA 1BD3A 2HA2A 4BNWA 1LRLA 1Z5UA 3N8KA 2FPOA 4Y98A 3ZLBA 3PPWA 2NUPB 2QX7A 1GO2A 3DEYX 1Q0RA 3SJ7A 3V1KA 2JD1A 3QX3A 4GD3Q 2R7LA 2AXQA 2O0JA 5C34B 2NPOA 1IN6A 3ASZA 4CMIB 3I5YA 2IP2A 3SJCA 5JS8A 3G9UA 3FNBA 1QP7A 4L7VA 4LK3A 1X19A 3U7QA 421PA 3UMMA 4K0KB 2H9IA 2YQZA 3CWZA 4JI5B 4QDTA 1SQ6A 4LRYA 3F5QA 1GXSA 1T6YA 1V7CA 1ZGAA 1IPFA 2R97A 1LTKA 2NGRA 1GPH1 3GBPA 3GUVA 4HQ6A 4LVOA 4BNIA 1E18A 1ONOA 3R24A 4JLJA 1N36B 1ULHA 2HHHB 4DWWA 2PKWA 1HLFA 3AY7A 3GEHA 3PE3A 1S3FA 1DV1A 2QIOA 1S1MA 2VHTA 4KO2S 4L4SA 3WGYA 4YP6A 3EPHA 1D9ZA 4YCDA 4GE0A 3ZGZA 3BE5A 2XNJA 5ALMA 4ER6A 5CITA 4ZGGA 2VTVA 2O59A 1EFPA 4Q4CA 2IYLD 2WV7A 2YRWA 1RWBA 3LLCA 1JMVA 1T3LA 1OH6A 1NX6A 2Z6AA 4GMXA 4A8JC 4R9NA 3BWYA 4DCSA 4DLNA 4NYIR 1E0AA 2YY6A 3NBAA 4R1SA 3LMKA 3TLCA 4P2GA 3SJZA 2JFOA 4H08A 4HCJA 4IHKA 5CT4A 1CQIA 4CZ2A 2V1UA 1GNVA 1VG0B 3KKNA 3P94A 4MB2A 1M7HA 4TM8A 2HQOA 3L6RA 5BWOA 3K94A 5FBWB 3MGKA 4RJJA 1QRDA 2DWUA 5FRDA 5B36A 3TPZA 5BR7A 3OO0A 3OPYA 1U3FA 5FL3A 4MHSA 1RBQA 2CZGA 3QY9A 1H2BA 4PXSA 3IAEA 4GUDA 4F9GA 3G82C 2H9YA 1WUJS 1XTSA 3ZE9A 4OF4A 3OIYA 4KJZA 4COOA 1V6AA 2I87A 3UY4A 1IN7A 3N39C 4D9FA 5KVSA 1DV2A 3A11A 2FSVA 3HM2A 4HAIA 2QUBA 1NYRA 4NY1A 2R5WA 4TLLB 3N5KA 1OWMA 4QTUB 4BKQA 2FX5A 3HA7A 1G5IA 2GLTA 3N2GB 1U7UA 4O4JB 5T8KC 3E9NA 3PQ7A 1TM1E 2VWHA 6YASA 5I45A 1AKYA 3KKPA 5FWYB 3WKCA 4CIYA 4C78A 1XPJA 1XQYA 5LP1A 2CXNA 1FK8A 1WVIA 2B1JA 2FN9A 1U0JA 5K6TA 1HBJA 2HHAA 1MHPA 2IJGX 3AI7A 3DE6X 3FLAA 4O63O 1RYNA 4B5LA 2PO5A 1RACA 3DE4X 1I2AA 2AFIA 2QQ0A 2ZOSA 2B2NA 2WWYA 2R00C 4H27A 1XAJA 2JFQA 1UPAA 5BSRA 3I05A 3ZEAA 4M7PA 4UEOA 2VPXA 5F35A 5HX7A 2CKDA 5LDHA 1TRHA 3DBOB 3W2HA 3H5IA 4OUDB 1XTBA 3A9WA 3N0XA 4H6WA 5C0OE 1H0KA 1QNFA 4JX8A 4Q9HA 2DKNA 1W8DA 4PYKA 1B43A 1NFQA 2ZBUA 2BGRA 4M9UA 3WYGA 1AB5A 3HN7A 2BUCA 1DUVG 2H29A 4F3KA 1Y6FA 2J30A 1T6NA 1W93A 4M54A 1OZFA 4UE3S 4M8IA 3FMOB 4GSKA 2O1SA 5I7VA 1K7XB 3OQ1A 3T95A 2DY1A 4R4JA 2O2ZA 3E4CA 5F5LA 3U80A 2J48A 3FLMA 1VLLA 3CG0A 4Y2QA 4ZODA 4BQIA 4GR4A 4TVSA 5GV8A 3WLMA 3DEIA 2ANBA 3I6BA 1WX1A 2CMGA 3IVCA 5DGCA 4Z2AA 4EYKA 2A4KA 3O21A 5IFKA 1M76A 1NUPA 2R6DA 1GVNB 1S7CA 3JZAA 3A26A 3FPAA 3F3KA 3LYUA 3HFSA 1QGAA 4ITVA 4UTRA 3KVYA 1XCOA 3R8FA 3ELYA 5GWXA 1OT5A 4Y6GB 1ZQ9A 2FRXA 3V2HA 1A7JA 2EX1A 2WF9A 2ZS8A 5JZ9A 5AVJA 4INOA 3SYNA 5CFRA 2WG2A 1GQ2A 3HTXA 1WLYA 5C2JB 1CYDA 3WB9A 2JAHA 1C3LA 3FW1A 2YIMA 4CV0A 2QLMA 3E0XA 2HMSA 4C03A 4L3VA 3LW7A 4KDRA 4NICA 2ZRMA 5C1IA 2GZRA 2O8CB 3EUAA 3DLHA 3EAFA 3H6HA 3L05A 3PRKE 2RGBA 5HJEA 2HU8A 1JSZA 4EGQA 3ZDBA 2I7XA 1SUIA 2OZPA 4RNCA 2BFCB 4TXJA 7GPBA 3ZHCA 5A4KA 5B7GA 4GEGA 1GTJ1 1Y1RA 2EZTA 4JKOA 5ANRB 1M73E 3RFTA 5EC8A 1L7DA 5BWCA 1DGQA 2E4WA 1QDEA 5FPQA 1L5GB 3S2FA 2DF8A 5AW1A 7REQB 5FIUA 2GAFA 5JU6A 1RRCA 2X4IA 4KPUB 1ND6A 4H77A 4PZEA 3C5WP 3VPAA 4C4OA 3E82A 2HB6A 5C8YF 1MB0A 4G41A 4UQLA 3RSSA 2F9MA 1XCPA 4CMKA 4BLSA 3G2NA 1FS5A 2WVJA 4U7WA 1CUEA 3BG5A 4J07A 3D4LA 2CJWB 3HMKA 3WB1A 1NVVQ 4HFRA 4ZOLA 4YAGA 1NFRA 3KOZA 2QROA 2AWOA 2I2XB 2QVYX 1YONA 1RMTA 4JLBA 1RRMA 1RI3A 3DP9A 4MS4B 3VNSA 1C9KA 3Q5DA 1Z75A 1W4CA 2J3MA 3MTIA 3OICA 4GC5A 5H8WA 3KVRA 3QG1A 3IMEA 2UXDB 1WDWB 2G1AA 1ZRNA 3VVBA 1GLVA 4JGGA 4OHUA 3IH5A 2PT5A 4PYMA 2QYTA 1Z9BA 4Q3CA 3A32A 4RSGA 2IV7A 3OZVA 5JCZA 1XL0A 1DTEA 3GJSA 3E4DA 3IAUA 4JI4B 4J1SA 3KUCA 1Y9JA 2JKYA 3WVNA 4RL4A 2PX2A 3DL7A 4DDWA 2CFIA 1BE6A 2OORA 2QWXA 2G5TA 2QL5A 2X9LA 3A05A 3GJYA 4FFLA 3TMKA 5CTAA 5JD5A 4K6OA 2GGSA 3FCAA 5CFPA 2DH5A 4QO8A 4F7DA 3SZUA 4PVCA 1V45E 3OT1A 4DXAA 2PRJA 1PL7A 2PSEA 3QLUA 4RVOA 5DLDA 5C9ZA 3R9IA 2PE5A 1SBCA 3HKDB 4MUIA 5LXTF 3TQFA 2I2FA 2RGXA 4NJEA 4RFSA 2PJUA 1K5GA 3H1TA 4DA8A 4J91A 3MB8A 4A8JB 1MT3A 2XMCA 1YIDA 2A30A 1XJQA 3NBZC 1NW3A 4R8RA 4KIFA 2AR9A 2RGWA 4NH0A 2C03A 3JATB 3TZKA 2ZTSA 4MSUA 4YFVA 3ZDQA 4ETMA 3ROGA 4LWZA 4ZHQF 1IYZA 1QO7A 4OAQA 2MJLA 4INAA 1BOFA 3BJEA 4ZXFA 3TZQA 5LMCA 1KAEA 4WXPA 4JN6B 5LBIA 3WZMA 4DIFA 1IY1A 4K6FA 3RWOA 1HQCA 2Z1NA 2GUGA 3DQPA 1CULC 5DT9A 1U2TA 4HS4A 3CPHA 4J1TA 4FW9A 5ELXA 1P29A 5KTMA 5CU7A 1B3BA 4EF6A 3ZXSA 2PAFA 1SVNA 4B2PA 2AEFA 1X0VA 2J6BA 1Z74A 1D9XA 4UVDA 5DXJA 3ESBA 1QV6A 4KO8A 3WE7A 4BFLA 4EB8A 4ERNA 3HJRA 3NBXX 1L8AA 1K98A 4KZPA 2BFFB 1WMEA 4KE8A 5EE5B 1SBQA 3IOBA 3KYDA 3M4ZA 3WWOA 3L5KA 4Q1DA 1Y3BE 1QF7A 2GM4A 1JQLB 1QDUA 5TQ2A 2XZPA 2NU7A 1VLZA 4JEMA 1PNOA 4OX9B 4XGKA 4YRIA 3PHHA 1XVIA 4WL0A 2Y93A 1Z8DA 2J3DA 2Z2IA 1PV4A 2IZ1A 1SQ0A 2WVHA 1E7WA 2XCRB 2A0WA 3RBZA 1EA7A 5EJMA 1GTL1 3O84A 3OOWA 4PPNA 5IPFA 4CM1A 2A5YB 4MMZB 2P68A 3GT3A 3N9IA 1Q44A 1KPIA 4IIJB 3DM9B 2NTEA 5CEFA 1OU4A 3AQ4A 3B12A 3FDZA 2BKAA 2PL9A 4ARAA 3RTAA 1BD4A 4U7GA 4G24A 4NX2A 1KBQA 4X00A 1H69A 1JLSA 4J7XA 4PGGA 4UFPA 3H84A 2UZ1A 1I1HA 2XE6A 1C0EA 1QG6A 4QC2A 4F1KA 1MB2A 1ZNQO 3VYUB 5JHHB 4BZWA 3ITDA 1PS8A 1N2CA 3PGA1 4ENQA 5FUVA 2CHGA 3RAJA 3RIYA 3ODGA 4ALIA 1GJRA 2X5JO 4HMQA 4P5PA 1I13A 1XN1A 4A0FA 4C7OB 3CRMA 3HCEA 2VTBB 3FB1A 2KB0A 2RJNA 4GGMX 1KP2A 5DGDA 4PYIA 4B82A 1RHJA 4E2ZA 4C05A 5J43A 3OIFA 4FJ1A 1D4FA 2KX7A 2ZSBA 3H4MA 3VPCA 2B6NA 5CT6A 1M0TA 3VU3A 1ADGA 3MF4A 1BU8A 1H8HA 2P8JA 2PL1A 2GUWA 3D8HA 3JQ7B 4PBSA 4RGBA 4TRRA 2VN8A 1ZH8A 1AIPA 1V7QA 1G2QA 4D3ZA 4O4IA 2C7GA 4S24A 3FM9A 4P32A 2FEXA 3OY7A 1U5CA 3G5TA 3NOXA 3O9VA 3RKSA 3SEFA 5EAIA 3QPDA 4XD7A 4D44A 4M9RA 1YDMA 2XKJE 4Z4GA 2G06A 1I4DD 2C9BA 5CB4F 1JIQA 3K0EA 3LL7A 5KDOA 4PAOA 1G20A 1I33A 2R84A 3U7FB 1HYGA 1RHQA 1SD5A 1SG0A 1U2SA 1I7PA 3GN2A 3M33A 3NWOA 4X94A 4NDZA 1RHRA 3WX0A 2X0IA 2EKDA 5B7QA 1P0PA 2F4NA 4P22A 3AIOA 1PL6A 1MDFA 4BWGA 4HOYA 2NSLA 3G02A 1MB4A 2ON6A 4LJ5A 3LPDA 3DLCA 1Z2NX 4LJ8A 4F9FA 4D9MA 1ANKA 1N7JA 1PGJA 2JBAB 3INRA 4JSRA 4J6EA 4C7XA 2Y1WA 4AP5A 5EPUA 4M1SA 3V4FA 3N2ZB 1BVRA 3EBOA 2GR9A 2EZ8A 4RVCA 3ILHA 2UVQA 3EIEA 1CNFA 1ID1A 4MS3B 1V26A 4XKJA 1RZUA 3AGQA 4ZVSA 2PVPA 3FYHA 4M0EA 2FFBA 4C14A 4HBGA 3DDZX 1EVEA 2AVNA 1A1SA 3R09A 4UMVA 1GQRA 5EZYA 2BRUC 1KJNA 1ZONA 3EQ7A 4OQPA 2WM2A 4LJAA 3DTVB 5FQOA 5YASA 4MVJH 4AYXA 1VPDA 1RJ9A 1RYYA 2WW8A 3IVXA 3SJUA 3FMFA 3HB7A 4LDPA 2C7RA 2F43A 1UEJA 4EKGA 1YVPA 2EBHX 3HL0A 1UINA 1KFJB 5K4GA 1KZ1A 4NL4H 1V8DA 1QM5A 4HN4B 3JQBC 2A33A 4EPVA 1DRWA 4FE7A 4CTNA 1RJGA 1WPXA 1Q7RA 3HXQA 1YBVA 3U4HA 1LNQA 2ACWA 4FFNA 4URXR 1NQ5A 2XRFA 3CF4G 3VO8A 3HO1A 1T6ZA 5LZ4A 4NVRA 4BNXA 3V34A 1X0XA 4J3FA 5IJZA 1E59A 4U63A 2R8XA 4N65A 3VBEA 2Y1GA 1X86B 4O4JF 1BEUB 4Z1MA 1E9EA 2VF5X 4UMFA 3F2IA 2V7GA 2NUBA 3LQRA 3DF7A 4UTOA 4HEA6 1QOPB 2EFDB 4L74A 4LPKA 1HE3A 5CDTA 3UHOA 1NXVA 1J1ZA 1YI8A 5BYAA 4PLFA 3TZHA 5KYWA 1KI7A 4JNKA 1DKNA 3KPUA 3IMCA 3F49S 4HSEA 1Z63A 1CR2A 4CQMB 2WWFA 2XVMA 3LGSA 4KFUA 3V55A 3QPAA 4UPEA 4B35A 3R20A 4JJIA 1YHZA 4AROA 3L7JA 4HGOA 1NDUA 3O94A 3WK4A 4UTVA 9LDTA 4JV5B 2J3QA 4BNUA 3RKRA 4MA4A 3I32A 3WLKX 4UEKA 3K0CA 4CFZA 1T8UA 4MDFA 3A9CA 1JVNA 2ZITA 3KB8A 4QGGA 1N9GA 1UC4B 2JW5A 2WD8A 2ZDHA 3GB9A 1C5KA 4FKZA 2IYZA 1XT6A 4RCYA 4F5EA 3V1YA 3KIPA 2ZIEA 2B7BA 5EKDA 1L5QA 3T7RA 4BVJA 4EI9A 3KOUA 2V97A 2Y6UA 3E53A 3KEGA 4D4LA 1C1XB 5AUOB 3AR8A 1AXEA 3QKSA 2QA5A 4QYIB 2IXFA 4DLYA 5GVSA 1Q83A 3PEWA 4CEIA 3CLTD 5CHEA 2BM9A 1T5OA 1T25A 2RGAA 5BMVF 3NEAA 3EPLA 1MOZA 4JBYA 1JNYA 5DSXA 1XZQA 4PICA 2B5OA 3B85A 3EIFA 5E8RA 2PXXA 2I6TA 2NYUA 1A71A 2Z1MA 3B38A 1CDDA 4DDVA 2QRHA 4HH4A 3B6KA 4CTJA 5BVHA 4KNYA 4NLLA 1RJDA 7MDHA 3R0JA 4UPDA 3V46A 2FPWA 6GPBA 1UFRA 2OYSA 3LY9A 4I5DA 4NE9A 1XBTA 3IILA 4R3UC 1P45A 5HCIA 1QJCA 4I3HA 1AQIA 3N3AC 4CQMA 1WMDA 4M9SA 1E1YA 4B47A 2P2ZA 4BJ3A 4TWZA 2QLNA 1X80B 2OR3A 2ZPTX 2J6HA 3FDFA 4R1UA 3QX7A 3K32A 4I8IA 4FFWA 1GG2A 3O8CA 5A02A 2D2XA 1FXWF 2G67A 4JBLA 4I5GA 1QAMA 3KU1A 4R2MA 1OW3B 1SUEA 1SUPA 1FMJA 1NKVA 4D3FA 1TQDA 2OCDA 4G1VA 3E9ZA 4ZMSA 4LTDA 4V0KA 3ZD9A 2NP7A 4MAMA 3HJHA 3EGWA 4P3NA 3SXUB 4BJ5A 2DG2A 5KQRA 2HZBA 3CLSD 3AESB 4JQZA 1T4CB 4FHGA 1NV9A 2QN7A 3DE3X 4C0KA 3UAGA 5I9IA 1JXOA 4MA5A 5D3ZA 1I2CA 1XD2B 2R25B 3LWNA 4LBVA 4W7HA 3ZGOA 1P61B 4A03A 3GIDA 4NU5A 1GITA 3VPFA 1NMXA 1V5FA 2EKBA 2UYQA 4GP6A 5D5PA 4Y2PA 5D6OA 1GT91 1YD7A 1K8YB 3K1ZA 2ZBPA 4FGWA 4IH9A 4JAVC 1GZ4A 1O6BA 1QIFA 3NTRA 4MW1A 1ZK2A 1ISGA 2KPOA 3V00A 1P72A 1E89A 3DHYA 3SF8B 3I9KA 3HU3A 2X1HA 2V5UA 3PQ8A 3CBQA 1Q91A 3QWAA 1XYVA 5T7BA 1GARA 3JAWB 5B58T 2CVOA 2WICA 2R2AA 4P4GA 4PGHA 1JG6A 3EF1A 3B13B 1BSVA 3MWEB 1SUWA 5E4TA 5EZSA 3UJ3X 1A9TA 2ZETA 4A0HA 3M5WA 1VLQA 5TPZA 3CX8A 5AOCA 2LV8A 3FI9A 3AV0B 3FFWA 1FXWA 1YJQA 4JVLA 5KREA 3FJYA 2ZROA 1D4ZA 4N12A 1H22A 1KI8A 3HXLA 5FOTA 4DBLE 2F17A 1ENZA 1EFHA 2R8OA 1UJBA 3LGAA 2HU5A 4I50B 3WIVA 2VDQB 4JB3A 1H8ED 2LGJA 1TPYA 3AVPA 4PCUA 3T94A 3I8OA 3LXMA 4E5KA 2JHFA 3DVSX 3FCUB 3NB0A 3WYEA 3LZ6A 4N0MA 2O5EA 1HTWA 1R0BA 3GJ6A 2GH1A 2EBFX 2VBIA 2VZ0A 1S9HA 3QM1A 3CF4A 4AI6A 5EJ8A 1LLCA 4N0DA 3F8WA 2B1RA 4KMSA 5AI4A 2FW9A 2VT7A 1I2ZA 1GTRA 5EVJA 1GDHA 4RTPA 3BSFA 1RXSA 3D2LA 2KE5A 4KACA 1OY1A 3LHSA 1NNUA 1F14A 4H1VA 3AP2A 4Q02A 4CV3A 1W59A 2QT9A 2G5PA 2CVFA 5DGXA 1X7HA 1FFXA 3EQ6A 1KDYA 1VHDA 1YCHA 2QUKA 2SBTA 2BMEA 2FEOA 1OCEA 2JHGA 4OHMA 3MUOA 4ICIA 4ON9A 1KQFA 3U9LA 4DL9A 1SK9A 1IRIA 1FX1A 1TMGE 5LA6F 5THXA 3TNFA 4CCSA 3U7GA 4JL8A 4C88A 3J80A 2VP9A 1QFZA 3B5JA 1WP9A 1Z3CA 3U1BA 3CUYA 1DX6A 2V45A 3ADPA 3QKRB 1YA8A 2WINI 3R6DA 4URYR 4Q3OA 2P3LA 1RWVA 3OIUA 4IV8A 1ZVVA 2ZSIA 2FQ1A 3GUYA 1C81A 4GM0A 5CTJA 1ZMTA 3ZLJA 4LZNA 4MYRA 1L1RA 4PYOA 4TSKA 2AF3C 4ARSA 4ASUD 1ORWA 1VYHA 2CXSA 2IH2A 4CEJB 1XCJA 4O1MA 3T3DA 4XFDA 4BECA 1QR6A 1RM5A 3QP9A 1XVAA 1WAMA 4NJMA 1GYQA 2D59A 3AESA 4OH1A 4Q9IA 4QSMA 1A8IA 1XA3A 2C5BA 1DCTA 2NU7B 5CRIA 2OHFA 3I1YA 2YHIA 1XZGA 3IA2A 4EY5A 3I62A 2M6SA 4YV2A 1F8GA 1RBYA 2CXTA 1GZ6A 4ISCA 5B5SA 3F6SA 4YYZA 3VNAA 2W2TA 3CKMA 1W30A 1Z0KA 4P93A 2GA9A 4GPD1 4UMEA 3JAMA 4RC9A 4BLWA 2YR0A 4IBOA 3NHBA 4Y9DA 5AOBA 1SPBS 4ZCMA 2XODA 4R83A 1IMJA 4GGOA 3HB5X 1F0NA 4FGLA 1V3TA 2X2PA 4X1KB 2PZKA 3WK8A 5FEUA 3H7AA 3H9UA 4RTLA 1CQJA 2CBZA 5ES3A 3WRXA 4MUBA 4JGIA 2IU4A 1EVQA 3FRJA 3H4IA 4UHKA 4E5SA 5HKKA 5JS6A 3MQ2A 2IUTA 4DIUA 1U6KA 4KLZA 4PS1A 3K3PA 3WGLA 4I1UA 4E7OA 3RIXA 4OB8A 1N2HA 1NXPA 1KWGA 3NUGA 5B55A 3CSDA 3T4XA 2Z04A 1O77A 2BFEB 1NPDA 3OPYI 2XOEA 3K9LA 3HYRA 5CG2A 2Y67A 1L4YA 2RHRA 3AZQA 2RGEA 2K6GA 2V9PA 4A6XA 2D3WA 3QV2A 3R3VA 3K2IA 4WN3A 1V71A 1J2YA 1ISRA 3OETA 1MN6A 2O23A 2G1JA 3PDCA 3X43A 3ZHQA 3M6WA 4UCWA 4M7RA 4BNDA 1HI9A 1GILA 4D25A 4KLRA 5HKBA 4MV5A 3MOSA 3OU2A 2JBWA 3I42A 4M0UA 1XCLA 4AZ0B 3UXMA 1XDGA 1BXGA 4E14A 4Z7QB 4JUBA 3CW8X 3N2LA 4WINA 4RGYA 4R8MA 1H3NA 3DMYA 1Q3TA 1E8NA 1G19A 3FMIA 4UAGA 1KJYA 2OQRA 1AXGA 1DCKA 4LUCA 3RJ5A 2PQMA 3L7CA 1K63A 2DYKA 5JOQA 2YJZA 4YJDA 1JLRA 2Q9UA 4OHWA 4YVFA 5IN4A 2C2BA 4RENA 1OGYA 4PO3X 3RUDA 5CB4A 1IXKA 1H5QA 1KEWA 1P4AA 2ZRNA 4O8CA 5E7JA 3OAAA 1PK9A 3OM1A 1T1RA 2WIFA 3GZTB 1NASA 5LSAA 5JS1A 4QGAA 2GFIA 5AKIA 3UWKA 1DP4A 1J42A 4PWZA 4X8OA 3MINB 3REOA 1WV1A 1GGKA 3VU8A 4CR8A 4NARA 3TIGA 3IQFA 4A82A 5DX1A 3ZQJA 3AHIA 1O97D 2RHTA 3OUUA 3HI4A 3FDJA 2AVDA 4QQKA 1UT8A 3ZY4A 4HNQA 4YJFB 1XA0A 3IQHX 4G1UC 4GXRA 2DUNA 3H5AA 3D0OA 3I9JA 4JLOA 5D84A 3ZU5A 2D5BA 4YV1A 4YYEA 4R2JA 4KPFC 1FS6A 3H2HA 5KWIA 2H17A 3OQVA 4GVPA 1V1JA 1PVVA 2IUUA 4ZCIA 2GBFA 3H18A 4AMBA 4YJ2A 4JI7B 4Q1BA 3RV3A 1G1AA 2ZS9A 4QUDA 3DW1X 5J4YA 1O0BA 2O7QA 1MP0A 3A2LA 5E9AA 2H63A 1WNFA 3GMIA 3QOWA 1EK5A 1PJ3A 3K1YA 2EF1A 3EEBA 5I8ZA 3VR0A 5IXSA 2Y99A 1N1MA 1L1QA 1QHNA 3CUSA 5IJ9B 5L45A 2CHEA 3BA1A 2C4HA 3PUWA 1PNRA 1PR5A 1T2UA 3NDIA 5KOJB 1Z0IA 3AKDA 5L4SA 3U40A 5HFAA 2MT9A 4ETIA 1NV8A 3CZ9A 3B3GA 2X6QA 2W70A 3F7NA 3VO2A 1OXMA 1Q0UA 2PQ0A 2QAJA 3ID6C 3PR3A 1XV5A 4NJEB 2PR2A 4RFSB 3MAAC 1PFUA 1H2FA 5FBVB 3RH0A 5EY5B 3DXZA 2Q0XA 3U3JA 3LHFA 3SVTA 2ATEA 2QVCA 3O8DA 3OSZA 2OT3B 2O8DB 4G1CA 1HZJA 3A6FA 4KKXB 5G0WA 4KQJA 2J3LA 1M34E 5BT9A 3KV3O 1T2CA 1SKYE 5TY0A 4MNTA 1E5VA 3KU4A 3U3XA 1JHRA 3MAJA 4JT4A 1GKKA 4DOMA 4E21A 3UJNA 3LP8A 4TL8A 4F2GA 3B89A 4W5HA 1EBUA 3LWZA 5AKLA 2XW6A 1B76A 5E3IA 2O5RA 3TXXA 3W5DA 4X92A 5K8IA 3BTVA 1I51A 1E64A 2XMSA 3A1SA 3EIXA 3NQ41 1VPWA 3EFOA 2HK9A 3CW2A 4NOLA 1IN1A 1IE3A 1HTTA 4BO6A 1TM4E 1ATZA 2YYYA 3G2MA 4DKJA 3W5AA 3ZDRA 3Q7TA 2QZJA 4ROSA 5TS2A 5BVGA 3PGXA 2J07A 2Q4BA 5FJIA 3SC2B 3EXG1 4ZO6A 3VKVA 2O9JA 1ZMOA 2H4FA 1UM8A 1TQHA 3L8CA 4H3VA 4BE4A 1KMHB 3MTJA 4F8JA 4KXYA 2E4ZA 1GAWA 3BX1A 2AL7A 3FSEA 3NBMA 4P34A 5HK8A 1WCXA 3JAWA 1XAIA 1JAXA 3MB5A 4MX8A 3SKVA 4I2NA 4H4EA 3QA9A 3D7SA 5J9FA 5KJEA 1M1ZA 1NX9A 2ZANA 3FNGA 4LG1A 5FD8A 1KERA 4YJGA 3VYVA 3DDUA 3D1VA 3L5OA 3CE9A 1KYXA 2IHJA 1JF8A 1OC2A 4NECA 4O2AB 4I9FA 3UKJA 2AI3A 6REQB 1RYFA 1Z7GA 3I23A 4K9RA 4US1R 2WD7B 3PNYA 1PUJA 5ECYA 1JIXA 4IKEA 4EBBA 1YQXA 1GSOA 2A5DA 2X77A 1EXDA 2H3EA 4JY7A 3SM3A 3T5AA 4B32A 5ALPA 3DV0B 5F98A 4XRGA 3SNKA 1U2GC 2CL0X 1OAAA 2XNCA 3P26A 2L82A 4BFWA 1QTIA 5JXWA 1K2WA 1PJLA 1F8XA 2DMRA 3MT0A 5E4YA 4X90A 3ICOA 5FI0B 4TWIA 3V80A 3PQCA 4OAPA 2JCXA 5FA6A 2X22A 1REQB 3AZPA 1YVEI 5AVOA 3SFZA 3WDMA 3O3MB 4F71A 1DB3A 2GLXA 3MPOA 4GMKA 3WBFA 2JIQA 4QWMA 2BGGA 4HMOA 1WHTA 1TT5B 3MWFA 2C4KA 4HX5A 4IIBA 3ZJ5A 4KQ9A 1AO0A 3EVAA 2OCBA 2GETA 2JFGA 3PPIA 4HN9A 4AKSA 4KITB 3CX6A 1VHQA 4RVNA 4C4SA 4QM7A 3P9IA 1GAJA 1M2OA 2ZRQA 1PDOA 4FZ3A 2I67A 2ZJ4A 4BPRA 4DARA 3GLIA 3MT7A 1WKCA 1BMQA 4TTAA 3QI2A 4F0JA 2OCLA 1W73A 2F9FA 5ALGA 821PA 1TCBA 4CM4A 4QRIA 4D45A 1ETUA 1M6EX 1Q7EA 3QE0A 4P83A 2PA3A 2VJLA 3ESZA 3F90A 4ID9A 4Q1EA 3MHTA 2GN0A 3TTWA 4LZJA 1LUAA 3OX3A 4AX8A 3G2HA 4Z53A 3GROA 3GWGA 4DZTA 2A9OA 1WKVA 1XZNA 2CC2A 1TVEA 3E58A 1P2GA 4JBHA 3ROXA 1J99A 4OFZA 1NSTA 3F4BA 2WJ6A 1JE1A 4RK0A 1Q0PA 5F33A 4AU1A 4J9UE 4CQNA 4RL6A 5ENVA 1TMYA 2VXYA 3AFGA 4OA5A 1H2WA 1FFAA 1U0GA 3A6DA 3RFCA 1U4SA 4DV6B 4LHYA 3KZKA 4OY3A 3AFMA 5IYZB 2P9YA 1LPMA 2TRSB 2BW0A 4U7JA 3GBSA 5FI3A 4ZV7A 3IBYA 1QP4A 3L49A 4BYGA 2JNWA 3KQNA 2IYWA 3GFQA 3V1LA 1N34B 1RWKA 5GVRA 2IUFA 1BNCA 5CDFA 4AJ4A 3NT2A 4KYTA 3UJBA 4MWZA 2EHDA 1MC5A 3EA0A 4LGMA 2C2OA 5FPKA 1F12A 2HJGA 2QMYA 2R8ZA 5DTEA 4BC1A 3QLVC 1H6AA 2YWBA 2FW7A 4HBZA 2HBRA 1GN8A 3WP1B 1K7YA 4W4TA 2AJDA 3WRYA 2ZVQX 3ONFA 4TRMA 3F9CA 5IBPA 2PX5A 3BPSA 1CQXA 3JARB 4AWBA 3DZIA 2DHCA 4HR7A 2W90A 4ZKDA 5JXIA 5KYTA 1AKWA 1RJWA 1UM9B 1XMSA 6ABPA 4EZIA 1HKHA 1CG6A 2VQSA 2MSKA 3WBKA 2BGIA 2J0QA 1PK7A 2QB5A 1Y7TA 1E1CB 2ERYA 5EIOA 1VGRA 1KJWA 3QUSA 4JJ8A 1WVGA 1N25A 2JJ2A 5FI5A 4XOUA 3UK6A 3M1LA 4OKNA 1MV8A 3OTOB 1RXVA 1X9HA 2E85A 3ZLVA 2WMYA 3ZXYA 1OH8A 3STYA 2QLBA 3DMGA 3WGKA 3IL2A 2KS6A 3MINA 4B6PA 5JROA 3Q9SA 3DBLA 3QYFA 2CDRA 4ETNA 4RZUA 1OASA 5BV2P 4G84A 4F45A 3BD9A 5CVUA 4TMYA 1TLFA 2DBQA 1JFTA 1BVHA 5AVSA