3B5JA

Crystal structures of the s504a mutant of an isolated abc-atpase in complex with tnp-adp
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
243
structure length
243
Chain Sequence
HHDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Water-mediated protein-fluorophore interactions modulate the affinity of an ABC-ATPase/TNP-ADP complex
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Alpha-hemolysin translocation ATP-binding protein hlyB
total genus 73
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2007-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3b5jA00
4Y0VA 1WMSA 1G291 3ND9A 3W5IA 4MRNA 2OBLA 2YC2C 1DAGA 1R7RA 2UVQA 4PC1A 3SEAA 1M7BA 1XRJA 3I73A 1GRRA 3BIFA 4M4SA 1FUUA 3MMPA 2WAYA 1E9BA 2AXNA 4KBGA 3AB3A 3P1JA 4HB4A 4OI2A 1DAEA 1KK2A 1AA9A 2FFAA 4EKDA 4YXWD 4YMUA 3ZYCA 4GMDA 2NQ2C 3NHAA 1COWD 2H18A 2WVJA 1EESA 1MT0A 4IEEA 3CPHA 3EPHA 1LY1A 2QN6A 2PLRA 2QPOA 2GESA 4M1WA 1ZM7A 5SZIA 3FKQA 2NO6A 1E2DA 1B0UA 5FOXA 3A1UA 3K8YA 3UPUA 1OHHA 2F7SA 2QL6A 2A5JA 2WMOB 2ZSDA 3PQCA 4I1UA 1IY1A 2P6RA 3KKPA 3B6EA 2VLIA 3MFYA 1E1RA 1GP2A 1N6PA 4DLZA 1UDWA 1S9HA 3K53A 1Z8FA 5IK2D 4DRZA 2ATXA 2ZRIA 3QXCA 1E2QA 1MRNA 5KSYA 5KSZA 5JRJA 4C2TA 3RWOA 3PITA 2MMCA 3ZQ6A 2ZE6A 3Q72A 3I32A 4LK2A 4A82A 3NH6A 2H5EA 4PAQA 1W36D 1SHZA 5H68A 4B44A 4TLEA 4PHTA 2PEZA 1AK2A 1EFRA 1TEVA 2IL1A 4LOAA 4LJAA 3C8UA 4LPSA 2VL7A 2GVZC 1GDDA 1P75A 3KB2A 3FGNA 4TMKA 5JCZA 4A15A 4RCYA 3CWQA 2J0SA 2Z4RA 5FUVA 3UKDA 4MDEA 1SKQA 2N42A 1T3LA 1F48A 4MRPA 1E9SA 3FYHA 5HTKA 4TQUS 1OXUA 4QGHA 1S9DA 1XEXB 3LLMA 1P5ZB 2Z43A 4NPHA 4RD2A 4UKDA 4II7A 3ASZA 2IX3A 4HB3A 5JMTA 2XZLA 5CM9C 4CT4B 4QGGA 3FHTA 1IN7A 1O3YA 4B3BA 1CF4A 4UNRA 4NMMA 1DG3A 2ZUBA 3L0SA 2RGNA 1PV4A 1RVDA 3GPLA 2OCYC 3MJHA 4GMXA 4IDQA 4QG7A 3UMRA 2P6NA 3EPJA 5HR5A 1KIMA 3L43A 1IY0A 2YOHA 5FOVA 1RW4A 2BKUA 4PO8A 4MA4A 2XSZD 2OCBA 1U8ZA 1NLZA 3T34A 1E99A 1P62B 3EA0A 3C16C 4Q7MB 4ESHA 3FHOA 3UWOA 2QT1A 2CE2X 1Z0AA 2R2AA 2ODBA 4JLAA 4PC3A 3SYLA 4URVR 4C0BA 1X86B 2W0SA 3SJCA 4DCNA 3CNOA 3N70A 5FI0B 1ELOA 1SXJE 4N0EA 4KYIB 5FUWA 5KNDA 5GJWC 4LX0A 4A36A 1NMXA 4A92A 4US0R 4B48A 1G8HA 4A6XA 4W9MC 5G40A 3EZFA 2RMKA 2ORWA 3FB4A 4A1FA 4LRWA 4A6PA 4WA7A 1I4TD 5FTMA 3LVRE 1W5TA 2NIPA 4F93B 1E4YA 2GK6A 2PMKA 2NPIA 2R6DA 1XWIA 1IN4A 2FEMA 2K5UA 3U7GA 1FFHA 5KDLA 1OIXA 1ZM3A 3NTUA 3E1SA 4C0AC 2VRWA 4KITB 2DWQA 2RGCA 2VHQA 1WDTA 5G3ZA 4AY2A 4IVPA 4L5BA 2RGNC 1LTQA 2EFCB 3EARA 3ETLA 3Q8XB 1DPFA 1US8B 621PA 3WMFA 4E22A 1CR0A 2FMXA 5DO9A 4DDVA 4DLRA 2WWYA 3AH8A 4CVNA 3QBTA 4C0KA 2VQSA 1PVOA 2ZAOA 4B34A 2PT5A 3I8XA 1XXHA 4Q4HB 5CK4A 4XWOA 2O0HA 5CB8A 4AKIA 2ZRMA 1YZUA 3ZS8A 1UPTA 3IIKA 2MSEB 1A2BA 3K0CA 2GJKA 4B6FA 1N6KA 4ZCMA 3ADBA 2Q3MA 2GRJA 1DO0A 5EXPA 2XOKA 2W58A 3VMFA 5HCIA 2PH1A 4JLKA 4QHYA 2CHQA 3UMSA 4WZBE 3K0FB 4EPYA 4XJXA 1S1CA 4HAUA 5JWHA 4Q47A 4MGZR 2FZ4A 2XJ9A 1PLJA 3GJ4A 4Q1AA 1GFIA 2PBRA 1ZW6A 4QM7A 4C7OB 3H2YA 5LB4A 2D7CA 4D25A 3CRMA 2EYQA 2QY9A 3AP3A 4G5SA 4IJMA 4Q9KA 5FL7A 1M2OB 1F6BA 1W48A 3EG5A 4QBIA 2IS6A 1QZXA 2CHVA 3BFVA 3QENA 3BS4A 1G5TA 3CX7A 4L9SA 1N25A 4JLMA 1XB2A 3SBDA 1OFUX 4V0ME 4JZKA 3IPYA 3LQRA 2GBLA 5C4MA 2V1UA 5P21A 5EUMA 5BXQC 1IHUA 3CRRA 2WSSA 2QM8A 4DB4A 2GXUA 5ELXA 3A1SA 2YWHA 3TMKA 5BN4A 3B9QA 3K0CC 1TQ4A 2GEDA 3LW7A 3BB4A 3ZZTA 1OYYA 2KE5A 3GLFE 4DXAA 1CRPA 1GNQA 2OT3B 1KTVA 3AP2A 4B43A 2WTUA 2R6AA 3X1WA 4CEIA 1CBUA 4S35A 4QM6A 3LY5A 3U3RA 1R6BX 1C9KA 2O52A 1LB1B 3T61A 1E2IA 2GCOA 3W5JA 4Q1FA 1EFUA 1NLFA 1YRBA 2L0XA 3QXXA 1GZSA 2CL7X 4JS0A 3RYTC 4C3ZA 3VQTA 4J0QA 5TXGA 1ZNYA 1TU3A 1XJCA 4TTRA 4IDNA 2ZR9A 5KYKA 2EW1A 1OH8A 2R6CA 3UWKA 2R44A 2ZJAA 4HI0E 2QZ4A 4V03A 4AG5A 1G7CA 2IYVA 2FGJA 4HAWA 2IF2A 2BMEA 2V7QA 2B21A 1G16A 1GKIA 1MABB 4JBXA 4LCBA 4QGAA 5TVKA 5KTYA 2GXAA 3CRW1 4OKSA 5FI1B 1WP9A 4RCZA 5JJLA 4CEJA 1FPMA 1DAKA 2GTPA 1QDEA 5EE1A 3LAWA 5TV2A 2GBLC 1QHHA 2AKAB 1E98A 3F8TA 5A4JA 2RGAA 1UF9A 2J0QA 3SN6A 2ZM5A 2W83A 3NXSA 3JZMA 3TJZA 1N6HA 3QI2A 4GDFA 5JI3E 1OFIA 1CRQA 5BQ5A 2CBZA 4IOMA 3JVUA 3ICEA 4ZCLA 2ZVQX 4DUGD 1N5JA 4V02A 2GJ9A 4AKHA 4A8JB 1G19A 4PANA 4C0HA 1Q1BA 2PZEA 5FBQB 4MKIA 5K8UA 1OXTA 2HUPA 2CLDX 5LDDC 1P2TA 1SKYE 721PA 4GFDA 4GSYA 3QY0A 4QRHA 2BJVA 4DLYA 5A5GA 1ZU4A 1H8ED 1CJMA 4LYHA 1VHLA 2ERYA 2FGKA 5EXSA 2W6JA 3QKSA 4FINA 4WVFA 2IYLD 4PHHA 4DIEA 1UBFA 2GEVA 3AKDA 1YR9A 1XEWX 2GJSA 4DWJA 1ANKA 1OYWA 3WYFA 4KFTA 4NU0A 1SXJC 4LJ7A 3GLGA 2ZRLA 2O8CA 4DSOA 3IILA 1MV5A 5JS7A 3R9XA 4GPTA 4OJQA 3SOPA 1Z6TA 3NEJA 3SYNA 2WJYA 2YOFA 2DYKA 3M4YA 4PSKA 5AUOB 5GVRA 2F9MA 2KI5A 1YQTA 2ZJYA 4I99A 2HT6A 2CK3A 1XU4A 3OE7D 3R9WA 2HEIA 1RZ3A 5HPYB 3MGCA 2Y8EA 1I4DD 1G21E 4LUCA 2HLDA 4RFSA 4XWAA 2ATVA 2VHUA 3AF1A 3D31A 3IBGA 3CX8A 2FNAA 1BMFA 2GNOA 1JJ7A 2QUZA 1KAOA 1GG2A 2OV2A 2RGEA 3K70D 2C9YA 5JS8A 2XTNA 3DPUA 4H9GA 1R8QA 1LS6A 4UXJA 5B57C 1E1RD 4AYTA 5DI9A 4H1VA 2HYDA 1NY5A 4HZUB 1ZNZA 3AVQA 4B6EA 5CB6A 3BK7A 4MRVA 4Q9LA 1RIFA 4FMDB 2B7BA 3KKOA 5IRCD 2FOLA 1X1RA 1JECA 2J1LA 4HLDA 4JT2A 2GJAA 2P2LA 3M0EA 1EGAA 3SQWA 1KMQA 2I3BA 4P0TA 1J8MF 3TBKA 3SNHA 2Z4SA 1XD9A 1LF5A 5JECA 3LX5A 4KLNA 3FMPB 1M8PA 3WYGA 1SULA 4U5XA 1RE0A 4CEHA 3WYAA 5HKKA 3LO5A 2WWWA 1ZU5A 121PA 4I1OA 2Z6VA 2FX3A 3X1ZA 2DY1A 3FMOB 2JDIA 5DN6D 3W9YA 4JBWA 4DJTA 1NN3A 4QFMA 1IOZA 3VX3A 3BWDD 4Q9JA 5JEEA 3KX2A 3ONWA 3GLGB 2GCPA 4XD7A 1WBBA 1A4RA 3HP1A 1KI8A 4X8MA 2WPDD 5D3QA 1Z63A 1XTJA 2VHCA 1JAHA 1UAAA 1ZMXA 3OAAA 4FMCB 3T1QA 5BWMA 1JALA 3ZLJA 2ANCA 2C03A 5L8VA 2NO9A 3ZIAA 1OW3B 4Q9HA 4B3XA 3EZ6A 5BN5A 1UKZA 1OB5A 1KSJA 3QKUA 2QMOA 1UEJA 1Z0DA 4OI1A 1OF1A 5GVSA 1D5CA 4X8LA 2WJVA 1HQCA 3O8RA 4BGDA 3B9PA 1JEDA 3QSYA 3VR3A 4PHFA 1KNQA 1P3JA 1UDXA 5EE3A 3EIEA 2J41A 1MKYA 1F60A 4L4UA 4XH9B 2CEAA 3K9LA 1CTQA 1GRQA 4QXAA 2PJZA 3WHKA 2R6FA 1K5GA 1QG4A 1Q3HA 4UNNA 2BM0A 1KZGB 2F43B 4DCTA 3IPXA 3PFIA 5DHFA 3SBEA 2ZRHA 3IQWA 3VHXA 3EPKA 2QG6A 3E70C 2AFIE 1E79A 1FOEB 1RC8A 3FDIA 1RRFA 1SGWA 4O25A 4L15A 1GRNA 1RJ9A 2PCLA 2NZ8A 2CJWA 1II0A 3DVLA 1NVUQ 1UBEA 4R7ZA 3LA6A 3B60A 5BYJA 2VH5R 3R9IA 3X2SA 3RRZA 2IYRA 2ZI9A 4D4KA 5EP2A 3UK6A 4A2QA 2WWHA 2OESA 1N3BA 2R65A 4B3DA 4BFUA 3K0AB 1M6NA 1EX7A 1GL7A 2G83A 3FTQA 2I4IA 5FTNA 1H8HD 3UIEA 4HZIA 4LJ9A 4E03A 4EPVA 5FOWA 1G3MA 1ZIOA 2ORIA 2V8OA 4G5RA 2AXPA 5KNBA 3HPRA 1XXHB 3KFVA 3FE2A 4NCKA 3ADKA 5E7JA 3T35A 2VF8A 1E94E 3CIOA 5FPTA 5KDDA 4P33A 3RS4A 1NVVR 1AZTA 1YZTA 4EJSC 4LY6A 2IS1A 1VG9B 4PPFA 3UATA 1IM2A 4P32A 2ZE8A 3KJIA 2J0UB 4LC0A 3KQNA 5E95A 1KI1A 1CKEA 1KNXA 1CJTC 4BLOA 3DHWC 1XD2B 4A4DA 1CJVC 2JLXA 3AUXA 3EPLA 1GUAA 1N6IA 5GJBA 4B75A 1E1QA 4BEJA 4D82A 3M1IA 5KSOA 2IT1A 2AWNA 2ZRAA 1N5KA 1SXJB 3ZD6A 1VYVA 1NN1A 3P4YA 1ZD9A 1J90A 3RS2A 4DLVA 3LX8A 2CNWD 4Q7LA 2BVNA 3NVAA 5IHPA 3PV0A 4HLUA 1B23P 2X1VA 1W36C 3GJ8A 1NI3A 4LBZA 5EE9A 2WZQA 5AJVB 2YNMA 4LDJA 3AF4A 3VTKA 2RGBA 3U7EB 3WRYC 5AJXA 4OL0A 4LV6A 2RCNA 4M1TA 4C2UA 2AWOA 3CH4B 1FNNA 3VU9A 3CR7A 3WNDA 4MYUA 2J3EA 3SDZA 4A2PA 4AKEA 1JR6A 1I2MA 1CULC 3QEOA 4D4LA 4F91B 4NTZA 2H1LA 4DDTA 4MDFA 1FL9A 2WBLC 2YV5A 3S1AB 3SS8A 4R71A 1KI4A 4EJSA 3HJNA 4BLSA 3NEYA 1NBME 1SQ5A 2QMEA 5TB5A 1I4LD 3BORA 3GLIE 2KB0A 3TSZA 2C96A 3VR4A 3RAPR 4NCNA 4XVQA 3TR0A 1HH4A 1II8A 3RS3A 3D3QA 1Q20A 3W90A 2IEYA 2ZAMA 1QRAA 2QE7D 1SXJA 1N2CE 1XTSA 2IHBA 2ZRGA 2ZUDA 2ORVA 4LBYA 4D4JA 1E2NA 1M34E 1Z08A 1RYFA 1KI6B 4TLDA 5EE5B 4BQSA 1OHHD 4CEJB 4ARZA 4HB2A 4RSGA 1KO7A 4KO8A 3SJBA 4HLUC 3GLFB 1BOFA 2J7KA 2ZRCA 4R98A 1KSHA 2AK2A 1YU9A 5IK2A 3AQ4A 3V4RA 5H1YA 1JR3D 4NH0A 1YZQA 4PAMA 5FTLA 5J4KA 2Q21A 2IXGA 2Z5FA 1JNYA 3G82C 3TUIC 1CS4C 1Z6AA 2BBTA 3T5GA 1KMHB 2YOGA 2ZR0A 3OEEA 2ZRPA 3LBHA 3N2IA 4NYIQ 2QTHA 4BWYA 1OH7A 4ZCIA 4JLBA 5EJEA 1VG0B 3NBZC 1UKYA 3MWKA 2VTKA 4H1UA 2C77A 1Q44A 1X3SA 4LV8B 1PLLA 2DHRA 3CM0A 4Q18A 4EPXA 5K8TA 2G1KA 2ZJ2A 2J0VA 5SZJA 5F3WB 5C1BA 2WM9B 1ZUHA 4GBMA 2A5DA 3BE4A 3Q85A 4BUJA 1E9CA 1OV4A 1KDOA 1IXRC 1N0VC 1XTIA 4BLRA 3U6BA 2OSBA 1FP7A 1Q1ZA 2ZSFA 3W8NA 1RKBA 4FI3C 5CDFA 4BLPA 1KSFX 2CXXA 1K6MA 3QJYA 4WIAA 4G5GA 5FFMA 3AKCA 1KY3A 3TK1A 1AJEA 2AR7A 3KKMA 1MO6A 4WZAE 2PJRA 4D80A 3C5CA 4RFVA 5E7IA 1UADA 3F0TA 1KK1A 1KGDA 1HV8A 3GLFA 1W4CA 4LJ8A 3EW9A 3PENA 2BEJA 3I3SR 1XJ0A 4GNKA 1Q22A 1XX6A 5GADl 3O47A 5JHHB 3TLXA 2BBSA 3KB1A 4W7SA 3ECCA 2GVDC 1AKEA 2BKEA 3KJEA 2F6RA 1N6OA 4QL3A 1KI6A 2J0UA 1YJ5A 4OJKA 1U8AA 2HDNB 4TQAA 1ZIPA 4E5UA 2YINC 4ZKEA 2D62A 2ZETA 3PUWA 4DCUA 3VR2A 3NBYC 3V9PA 4PSVA 3IHLA 2QSYA 4G3XA 4ZI3A 5FBLB 2QQ0A 4YMSA 2ZPTX 2GF9A 4C0LA 3RRYA 1R0YA 4NYMQ 4TT3D 4WBSA 1VCIA 1N0UA 2JJ1D 3IEVA 1H65A 1GNRA 2EWVA 4UJ3A 3U2QA 1KDTA 4JBYA 1E2GA 3D7MA 4M9XA 3SJZA 2EWWA 1Z0KA 4AG6A 3IGFA 4Q1DA 1G64A 2ZEJA 4YONB 1S2MA 3CW2A 4EAQA 1TQ6A 2MSDB 1Y63A 1Z06A 2W0MA 5DI3B 2ASEA 4OHYA 3BB3A 2C8VA 2V4ZA 1TQ2A 1EG7A 1KDPA 2ZI3A 2C95A 3O8DA 3BH0A 4JLPA 4LGMA 4KFUA 2XNDA 4G5OA 4BFTA 4KU4A 1EFRD 1VG8A 5EZ6B 1AGRA 1W44A 4IRUB 2O8EA 1PUJA 2EYUA 2RGGA 3SFVA 1MABA 5DGXA 4ZIRA 1U0LA 2AN9A 3P32A 3GLIA 1JB1A 1FMLA 4MYHA 2ECKA 2H16A 2ZS7A 3P26A 1G41A 3DM5A 1P2SA 4IVQA 5JI2E 3OIUA 1CIPA 4QNMA 1P7CA 2CCGA 2GETA 3QOFA 4D2IA 4JSTA 2WJGA 3A4MA 3QF7A 5H70A 5GJCA 4B47A 5HZHA 2XXAB 1TF2A 5DNYB 3I92A 1WB9A 2QPTA 2ZRBA 4LJ6A 1W4BA 4K81B 2P5TB 1RRPA 4JT4A 1VG1A 4IW3B 4UNQA 1XMIA 3FHCB 4RZUA 4TMVA 4C0QC 4DSTA 1VCOA 4MGKR 1VHTA 2VYFA 1XPRA 1CXZA 2OHFA 2PMDA 1QHNA 1D2MA 2JDID 3KXIA 1SVKA 2XXAA 4M53A 4MITA 4PC6A 4NCHA 3I8SA 4Q02A 1LS1A 1FQKA 2JGNA 3CNNA 4ZI2A 2W2XA 2OXRA 3RS5A 1FUKA 3FWYA 4FIDA 3T1VA 1TL7C 2FV8A 3AEZA 4NP6A 1EK0A 2OCAA 2WPDA 3U61B 4QGFA 5KSPA 4B2PA 4N3NA 3RSOA 2JJ8A 3TE6A 2IYZA 1IN5A 5L3RA 2JLUA 4ACAA 3PUXA 1SVLA 1E9AA 5DIFA 4TMZA 1XCMA 3MCAA 3IHWA 1JPJA 2FWRA 2ZI6A 4D26A 2F3TA 1FX0A 3MG9A 1RJ9B 1E2EA 3CLVA 1JEEA 4KHZA 5DISB 3L82B 4DDWA 2PZGA 4FWTA 4RJLA 2VSXA 4ZDJA 3OIVA 1Q3TA 1L4YA 1Z2CA 1QF9A 2C2HA 1BMFD 2IF0A 3QE0A 4AK9A 5FOTA 3B1WA 4Q01A 3FKSD 3MSXA 3OHMA 1UFQA 5CIQA 2W00A 1O87A 3KJHA 5HE9A 2WSSD 3KQHA 2ZTSA 2GAAA 4WAUA 1SVWA 4D0NA 3LNCA 2IYQA 4PQFA 5EQTA 4PPQA 3A36A 3ASYA 1HUQA 3KZ1E 5FOUA 2ZYVX 4NCIA 2PX3A 5J4VA 3CKLA 4O0MA 1YR8A 5JZVA 2WHXA 2FF7A 2JLYA 2V54A 3GLHA 4WW0A 4CT5A 4PX9A 1G3IA 4NKRA 4P4TA 4OI4A 3SR0A 3EX7C 3FVQA 2N1BA 3PJRA 2A2ZA 2VP4A 4LYFA 1VIYA 4ZV4A 1L8QA 3GFTA 4BFWA 3FOZA 3MLEA 4MKFA 2D2EA 2QAJA 3EXAA 3LRPA 2D4HA 4X8OA 3AGQA 4OK6A 2QORA 2OBNA 5DYIA 5AUQA 2OE2A 3HDTA 3K1JA 3VHLB 4TL7A 3TVDA 1FW6A 3HR7A 1MR3F 1KI7A 1M7HA 2DWPA 4TYNA 1E96A 3QXHA 2VSFA 2ODEA 1G9XA 2QTVB 2XOKD 3AVTA 1BIFA 4POAA 2HF9A 1E6CA 1P9NA 3LVQE 1OH5A 1GNPA 4G01B 1MO3A 4Q03A 4TQ9A 4IXNA 4NYJQ 4PXAA 2VF7A 4TMTA 1RFLA 5DI3A 2OZEA 3P4XA 4B76A 1QVAA 2CVHA 3L8YA 2IEZA 1P2UA 1G20E 2UZ3A 3FFAA 2CVFA 3TAHA 2EU8A 3PUZA 1KZ7B 3ADCA 2J46A 3O8CA 1M1YE 2WIBA 4IFBA 1G7RA 2HXSA 1G7TA 3QKRA 4GI7A 1DTSA 2BIFA 1U94A 3GCGA 4KFSA 4PC2A 2AL7A 2HT1A 1NL3A 4JIMA 5D3MB 2JLSA 2ZS8A 4QJ4A 4TZ0A 4B33A 1N0WA 1QHGA 2LKCA 1PUIA 2LCFA 3H86A 5TDHA 5J4LA 3E5HA 5FH9A 1QBKC 4N0DA 3GLHB 2W6JD 1EX6A 2JA1A 3BH6A 3OFND 4B71A 2O8DA 4ZO4A 4EPTA 1YZLA 4IOJA 1Q21A 1VKJA 1XMVA 1E79D 2C5LA 2QA5A 2V6IA 5IT5A 1E2JA 1TQDA 2BM1A 3AF3A 4D6PA 4ITRC 1VDZA 1X8JA 5B58C 4UNSA 2ZSBA 4HSEA 3Q5EA 2OEPA 4M9QA 2FEOA 1Z6XA 2OLJA 4QHTA 2IYTA 2ZJ5A 2FFHA 1G5PA 1TU4A 4URWR 1XPOA 3HU1A 2ZYUX 4HDCA 4PO9A 3CONA 5B64A 2PLFA 3DKVA 2GCOB 1TPZA 3WY9A 4YMTA 3MRSA 2CLSA 3W6PA 3DZ8A 2VP0A 1NY6A 5FTKA 3DL0A 2D7DA 3NG1A 1OJLA 4CZ2A 1JXOA 2QAGB 4OBEA 2BOVA 4CEIB 1Z29A 2ZRKA 4CGZA 3KDSE 4QBGB 1GITA 1IJFA 4DVGA 1UBCA 2VP9A 3VKHA 1E2LA 1NBMD 3AVYA 2BMFA 4DB2A 3M6AA 3LV8A 3SFZA 3T06B 1X1SA 1BH2A 2BWJA 2B8WA 2QAGC 4IFEA 1ODFA 4Q1BA 4V0LA 4K8OA 1P73A 4NHOA 3B85A 4BFVA 3ZH9B 2P3SA 2XEXA 4XVUA 2GXSA 2XTMA 3DZDA 1UBGA 4ZDWA 4PQYA 1I2DA 2CNWA 4GRAA 4EFNA 4BFZA 5HKKD 1QHIA 3W8RA 4BLQA 2XITA 1NN5A 1MO5A 1HQYE 4TLCA 5J4HA 2AD5A 3AUYA 3I4LA 1FNMA 2IS4A 2ERXA 5L3SA 4OQXA 1CJUC 3W3ZB 3A4LA 1MO4A 2RKOA 1F3OA 1CP2A 5DSZA 1RPZA 3B78A 4MGIR 3U3KA 3CX6A 4IXMA 3K0FA 4QJ3A 4F92B 4KSCA 3CPJB 3RDPA 3PR1A 3ZJYA 3IO3A 1VYUA 2AKYA 3LWNA 4OQMA 4GZMA 4KCGA 1AQUA 2V6JA 3IBYA 4OK5A 2QI9C 3T12A 3RABA 3OEHA 5CLQA 1OFHA 3QBVA 3B13B 4ZDKA 3PEUA 3TIFA 3ICQB 4WXRA 4FMCF 2QU8A 1KJZA 1R10A 1KI9A 2W2VA 1JQLB 3V4FA 4US2R 5LD2B 3WBJA 1KJWA 3RSLA 1NG9A 2DFLA 2F1HA 4LHZA 1XF9A 1T8TA 5CK5A 1XP8A 4MRRA 5JJKA 3VKWA 1FZQA 3K0SA 2QAGA 3PVSA 2HLDD 1A7JA 5K8LA 3OF5A 1SXJD 1P2VA 2ANBA 1OXSC 4HDQB 3TKLA 1ZM9A 4ABYA 4DIDA 5L3QB 3KQKA 4DDUA 1N6NA 2JJ1A 4QKQA 1ESNA 3B8HA 4ZIRB 2JCSA 3THYA 1VCMA 3QKTA 4IKEA 5CDFE 3AKYA 2XGJA 2JASA 1W46A 4URYR 1W4RA 5FBRB 2QRZA 2MMGA 1YRAA 3THOA 1XMSA 2XZPA 4KV9A 2FE4A 3TRFA 4AYXA 2ZR7A 1NSTA 3FMFA 1G8PA 3FFBA 2ONKA 1DS6A 2ZJ8A 3TUJC 5JBQA 5C46F 2EFEB 3AF0A 1FTNA 1M74A 2KWIA 4BRUA 4Z54A 2AK3A 4TL9A 2IWRA 3T15A 2C98A 2YJTD 8OHMA 3HYTA 2YKGA 2YHSA 2X8AA 3WNBA 1KY2A 4F7WA 3H4MA 2OG2A 1W1WA 3Q5DA 2HV8A 2F43A 1U9IC 1GKYA 1DEKA 2GEUA 3QIAA 3KJGA 3I61A 5HCNA 1H8HA 3RS0A 2ZUCA 2IUTA 5KPJA 1U99A 5BYKA 4LJ5A 5FBVB 5E4FA 3QNUA 4DKXA 4ERNA 2RAPA 1ZVQA 3VR1A 1KOFA 4KBFA 3R8CA 4A8JA 4D0GA 1ZJ6A 3K9GA 1ZRHA 2BMDA 3C41J 4MQBA 1D2EA 1FMJA 1WQ1R 4PZLA 1YZNA 2FFBA 2ZSEA 4G5QA 3RRNA 2QENA 2BMJA 1L7VC 4I4LA 4TSFA 3THYB 1XBTA 3A58B 1EFTA 5AJWA 3DOFA 4KFRA 4URZR 2ZROA 1XNJA 1Z0FA 2ZE7A 2B92A 1G8FA 3D8BA 2H8KA 3HR8A 2A9KA 2GJ8A 3EASA 2BJWA 1TUEA 1CEEA 4M1OA 3VX4A 1W4AA 1WCV1 3B7GA 2OXCA 4YMVA 5CLLA 1E3MA 3GEIA 3NH9A 2HF8A 4M1SA 1J2JA 2D2FA 1QHYA 2ZI5A 1VIAA 2IXFA 4P4UA 2RB4A 3CNLA 3IQXA 3RC8A 2GDJA 1M7GA 1OB2A 1AKYA 1EWQA 4JLDA 2FSHA 3RLFA 2G88A 2A78A 3IEUA 4LJYA 2NOAA 4FW9A 3K09A 1E9FA 1R0ZA 2Z83A 2NO0A 4CYMA 2WJIA 3HU2A 6Q21A 1KDRA 3TSWA 1U81A 5B30A 5KNCA 1ZD8A 1NF3A 1CR4A 4TL6A 2AFHE 2DBYA 4OQLA 1NJFA 5KUTA 1EFCA 4A8JC 2VP2A 1KO4A 4HB0A 1J7KA 3LH5A 1ZAKA 1VYTA 1W5SA 2A30A 3EZ9A 2P0EA 4CF7A 4F4CA 2VO1A 1MOZA 2O8FB 2GF0A 1JJVA 1TEXA 4EQ6A 2KBFA 3A1TA 4Q7KA 4Z8XA 4PZZA 1RRCA 2O0JA 1W36B 4O3MA 1KK0A 2IUUA 3TUZC 4GL2A 2DPXA 4DLWA 5KO2A 4KYUA 4LHXA 1DAIA 3DM9B 2VBCA 1G3RA 4LWZA 3UG7A 5JWRA 1XJQA 4BPBA 2VP6A 5JCPA 2OFWA 1TUIA 4NDZA 1SVSA 4HLCA 3AVWA 3TVTA 2F9LA 3Q7QA 2DCUA 3THXB 2W6ID 4Q4AA 4Q1EA 2MSCB 1SVMA 4JKYA 521PA 2R6GA 1NSFA 4IOKA 2IYSA 2J45A 1IAQA 1DADA 4HYYA 1E1QD 2CCJA 1ZNWA 2CLCX 2ODNA 1SZPA 2A7QA 1K5DA 1TX4B 5KPDA 1P61B 4US1R 4MKHA 2ZU0C 2O8BA 4HEJA 4ASUA 2CCKA 2BDTA 1OXVA 1YZKA 4MGYR 5JRZA 2YZ2A 4KAXA 4FCVA 2VSOA 4NE2A 3TW8B 3SHFA 1D6JA 3EZ7A 3ZVRA 4QBHA 4AKGA 4WOPA 4TTQA 4ZDIA 2FSGA 3TQFA 1FTSA 2R62A 4LPKA 4EPWA 2ZRDA 3GJ6A 4KODA 5F2EA 5ANRB 5FTJA 3NC0C 1UM8A 4MUAA 2DFTA 1YHNA 2KBEA 1DO2A 1QHSA 4I1SA 3TAUA 1DG1G 3A1WA 3LD9A 3BFKA 5E7MA 1BS1A 4OHWA 1WE2A 1ZUIA 1TMKA 3QPVA 4C30A 2ZIAA 4Z1MD 2O8DB 3K0EA 2QMUA 2C9CA 3NDBB 3MJRA 1T3SA 4AI6A 4UQOA 3TSOA 4PQRA 1G6HA 1A82A 1LNZA 3BJIC 4BECA 2ZYTX 2AHOA 4RZXA 2EFHB 4B32A 1EWRA 2GKSA 1NN0A 1U2RA 2OFXA 4BRWA 5EZ5A 1ZYUA 5FR2A 4TYYA 3NWJA 5FPYA 4AD8A 3DOEA 4CEHB 5C2JB 3PEVA 1HT1E 4Q4AB 1CU1A 3R7WB 2ZREA 5AUNB 1G3UA 4LJ4A 2J87A 2VA8A 4YQFA 2V1XA 4JLNA 1W0JD 3GMTA 4ZPXA 2X19A 1X8KA 1JR3E 3BD9A 3F3YA 4FD2A 4V0MA 5LBIA 3WNCA 4EJSB 3S1AA 3I62A 4HAVA 4QBFA 4BEBA 1R5BA 3A6PC 1JR3A 5AR1A 3U44B 4Q4LA 3PEYA 1T0HB 2FSIA 5TMPA 1OPXA 2GWHA 1XTKA 4LYJA 3REGA 1MRSA 4AURA 4IOLA 3LDAA 2XJ4A 4GP6A 4AYWA 5JWOA 2I1QA 5FUYA 2RHMA 4XWKA 2UZIR 5C18A 1U0JA 5H8WA 1DELA 5IDVA 1ESMA 3WMEA 2ZANA 3Q7PA 3J81k 2JJ2D 2OUKA 4WXPA 2G1JA 2QROA 3ZZUA 4HUTA 1CR2A 1NBMA 3CO5A 1J99A 3LBNA 1AM4D 4M9SA 4GOXA 4P4SA 4EFMA 1E9DA 2XB4A 4M1YA 4BE7B 4LHYA 2XAUA 1E0KA 3VR5A 1WA5A 1EFHA 4HATA 5JFGA 3HPQA 5JHGB 4JVMA 5F9FA 2Q6TA 4MKGA 1U9IA 1JXMA 4RD4A 3AP1A 2Q9CA 1HURA 3FMIA 4JLOA 2JIZD 3QKSB 2QGNA 3TR5A 1Z0IA 1J70A 1G17A 1W47A 1E2MA 1Z0JA 3V00A 1Z6YA 3MD0A 1Y3AA 3X1DA 4JL6A 4EFLA 3WXMA 4C0SA 4JSYA 1ONBA 2G6BA 4W5WA 2FSFA 1CR1A 1KJYA 4Q5IA 1ZC4A 4HAYA 3NHBA 4K46A 3MAAC 5CYOA 1G8GA 4PPNA 1NIPA 5J47A 2AD1A 2QQEA 2VHTA 2OO7A 5B2ZA 3K0AA 4YMWA 3SE0A 2BBOA 2HCBA 4TT3A 1S4QA 4TLBA 1OIVA 3AV0B 4JLVA 2IC5A 3NC1C 2JAQA 2A3RA 4IHQA 2GZDA 5HE8A 3U60B 1NRJB 1T5IA 1F2UA 1S3GA 4FWIB 2Q3FA 2EQBA 2ZJZA 2BCJQ 4PSAA 1IN6A 1IY2A 3U3MA 3GD7A 1S3SA 4C9BA 3NBFA 4C7OA 1GAJA 2CDNA 4M2LA 2FN4A 3I5XA 3FKSA 4NYMR 3W6NA 1U8YA 1F5NA 1NKTA 3K09C 3ZDQA 3EWAA 3CF0A 4W5HA 2C04A 5JSZA 4GZLA 4G0NA 3GLGE 3AVPA 3KKNA 3R20A 4UJ5A 4DSUA 4Q19A 4Y0AA 2XNDD 3CZPA 1NVWQ 3LXXA 5K8IA 2HXYA 2FFQA 2IUSA 1VCNA 4URUR 2DFNA 4A9AA 1AN0A 1NNEA 2WKRA 4PTLA 5EXTA 1S1MA 4HLQB 1CLUA 3W6OA 3TW4A 2REOA 2B6HA 4NONA 2DR3A 2OFOA 2IA5A 2CJWB 4Q4JB 4FN5A 4ZKDA 1F2TA 3U4QB 4Q7JB 1G6OA 1S0UA 4Q48A 1P9WA 3X1XA 4A0GA 5EXXA 4PZYA 1R5OA 3R8FA 1KHTA 2A5GA 5F9HA 1DAFA 5AWFC 1G5RA 5M04A 1KYIA 1DARA 2IYXA 2ZRJA 4YLGA 4QHSA 4R2IA 4MRSA 1ZINA 3LFUA 2QP3A 4Q00A 4YC7A 2VIIA 4FCTA 1X6VA 2J7PD 1TF7A 5DE3A 4XOIA 3W34A 5JEDA 5KDOA 1BYUA 2X2EA 4LHWA 5AJZA 4IVRA 2B8TA 3N2EA 4EIWA 2GXQA 4XTRA 3ZGXA 2Q9BA 2KJQA 2YWGA 3PXGA 1NMZA 5GJVC 4HAZA 1Q1EA 5JLJA 1E2KA 3RRMA 2QMHA 2WKQA 5LB2A 3AKEA 1XPUA 4YXWA 2YWEA 1OXXK 2WMNB 3NKVA 1KO5A 2NZJA 4TLAA 2ZE5A 3B1YA 3WP0A 3NBXX 2FPMA 1P9RA 1WRBA 1T4GA 3EA5A 3L2OB 3G0HA 2GK7A 2JLZA 4A2WA 1OFTA 1XEWY 2FDCA 3BC1A 4TMXA 4HZUA 2E1RA 1HYQA 1JQJC 821PA 1GWNA 3LXRA 2RGDA 2ZS9A 4DEYA 4BLTA 1DE0A 3C7KA 1L2TA 4IDHA 1Z6GA 4MH0R 1ZC3A 3D6TB 2IYWA 3CF6R 4R9UC 3K70B 1LFDB 1SKYB 1P6XA 3H0KA 1XZPA 5E3HA 4EUNA 2CHGA 4R2HA 3QF4A 1E0JA 2PT7A 3U4QA 3SQXA 4DLSA 1GILA 2OM2A 3UANA 4DCVA 221PA 1E32A 5G3YA 1XEXA 1G7SA 1BYIA 2HCJB 2WIAA 3ADDA 2FPLA 2CE7A 1OH6A 4BFYA 1KO1A 3ZD7A 4LV5B 5G41A 1LF0A 2XTZA 4UNPA 2WV9A 5CM8B 4LI0A 5FOSA 4DT1B 3BOSA 4NBSA 5UKDA 3U7FB 1OT3A 3KUCA 3A37A 5HZKA 4MYCA 4JJKA 3TNFA 2G3YA 4F38A 3EC2A 3EC1A 4CIDA 2C9OA 3A1VA 2PZFA 4JJZA 1OE0A 4OHZA 2QP4A 1P72A 2ZU6A 1G4UR 3B2EA 2WAXA 2GCNA 2CL6X 3SZRA 2IW3A 3KFXA 4DLXA 5L3SB 1E4VA 4B3FX 2EFDB 3H84A 4TSFD 1DBSA 3GLHE 1NIJA 4X8HA 3AM1A 1EXMA 3ZVNA 1YR6A 4O2RA 3VAAA 3TGPA 4XSHA 4W5JA 4TYWA 3OIYA 1D8TA 4XTCS 4ASUD 4JL8A 1BO6A 1KMHA 4TN1A 1OKKA 1OSNA 3BBPA 4GOKA 1DVRA 2V55B 4E07A 2WKPA 3GJ0A 3LLUA 4NYJR 2REXB 5J40A 2IWHA 4B3CA 4B73A 3KQUA 2G77B 1HE1C 2G0TA 3KKQA 4LSGA 2VHJA 2WWXA 4B3GA 3B5JA 4JYCA 5AJYA 1IN8A 1NKSA 2IYUA 3GJ7A 4KLZA 3WHLA 2F3RA 1YR7A 3OFNA 5A0FA 1AQYA 3T5DA 1E0AA 3EZ2A 4PPGA 3KQLA 4WZ6A 3DO6A 2GZAA 3I1FA 3UMFA 1II8B 2FG5A 2D74A 3GFOA 3KXKA 2REBA 3OEHD 5L3VA 5C4GB 1VTKA 1PZNA 1T3HA 2YC4C 3Q9LA 1NLYA 2WSMA 3GP8A 4QC2A 1DOAA 2NO1A 1T6NA 2LKDA 4DT1A 4RD3A 1S8FA 4U7DA 4RZ2A 2IYYA 4Q4HA 1COWA 4BFSA 2GAOA 1LV7A 4RVCA 2JLWA 1HTWA 1KO8A 1RYHA 2F1JA 3CZQA 2H17A 3QEJA 2OLKA 3AF2A 1W0KA 1ZD1A 5G53C 1T9HA 4O2LA 2G0NA 2WICA 1XTRA 1R2QA 4V0OA 4M8NE 1D2NA 1HY3A 3K9HA 1G8YA 3HWSA 4D0LB 1ZP6A 2NMVA 4G1UC 5EP4A 2QSZA 3RVBA 1PJRA 4JYBA 1KAGA 1T8UA 1NJGA 3T1OA 1XD2A 2OAQ1 4IEIA 5SZHB 4XIGS 1XZQA 4D81A 3C14C 5TY0A 1Z07A 4QOSA 1G3QA 3HU3A 5BW8A 1LVGA 2ZI7A 1HA3A 4I1VA 4XSGA 2O8FA 2W2TA 2BBWA 1E2PA 3P20A 3SHWA 5KU1A 2QRNA 3B82A 1SHKA 4UXHA 3ZVMA 4DC9A 4N1AA 1GIAA 2JLVA 2QEQA 4Q1CA 2WWGA 4KXFB 4PR0A 1G1MA 4LHVA 2HYIC 3DMDA 3L0OA 2A5YB 2CMKA 1IBRA 3BRWD 3EIHA 5LPNA 1R0WA 2XNSA 3QF4B 3B1XA 1C4OA 4CRWB 1A1VA 4RD1A 4BZXA 2WJHA 3X1YA 3B1ZA 5IF9A 3PIRA 4LZZA 4LC1A 2O0KA 5CJ2A 1Z83A 5DYGA 4BZQA 3RNLA 4OQFA 1NVXQ 3SC3A 4I81A 1DAMA 3QQ5A 3CRVA 2OAP1 3SYKA 3CUEF 3L8ZA 1GSIA 2BCGY 3SJAA 1N5IA 4IDPA 4RD6A 3RANA 5J5CA 3ZQJA 2ZJBA 4LYAA 2O5VA 2HJVA 1T5LA 2RH5A 5CJPA 2FJUA 4M1MA 3TH5A 4TTPA 3NDPA 1DAHA 1XEFA 1XDBA 2FU5C 1ZNXA 1GM5A 2IXEA 2ZYWX 3QG1A 4M22A 2WJJA 2IK8A 1P60A 4JL5A 4DLTA 2QGZA 5CITA 2XSZA 4LBVA 3THWA 1E0SA 4PO1A 3KTAA 1GL9B 1Z47A 2F1RA 3MWJA 4TWZA 3DKPA 3QVVA 4KVAA 4D4MA 1BKDR 5EP1A 4TYPA 3B1VA 1KKLA 1W0JA 1ZM4A 3C5HA 3AVXA 4DZZA 1Z5ZA 3QPUA 2Q9AA 4RZ3A 1FQJA 2JEOA 3CF2A 3KTAB 3R7WA 4B2IA 1FP6A 5FPSA 2FA9A 4OQNA 2Q0HA 1E9EA 1AZSC 3L0PA 4B74A 4P31A 4DCSA 4AWXA 2DFKB 2IBMA 2F55A 2QTFA 4M0LA 2BEKA 3I72A 2QBYA 4OYHA 4MYTA 2YYZA 4PFSA 3DMNA 4BZPA 4UXIA 4F4JA 2KSQA 2F1IA 3MWYW 2V3CC 1IXSB 2BHRA 2VEDA 3EWSA 1JAIA 3U3OA 1V43A 4BASA 4P3YA 1R4AA 1ZM2A 3KUDA 1ZCBA 2ZI4A 1IJEA 1NVVQ 2QT0A 1Z22A 1N6LA 1C1YA 5D3MA 4HAXA 5DHAA 2ZITA 1QHHB 4CW7A 4JVSB 2VP5A 4GP7A 3PEWA 4E09A 3IIMA 1ETUA 3GJ5A 3QUSA 3ZS9A 1WBDA 4NZYA 1R5NA 2W6IA 1U90A 4XVRA 2D06A 1N6RA 1HEIA 3CWZA 4KJZA 2AX4A 3T1TA 2WOJA 2NGRA 4EPRA 2PX0A 2IHYA 1CJKC 4DLUA 1D9XA 4B2LA 5F98A 2X2FA 3OIWA 3Q3JB 3BAFA 3AGPA 1S96A 4EDHA 1Z3IX 2E9SA 4YDSA 3IIJA 3IKJA 3AVUA 4RFSB 1NP6A 1D9ZA 2E87A 2EFGA 4JVLA 4YDHB 3SI7A 4U00A 1II9A 2ZRNA 3F5FA 1IXZA 4JVNA 5EP3A 3ZIAD 4RY2A 3C15C 3THXA 2JLQA 1KKMA 1Z28A 1AS0A 1R0XA 4TMWA 4C0JA 3JZAA 3DEFA 4TYQA 3A4NA 3FPAA 3U7HB 3UXMA 1YKSA 2WWIA 2CK3D 3OE7A 4FMDF 1RRGA 3GFPA 1AS2A 4AIIA 1QHXA 1Q12A 2QP9X 4A0FA 4Z1MA 3LW8A 4OK3A 1A2KC 1N5LA 2QBYB 3GJXC 1GTVA 4OI0A 2FH5B 3IDQA 1NMYA 1TAGA 2C99A 1GL6A 1HT2E 2ZQ5A 4RKFA 3G5UA 1LW7A 3GQBA 5J4YA 2O8CB 2OCPA 2Q3HA 3U6KA 4HUQA 3PG5A 3QKRB 1HE8B 4RD0A 5FPKA 3U44A 2ZSAA 5JJIA 3SU8A 3JVVA 2NG1A 4U02A 3PCRB 4FXPA 5FL3A 1YVDA 4TZ6A 1XFAA 1KI2A 5JSZB 3IO5A 2J5XA 4V0KA 1IONA 4DSNA 1P4SA 2FZLA 3LQQA 4OHVA 5FUXA 1TTTA 1E69A 1KI3A 1WF3A 3NIBA 3WRXC 4V0NA 3QG5A 4L8GA 1WXQA 2P65A 3BXZA 1NG1A 4FMBB 4A0HA 2ZRFA 1TF5A 3L0IB 2J59A 3CH5A 4NYIR 1Q57A 4B35A 4ON9A 4Z51A 1VMAA 1ZUNB 3VNVA 1FX0B 1Q0UA 3GEEA 3K9NA 3GEHA 1UEIA 1V5WA 2LWIA 2RHDA 2DWOA 2RGXA 2V7QD 4KSBA 1XCGB 4JMPA 2ZXUA 5DN6A 1Q1QA 2Z0MA 4QNRA 5TARA 5FPHA 2HJGA 3BB1A 4ILEA 2ZVPX 1ZBDA 3CR8A 3CPEA 1U0HC 2C78A 2TMKA 4L9WA 1SVIA 4XD7D 3TQCA 2J7PA 3P27A 1XTQA 5KHOC 3RS7A 3AVOA 4M9ZA 4Q4JA 3OAAD 1F2TB 4ESVA 1YZGA 1W2GA 4URXR 1MH1A 2WWFA 3RHFA 1G18A 2B7CA 2XX3A 1TADA 3LBIA 3VR6A 3VFDA 4DUGA 1OKKD 1XCPA 4Z8YA 1VECA 1ZCAA 5EE0A 2G9NA 1K8RA 3MUFA 3QVUA 4RKEA 5FL7D 2IS2A 2J9RA 2GHIA 1KK3A 2GA8A 1AIPA 2JATA 2O8BB 1Z2AA 2WOOA 2D3WA 2JLRA 3N5CA 4L16A 4S2EA 2P6UA 2X77A 4PAOA 5DH9A 3CBQA 1AS3A 2YVUA 3BH7A 1T91A 3PUYA 2BC9A 2H92A 1GVNB 4MUBA 4TL8A 1TNDA 3RC3A 421PA 3W3AA 1H8EA 3THWB 4LBWA 3GLIB 1A5TA 3IUYA 4F4IA 2O8EB 2H57A 3CRQA 1XMJA 3KL4A 2H7VA 2PEYA 3U5ZB 2P67A 2P5SA 1OLOA 1YE8A 2NTYC 2SHKA 4JKIA 4AC9A 3VNUA 1XXHE 1E2FA 2QM7A 1U98A 2R8RA 1JI0A 3BGWA 4PC7A 2XB2A 4Q21A 4EQ6B 1T0JB 2I1VB 2R9VA 3DDCA 5CIWA 3WBKA 5DLQC 4ARZB 2A5FA 1W0KD 2BV3A 4NCJA 2QE7A 2NPFA 1QVRA 1G4AE 5CYPA 3ND8A 5AK0A 3ZZ0A 3AVVA 1W49A 1OIWA 3HYRA 2FPKA 2UKDA 2ONJA 2NO7A 3WP1B 5LD2C 3O8BA 1XD8A 2ODWA 2OBMA 2EVWX 2V9PA 2N46A 3REFA 4FCWA 3ZVLA 1UKEA 1W2HA 3OESA 5SZKB 3E2IA 1JBKA 3GJ3A 5FBWB 3U3JA 2QNRA 3MWLA 5EUQB 3VKGA 2JJ2A 1SVOA 3OZXA 4C4PA 4A0RA 1UJ2A 1X8LA 2PCJA 1F2UB 1JPNA 2ZJOA 4KI0A 3QXSA 3A8TA 2YWFA 4DBLC 3OEED 1IQPA 1US8A 3RWMB 2VPPA 4HUQB 2XZOA 2CL0X 2DB3A 1GKUB 3EAQA 1UKVY 4IDOA 5KOYA 4Q9IA 4GOJA 4NL4H 3VU9B 4HDOB 1W7AA 3QPWA 2OILA 3I5YA 4PHGA 1AGPA 5AUPB 3C4JA 3UG6A 1R8SA 4P4SB 5L3QA 4OHXA 3H1TA 4JLJA 1GOTA 1E2HA 1VPLA 3K70C 2QPAA 4CDGA 4GT1A 3BERA 2JIZA 4QJ5A 2GZHA 3KXLA 1QG2A 3QXJA 1KSGA 3WMGA 2GILA 3CB4A 4KVGA 4DHEA 1L4UA 4M1KA 1J8YF 5FR1A 4BFXA 4M21A 2PL3A 3BFXA 3PUVA 4DEXA 3EIQA 4Q66C 1E9RA 4ACBA 1PLKA 5BN3A
chains in the Genus database with same CATH superfamily
1X70A 2WUVA 4Y0VA 4ONEA 1G291 3ND9A 3PIDA 3B20A 3ZG6A 4MRNA 4HVLA 4LOKA 1DAGA 1R7RA 1MVNA 3B38A 4A26A 3EXHB 3PXAA 2CNBA 2X7XA 4YJ3B 5KYUB 4X62B 1XRJA 5ALPA 4W5RA 5IC6A 4AAYA 5BWBA 3F6SA 2OENG 3EVNA 4M4SA 5C8YB 4AJJA 5AKGA 3U19A 3TLMA 2ZCVA 1O0BA 3CEPB 3RD5A 1A5AB 1G55A 3AB3A 2EP5A 1LPAB 2DPHA 1EFDN 2GBIA 1KK2A 2P6OA 2PA0A 3R6GA 4JR0A 5DCLA 5EGNA 5SY4A 4EY3A 3PTZA 4G1BA 5SICE 4MWGA 3ZWQA 3VSDA 2COKA 2XD4A 1X2EA 2W42A 2AH5A 1XQWA 3G59A 2A6PA 4EG1A 2Y93A 1LY1A 2QN6A 2Y71A 4M1WA 5EJ6A 1JSZA 2P7IA 2QJFA 2NSLA 4K88A 3PNMA 1RNLA 3PRJA 5EHQA 3GOHA 3G2MA 4LOJA 3A2MA 4H77A 3UWMA 5CVTA 2JGDB 4P54A 3TSCA 4KMSA 1OY1A 2PXCA 3JPWA 3KU1A 5FOXA 4C89A 1BHJA 2OHIA 2F7SA 3D4LA 3PVCA 1TVCA 1TUBB 2PJDA 2WMOB 2ZSDA 3QTBA 3MOIA 1IY1A 2X4DA 4I1UA 4ZZ2A 3WLNA 1NKVA 2JGJA 1DJNA 1G59A 1E1RA 3HADA 1N6PA 3M6IA 2X4LA 5GY7A 3VJLA 1WUTA 3K53A 3ICVA 5ILQA 1Z8FA 4X60A 1JLMA 1Z39A 4RTSA 2ZRIA 3PC3A 1UMDB 1MRNA 4QPNA 3RUDA 4KQCA 5JRJA 2VWHA 3EEFA 1QAOA 1AT1A 1N9GA 1U0EA 3LX6A 5B1DA 1X0VA 4C3OB 3QLEA 2EC5A 3F7NA 3Q72A 4A82A 3JU3A 1E5VA 5KTKA 1NPDA 1F5SA 1QIGA 2H5EA 4IWYA 4WZAB 4FB4A 4HQKA 4LY0A 5TPZD 3KEGA 3ZH2A 4LKRA 4TV9B 1XVAA 4RK6A 1UJCA 3GFRA 4RK7A 5C8XA 4RMIA 4IGFA 1QLHA 3MB8A 3JPYA 3KYDB 3R8XA 1P18A 1YU6A 2HZBA 1A7KA 4FI3F 4LJAA 1MIOB 2CNDA 2GVZC 4YCDA 3PQ8A 3NVMB 4EA8A 3KB2A 4X3OA 3UK0A 4E5KA 9MHTA 2JZCA 5CA1F 5JCZA 3THOA 3LUHA 3LQ2A 5K3DA 4KDRA 3WRXA 5JW6A 3INTA 4KNVA 5DHUA 3UKDA 2WF9A 3AR6A 4MDEA 1SKQA 2N42A 3DE6X 1PJAA 1QS0B 1TTHA 2BFDA 2W8BB 4HWKA 1E9SA 2HWUA 3DCIA 1JX6A 3W79A 4YRIA 2QX4A 1OZ0A 4XIJA 2G04A 4D43A 4PLTA 5G1OA 1RSZA 4RD2A 4ZCPA 2Z43A 4PEVA 2O7VA 2VOJA 3FMGA 4CQMA 3FHTA 1M6HA 2M32A 1Z18A 1HZJA 5I4IA 5LP1A 2R5FA 4N39A 1TZKA 1CF4A 4RXUA 2GNAA 4N3AA 4HV4A 1JU9A 5JAOA 5AKZA 1SCBA 4ABTA 5AH0A 4HWPA 1NFQA 2EGUA 2IY7A 1BMQA 5EZYA 3GPLA 2A9JA 2QVYX 4GMXA 4I66A 4IDQA 1FDSA 3DMTA 3SS9X 3UMRA 2P6NA 3H1FA 5EIOA 4V1CB 1V9CA 1A2OA 3EC7A 1F20A 4PGAA 1MCZA 1LFAA 2GAIA 4J8PA 4MA4A 4MWSA 1KOLA 1DT5A 1JKMA 3RBZA 1YULA 3GGDA 1U8ZA 3L7KA 2EKZA 1A9XA 2ERCA 1I7LA 3EA0A 4MA0A 4L6CA 2AOWA 4IYJA 5AJTA 1GO2A 2AZMA 3PQ2A 2OO3A 4OGGA 4QT0A 2CE2X 1JNXX 3DVQX 1QLWA 3HO8A 4JLAA 1L8AA 1PZHA 4C0BA 1TRKA 1X86B 3KTFA 5ICGA 5HGJA 3CA8A 3GAZA 3N70A 1LJLA 4JX8A 1YH3A 4N0EA 5KTTA 3C6KA 4ZRDA 4BJHB 4HNTA 3DHVA 2QUHA 3IAEA 4M9CA 4FLMA 4LZNA 2I65A 4A92A 4EB6A 3TF5A 3MWEA 3DT8A 3PZBA 1AGXA 3R44A 1KMIY 4PX2A 5L6LB 4OF4A 2CXRA 5ES3A 5B3JA 1B16A 2ORWA 2RMKA 4HJXA 4LRWA 4A6PA 4WA7A 2CVPA 3LVRE 1I5OA 5JCOA 3BSSA 3CH6A 3L0BA 4PRKA 1UXHA 4RF3A 3GZTB 2GK6A 3KE8A 4WCVA 1IPFA 4ZAZA 1K88A 5KNDH 5WRFA 4PZ0A 1NC3A 4CCYA 1IN4A 1H66A 4CR8A 2IHNA 1M83A 1XZEA 1IEQA 2VRWA 3IMCA 4KITB 1WTCA 2DWQA 2RGCA 1ODKA 2BGNA 2RHLA 4L5BA 3OY2A 3CC8A 4O4JF 1LTQA 2V5AA 2ZJ6A 3BMXA 4AECA 2ZB8A 2Y1LA 5H81A 1US8B 5DXJA 4E22A 3I39X 4CVNA 2DP4E 1YZYA 4MKRA 2W6NA 1L5LA 3AHDA 3H2BA 1JFVA 3JD0A 4GMFA 4F3TA 4QASA 4BQRA 5L53A 4RDHA 3WQBA 4E12A 3QKWA 2JCYA 4FZRA 2JIOA 4JITA 1QKKA 2WAMA 4EUHA 5MGBA 4G65A 3K1YA 3OLVA 2MSEB 3QYFA 4EG3A 3ETCA 3SWWA 2GJKA 3M82A 5BPHA 4GWLA 1ULHA 4B6FA 2VAPA 1CY6A 2PWYA 2Q3MA 1J0CA 3RH0A 4ENPA 3CJTA 3JD4A 4ZCMA 4QTYA 1CIVA 1FSPA 2ZBEA 3GWZA 4IQFA 3A9WA 4R1SA 5TPWB 4DABA 3AIIA 3Q3CA 1DIHA 4K26A 3VMFA 5HCIA 4A2CA 4DAEA 2PH1A 1UJNA 4DBLE 2JJMA 3BXFA 3K0FB 3P2YA 1FMFA 2VZ8A 1UOOA 4WNAA 5JWHA 3I6ZA 5JAQA 1C9MA 3NR2A 3G6WA 2CXUA 4Q1AA 5DMXA 1WETA 3V7FA 3GZJA 4AL4A 1T3TA 4XUDA 4QM7A 1O58A 3LPDA 4C7OB 3C7DB 2QJOA 1WKCA 3MFQA 5C7IO 1DU4A 4UOZA 4EO9A 4G5SA 6AT1A 3S4YA 2QNIA 3FI0A 1W52X 2QHXA 3IP6A 3K15A 4J94A 5IXSA 4QBIA 5IVIA 1AX9A 3L79A 3EG9A 4MHSA 3UWPA 4JYAB 4K9QA 1C41A 1YQGA 2PFGA 4L9SA 2W70A 3L6UA 2XZTA 2H2AA 3QFFA 4JB0A 4JLMA 1MT3A 2VHWA 3PUJA 3PT9A 4JVOA 5BSRA 3IPYA 1Z5PA 2ZWIA 3LQRA 1XJ5A 4NULA 1TO1E 4PWZA 1KFJB 5CNKA 5D7BA 5P21A 3JYOA 1KE1A 3OQVA 1XRSB 5BXQC 2ZWVA 2BHSA 5CFNA 1PT7A 4LTNA 3VR4D 4DUZB 3QYAA 4TZKA 4M0MA 3DF7A 1QF7A 1XA4A 5LC1A 3A1SA 1E6EA 1ULUA 2YWHA 3TMKA 4UBKA 2V4UA 1JDJA 4P98A 1VSUA 3BB4A 1RZRD 3G88A 1AU9A 5I8WA 3W4JA 4DXAA 3GLFE 4QYIA 3CUYA 4GLBA 3AP2A 4P4GA 2D5AA 2R6AA 1ZISA 5CYFA 5TJHA 4S35A 3AWIA 1PS8A 1C9KA 2R0QC 3D5TA 4BJ5A 4XRRA 4KIWA 2GCOA 4J1TC 4MR9B 1EFUA 3AI7A 3W5JA 2A1UA 4YP0A 1UH5A 4BKMA 2L0XA 2VHEA 1M8FA 2CL7X 4LRSB 3ZHZA 3RYTC 2QLJA 5D85A 1KERA 4GZ6A 4R31A 2HHHB 2O06A 3H2HA 2SECE 1JIVA 3G2IA 4MLPA 4IDNA 2ZR9A 4HDNA 4QUJA 3P9CA 1P9OA 2XXBA 3R2JA 1ZJZA 4IJ6A 2VTVA 4BMDA 5MDHA 3FR8A 3IUPA 3OCUA 2ZJAA 2QG9A 4L8LA 4V03A 5IUKC 5CFPA 1KQPA 3ZXUB 3QBDA 4AG5A 3ZUGA 3JYNA 1GKIA 1PCXA 3R0QA 3HNOA 3ISVA 1M2NA 5JSUA 1CF2O 2P7HA 5KTYA 4XGRA 5FI1B 3LKZA 1GU1A 1AC5A 2PK3A 5JJLA 4GYJA 1L7MA 1N7HA 5EE1A 5F9MA 1W5AA 4MI9A 5AM4A 4KEAA 1QHHA 2AKAB 4AJ1A 1TJPB 1TGVA 4ZVUA 3H9UA 1U0RA 3SY8A 1K6XA 2YZ7A 2XUAA 3JZMA 1XU7A 3CB2A 4JK3A 3SMQA 1QU2A 4GDFA 5JI3E 3BT7A 4DCOA 2B4RO 2CBZA 3JVUA 3ICEA 2GLUA 1X1BA 2ZVQX 4B4DA 1CNMA 4QDZA 3AEQB 4ZEWA 2NXWA 1MVLA 2W2NA 2VN8A 4V02A 4DUGD 1OFVA 3FYUB 4EFDA 1Q91A 1TJNA 2BEUB 2ZSHA 4RHCA 5CDGA 1WCIA 4QARA 1G19A 2PS3A 2RAFA 3VRHA 4C0HA 3TLBA 1E7MA 1Q1BA 3KM0A 1SXPA 3UFXA 5FBQB 4KXYA 4WVFA 4MKIA 3EUEA 3AYXB 1CZOA 1JFLA 3U37A 3V8VA 5K8UA 3N0TA 4DQ0A 2CLDX 3JZIA 2CZCA 3R6WA 1GG5A 1P2TA 1S8AA 1XDZA 4FCCA 5LDDC 4QVKA 4ZI5A 3DBLB 5IT9A 3A9SA 4GSYA 4OD0A 4QRHA 2BJVA 3DMYA 3FSGD 2C07A 4U6NA 4U7TB 4Y6GB 1ZU4A 3L05A 4PYRA 3OM8A 1C7RA 4S0ZA 1UWVA 2PU7A 2FGKA 5H0IA 5BSKA 5KQPA 2IYLD 2O1XA 3EULA 1MJNA 2F00A 2P35A 3PDIA 1UBFA 4CG1A 4ZYTA 3AKDA 2H4FA 2QLNA 3AYZB 1O9GA 2H5LA 4YV1A 1OYWA 3MJCA 2J4CA 3D6FA 3RSZA 3GLGA 1D1PA 1K6EA 2ZRLA 4G4JA 1E64A 5FLXA 1B1AA 2P9GA 1Q2UA 2A33A 1GXSA 1YL6A 2AZTA 4YAEA 5KWJA 4R83A 4Y9SA 1NGSA 1L9KA 2DYKA 3M4YA 3N2KA 4IH4A 5AUOB 4NPCA 2F9MA 3P9NA 2NACA 3EQ2A 4I99A 4U3JA 4RVFA 1ZEJA 3UBTA 4UE2A 3WK4A 1EVQA 1EFVA 1QPBA 1Y80A 1IJBA 1EZZA 1S2GA 4MTCA 4K03A 4C43A 2EJWA 4M8KA 2VHUA 3D31A 4XWAA 3IBGA 3CX8A 1BMFA 2FNAA 1GFZA 4FE3A 4QXPA 3WB1A 2XZDA 5AJHA 1J5XA 3GRYA 4JC0A 4KO4S 4DR6B 4MV3A 4CV0A 4PTYA 2AV6A 3C24A 4U0JA 5BOSB 3K70D 1O97C 5JS8A 2XTNA 3ZQKA 3KD2A 2I54A 4H9GA 4UXJA 3S2GA 2AQIA 3D81A 4GH5A 4BNNA 1DXHA 3GVHA 4HEA1 4W9NA 1UAYA 2B0JA 1ZNZA 2Q0QA 3JASA 1E63A 4J0KA 4TUYB 4RTLA 3BK7A 2O2YA 3NI2A 5CB6A 2LRHA 4FMDB 3LS2A 5ADUS 1JECA 1Z4IA 4FTWA 2QG4A 1QYWA 1PWXA 2GJAA 5D3ZA 4CR7A 2P2LA 5B3JC 3M33A 2AJDA 2J9GA 4FYXA 5IC5A 4QAJA 4R6WA 2XCUA 5GONF 1KP2A 1DOHA 5JY1A 2IELA 4M83A 4KLNA 4WEOA 3KQQA 3FMPB 2G0AA 3K4HA 2CZQA 2FVYA 1L5VA 1IPEA 3L7IA 3RJTA 4DV6B 1MJ5A 4QUDA 1RE0A 3K4QA 1JHMA 4IIXA 3TGWA 3AHHA 3DEIA 4IJVA 3UXEA 3WYAA 5BOVA 1SBQA 3WKBA 5LLDA 2NP7A 1C4WA 5EWMB 3RT1A 2Z6VA 1C0PA 3X1ZA 4XFKA 4XIIA 3H5LA 1SR8A 3AV3A 3WL7A 1JT2A 2I3DA 3FMOB 4MQEA 3R5JA 2QN7A 5K01A 5K0SA 3OLYA 1ENPA 1GFWA 4RVDA 4DJTA 1PP4A 3WIVA 2VZEA 1EWVA 5F64A 3CLRD 4WKOA 3K5PA 3HJGA 5LQSA 1FK8A 2DQ4A 2ETVA 3FNHA 3KQTA 1WBBA 5DK4A 1TJ3A 1HDEA 2A1UB 1JAHA 4I9FA 3VSEA 3K20A 1UMBB 2H11A 3WIDA 2X5OA 4M3NA 4EMSA 4IG4A 2Q0XA 3P9SA 2BFNA 4E5YA 2ROQA 3EZ6A 1YQQA 3PLRA 5CU7A 2IXTA 1AF4A 4EW1A 1RAEA 5BN5A 5JH7A 1OB5A 3MBOA 1CSEE 3QKUA 2D7JA 2EKDA 3RHTA 2XUHA 3OKPA 3CZRA 1FNSA 1PFQA 3BJMA 5GVSA 3ZWCA 4PNEA 3ZYZA 1JQ5A 4OSOA 4G97A 3KKKA 2QTVA 1JEDA 2XDQB 3EMDA 3VTZA 3QSYA 3RR2A 4JI4B 4JR2A 2VOEA 3IMGA 5E3IA 3TZEA 1P3JA 4BRSA 4EVIA 3OP1A 3PXUA 4BJ6A 1RLOA 3A32A 4XH9B 1YS9A 5JXGA 1J20A 2ACVA 1V2GA 1Y8RB 4FGKA 5E8JA 3O1HB 4QBKA 2R6FA 3HJRA 3Q0TA 3HB5X 4UNNA 2CF6A 1EUDA 4Z3OA 1KZGB 3PFIA 5DHFA 1ZKMA 1A9TA 3VHXA 5KX5B 5J59A 1UBOS 2AFIE 3FDFA 1FOEB 3AB7A 3RTCA 2H4ZA 2IFTA 3FDIA 2PWBA 3PYXA 3T3GA 1RRFA 2FR1A 1QK5A 4J4HA 4D3YA 1T6XA 1F2DA 1O6CA 2CJWA 3DVLA 1CJBA 4YP1A 5GADl 5HOEA 4I5EA 4O1IA 3OPQA 3AIMA 3OU2A 3MWFA 3TNDA 1RAGA 4RVHA 4BB5A 2P4HX 2PRZA 2Y3IA 3PGLA 1A4UA 3HN6A 4PGHA 2I55A 1QRTA 4KWTA 2O3TA 2R65A 3I2YX 4B3DA 6NULA 2HF2A 1EX7A 1GL7A 2PMWB 2RFLA 1XNGA 2I4IA 3FTQA 4JBLA 5FTNA 1H8HD 3AUSA 3UIEA 4D02A 3VJKA 3DFZA 4EG5A 4RYDA 4AICA 1KJ9A 2VPQA 2WU0A 4FUTA 4RSHA 5CX4A 3ZE6A 2XCTB 4KN8A 4G5RA 1RHJA 3IMKA 5IVHA 4FNGA 4LMAA 3T35A 4HY3A 5K6TA 2GRUA 2VF8A 2R79A 5LYYA 5KDDA 4P33A 1RAIA 3LIPA 3ZEIA 4ZP1A 1AHNA 4LY6A 4ALLA 4PLHA 3TLCA 1PJBA 1X7ZB 3WLKX 3G79A 4ALMA 5CFLA 1DRJA 4O8ZA 2Q5FA 3P97A 1MB0A 3EXG1 1CJTC 1PYGA 4GPBA 3IJPA 5C5EA 3GPIA 3CT4A 3AUXA 5CX1A 2JLXA 1N6IA 4EFKA 3GPDG 1AUQA 1F0KA 3G5TA 1E1QA 2FSVC 3WX0A 1QR6A 2KM1A 2QD2A 1E59A 2ZPUA 2AWNA 4OMUA 4IY1A 3I9MA 1N5KA 1VYVA 3EXIA 3P4YA 1ZD9A 4FZ5A 3RS2A 2XW6A 4D9HA 5CUQA 2CNWD 1DIAA 2BZGA 4P7FA 1FFAA 3MT9A 5IHPA 4CKBB 4UBIA 1B2LA 2F8TA 4DJFC 5AW4A 5BQ3A 2X1VA 1B23P 1W36C 4TWAA 2FW8A 1P1KA 4TRMA 1CWUA 2WZQA 5AJVB 4LDJA 2KHZA 3CNQS 4CEHA 2G8NA 2PQ2A 3OQMA 4PZEA 3GEMA 3WRYC 1Z68A 4LV6A 2RCNA 1KZYC 3H0EA 2JIBA 3LUAA 2VHXA 4E13A 2BM9A 1IDOA 1JVBA 5DX0A 3WNDA 1SCJA 4AT1A 3LLCA 4WD3A 1JZQA 4A2PA 4QUIA 4Y67A 3PUKA 1I2MA 1UWLA 1YC2A 4ALKA 1UK6A 4OLHA 4YLYA 2Y05A 4ZZ0A 2H1LA 1TCBA 1M2JA 4G6ZA 2YV5A 2Q3EA 3IDAA 4WN9B 4F6RB 1VE1A 4BLSA 1BC5A 1OWNA 1LLUA 3CPSA 3L7YA 3AY3A 3BORA 3H5WA 4FT4A 2KB0A 5HFNA 3GLIE 3RAPR 2B1JA 1YQXA 5DP2A 4XVQA 1ISIA 1X1CA 3LLVA 3D0RA 1II8A 3D3QA 1WAMA 3ILYA 1ULAA 2IEYA 2JJQA 1YOBA 4UU1A 3UOGA 5C81A 2OZLA 5EJFA 2QE7D 2HRQA 4UBJA 2CVQA 5HW0A 3LZ6A 2IHBA 5DOVA 1FFDA 5FHQA 5IVDA 1JEYA 1E2NA 1JIUA 1HSZA 2XI4A 3C70A 3LYLA 2FWIA 1MU0A 3ISTA 4TWJA 4QUKA 3GXOA 1OHHD 4NV0A 5EE5B 3RVNA 4AN1A 4GBJA 1SB9A 1PFVA 4YFVA 3SJBA 4OHMA 4ZRNA 3DXFA 2J7KA 4R98A 5T57A 1KSHA 5E4JA 3AQ4A 4WKPA 3F7MA 3H83A 1ILEA 2PL9A 1YZQA 3OCCA 2E85A 4ER0A 5F2KA 5KNCH 1NNSA 4YR7A 3KTDA 3BF7A 3LUDA 2CWDA 3IE0A 2GPYA 3OEEA 4BWYA 1T1EA 1M2VA 5FPQA 4ZCIA 4JLBA 5B7PA 1O5IA 2PZAA 3B7WA 1I7QB 1P77A 4YY3B 3T38A 2EZTA 3JWEA 4W9NC 4H1UA 2C77A 1PEDA 2XE8A 3AUJB 4L0MA 1E8MA 4XM1A 4WKBA 4X6LA 1SA0A 1A9YA 3HGMA 3NWEA 4WN9A 3W1WA 4F6RA 2J9FA 4RH1A 3KYIB 1ZUHA 3O0DA 2NTJA 2A5DA 4D6XA 1N5OX 3BE4A 3R75A 3UT5A 3Q88A 4BUJA 2IQIA 2ZTUA 2MCFA 5IYZA 3VC1A 3FYDA 2IY8A 3T5TA 5AVXA 2IXDA 2PZKA 2PGJA 1JG4A 1DC8A 3A2LA 1KVUA 1NBAA 1XU9A 3B51X 1D03A 1P91A 3RSFA 3QU9A 2Q2WA 4KK4A 2PXAA 1F8GA 3QJYA 3GDWA 1IEWA 1P4AA 4WIAA 4G5GA 1HRKA 2QN8A 4L78A 1W94A 3OJ0A 3R7FA 4WFIA 3RVRA 4WBNA 2RGRA 4D80A 5LOVA 2XDAA 2IRWA 3C5CA 3R3ZA 4IEFB 4MP3A 3F0TA 5K45A 1C9YA 2FX2A 4D3SA 1HV8A 4QPDA 4E0BA 5I4KA 5T4HA 1HFWA 3MTQA 3R0IA 1KETA 3VKFA 1Y82A 3GIDA 4O4JB 2BBSA 4BWFB 4MJXA 2HA6A 1XNRB 1AKEA 1V7PC 2F6RA 1WCYA 3IA7A 4QL3A 1XAJA 4UPEA 3IQHX 1GPBA 1XTVA 4H7DA 4OY3A 4ZMSA 5ULLA 5CXUA 4UCFA 3EGXB 4K2AA 4LX8A 2VJYA 2MYTA 3DB2A 3LCUA 1GU0A 3JQ8B 6YASA 4ZHQA 1UODA 2IHKA 3V9PA 4MVXA 4G3XA 4DXDA 1QNLA 5FBLB 1JJIA 2QQ0A 2XUJA 4R54A 2XUQA 3BJRA 4MI1A 3FZQA 4C0LA 4L4RA 3PNKA 5D8DA 1XROA 3UCXA 4TT3D 3WOVA 4J91A 3KB6A 2BFBA 3DGFC 4GS5A 3RFCA 4PSDA 1OI4A 3NRCA 2HQBA 3CY6A 4YRKA 5IKEA 2XH8A 1E2GA 3D7MA 4JBYA 4LYEA 1YHZA 2JFFA 5C34B 2QD5A 1NOKA 2QRHA 2YFQA 3BL6A 1E6UA 4W4TA 4AG6A 1P2DA 2OKGA 3ROXA 3PNQA 2PRJA 3RYHA 1ZY2A 2PKRA 2WQZA 3HU5A 4YA6A 7ABPA 2MSDB 2Q28A 3K6JA 4OQEA 2ARKA 4G26A 5DI3B 5EPOA 2NV2B 2B1GA 3GEDA 1RCUA 5FPPA 4ALJA 1KDPA 2ZJ0A 2IUEA 5JSYA 4JLPA 3BH0A 4KFUA 1RPAA 5DVZA 4G5OA 4HWRA 4KXQA 4BFTA 2W2OA 4YAIA 2DPYA 2XTJA 2OWEA 4IH1A 4P3OA 1THGA 3FOAA 4F4UA 1PUJA 5ESRA 4U7HA 3SFVA 4HO1X 2GN9A 1IVSA 5DGXA 2IPMA 4EKYA 1U0LA 3P32A 1MW8X 1FMLA 3PU6A 2NXEA 2JA2A 3KQSA 5M3BA 1G41A 1S5PA 5JDCC 1P2SA 5EEGA 4IVQA 1NVAA 3VR5D 1CIPA 1PW5A 3OQIA 2CCGA 2D2VA 2GETA 3A4YA 3SBOA 4U9HS 3E3LA 4I1IA 3RTGA 3SYMA 4ZJYA 5ICMA 4MQEB 2BAGA 3ZY5A 4DLLA 3QU5A 1OD6A 5EIBD 1W4BA 3C6QA 2P5TB 3G89A 1J06A 1VG1A 4IW3B 4WVLA 2ZWMA 4KFCA 1RQXA 4TMVA 4OKIA 1X7ZA 1VCOA 1DKUA 4P22A 2X7JA 4TV9A 4DSTA 4RGBA 1XVVA 2PTHA 4UCXA 3PA6A 2H9IA 4M7OA 4NCHA 2F3UA 3F6BX 3DV0B 3M1YA 3I8SA 3JQGA 3KYCA 1MF7A 3CKMA 4OJMX 1MC4A 3G8CA 2FMIA 1P45A 1VBNA 1FUKA 3ONDA 1POXA 2B6NA 2FV8A 5KMGB 1D5WA 4WNYA 2WPDA 5K0LA 4B2PA 1CEXA 1XIVA 1SOAA 5EMKA 3V32A 3ONVA 1SXGA 5FT9A 1O97D 4M76B 2V6MA 3SNKA 2FSVA 4MYRA 2Q49A 2IYZA 1IN5A 2FW6A 1D6MA 1ESZA 1MOQA 5L3RA 3PUXA 3OZCA 2JLUA 1E9AA 1W59A 5DIFA 3GRVA 3GV0A 4I6GA 3EXEB 2C2WA 4PYKA 3MCAA 3IHWA 5ENZA 1JG1A 1TYAE 8LDHA 4D26A 2I8AA 1QP0A 1M6VA 1PW7A 1RJ9B 1Z38A 2JFHA 3OX3A 3PNOA 4AY3A 3L82B 3L4BC 3GVPA 3K0HA 5EESA 5EOVA 5IH7A 3GMIA 4CL2A 3EFBA 4RJLA 4FWTA 1WD5A 3D6UA 2UUBB 2E5FA 2HNAA 2AOTB 4N54A 1SXQA 1HYEA 3K31A 3V55A 1HYGA 1FBNA 2NYVA 3OZTA 1Q3TA 1L4YA 1Z2CA 1USWA 1JYEA 2LCQA 4AJ2A 2XV1A 3EGDB 2IF0A 4B7XA 3UPTA 3LG2A 3QE0A 3WRYA 4TWRA 1YNSA 2R4UA 3BE8A 4NFYA 3OZSA 3KQHA 3BIWA 1UFQA 4S1NA 5HE9A 1O87A 3KJHA 2RK6A 4UM8B 2GAAA 5ALZA 4OB6A 1SVWA 1IAVA 1RC1A 3F4BA 3HZOA 5EQTA 4PPQA 3A36A 2HDHA 3ZHTA 2M9MA 3NM4A 1L3CA 3AJRA 4D8VA 1HUQA 5DGHA 2CY0A 5IHXA 1KIFA 3I42A 2VYQA 4NCIA 1H2XA 3CKLA 5AHOA 1ZPDA 4ZVRA 5EHNA 3VNRA 3ZBUA 1YDEA 4OP3A 2WHXA 3GLHA 2XMBA 4HAIA 4CT5A 5LM3A 2D4AA 4G84A 4P4TA 4PX9A 3SVTA 2VJDA 2AVNA 1D2AA 3P9PA 2O7NA 4GX2A 1G4HA 1YVPA 1NASA 2G07A 5FO1A 3GFGA 1VIYA 4HX9A 5FX2A 3FOZA 1JA9A 1KRXA 2QIPA 4MIYA 1SUSA 4WLOA 4JLSA 2D2EA 3QU4A 2C4KA 2J9ZB 2WLTA 2BZSA 4IIJF 1DX9A 2VAWA 1AV7A 3EZGA 4RABA 1D1QA 1UT8A 3IOMA 3ZHUA 4X8OA 3IEMA 2YJ5A 4OK6A 4DGQA 1C3OA 3K1JA 1ATIA 3U16A 3I1IA 3KDAA 5IXYA 5F7XA 2JVKA 3OT1B 4NJEA 1ZMOA 1U7UA 1MX5A 1HOXA 2GYWA 3QXHA 3L0OA 4NEQA 5KYVA 3GDOA 3AKZA 1R50A 3H4IA 5EYPB 5I7EA 1EDOA 1E6CA 4FZJA 4Z4HA 1Z33A 1FEZA 3PLNA 4LXTA 3HLTA 4MEAA 4Q03A 2AZ4A 4IXNA 2C0PA 3CW8X 3R5KA 4NYJQ 2VF7A 1WQ3A 3EAGA 2FEAA 1QVAA 1M76A 1ONOA 3PQDA 1I3CA 5EVCA 5DLEA 4MA5A 5DULA 4EGFA 3QK7A 3CF4G 3FFAA 3TAHA 5IKXA 2HB6A 3VPHA 2BGKA 4Z53A 1JQEA 4P34A 1G20A 1Y5LA 4B7CA 1NVTA 2CMHA 4QULA 3C7AA 2ZG6A 1QQBA 5FP0A 1V9SA 2B3DA 3PXCX 4UMFA 1G7RA 3BTOA 4XPIB 3L7CA 1J8VA 1NVMB 1N7GA 2RARA 2RJ3A 3PKJA 4JOSA 4PC2A 3WYBA 4JIMA 2R86A 2HT1A 2CV2A 4CCAA 4BVHA 2QTGA 3HWWA 4TZ0A 3NKLA 4G24A 1MIHA 1YFKA 2XWQA 2LCFA 3ND6A 5LU9A 5H4GA 3IE1A 3MJTA 4CKCB 1D07A 2H4YA 4BAZA 1MB3A 3GUYA 3OSZA 1T34A 5E0OA 5K3CA 1UXGA 2GTHA 3BH6A 3K2QA 3OFND 4MUNA 5KKCA 1X7XB 5I7WA 1ORTA 1YZLA 2HWWA 3GD5A 2JRCA 1VKJA 3GMSA 1VHWA 3RFFA 3RODA 5K5EA 3RK1A 5ELLA 4FDVA 2V6IA 5DT9A 5CLFA 2CW5A 3N1UA 4PRLA 1TQDA 4KN9S 1VDZA 5TQJA 1FSZA 1SBZA 2R8PA 4KN5A 4F2GA 2WM3A 2ZSBA 2X9QA 3ANYB 1JP7A 3H87A 2OEPA 3AR7A 3Q5EA 3UQZA 1C3OB 2G5TA 4M9QA 2FEOA 1Z6XA 4FHFA 1JILA 2EV9A 4IX9A 2ZJ5A 2FFHA 2XVXA 4QHTA 4RA6B 3WKCA 1G5PA 1QYRA 1XPOA 1Y8RA 4M87A 4HDCA 1KE2A 1FYXA 1HFKA 1VP9A 2Q8PA 3DDSA 3O91A 2HLNA 4OXXA 2HMTA 1GZ6A 3DKVA 2FW0A 4QOGA 3L8FA 1ZI6A 4UVHA 3WY9A 4YMTA 2VPXA 1QGUA 7AT1A 4IFTA 2YYSA 2GN2A 3FZGA 4HPXB 3W6PA 5HUQA 5JNSA 2UUOA 2VP0A 5FKJA 1C4KA 1OZAA 4HNQA 2JK0A 4WDRA 1GPLA 1EVZA 2ZKLA 2MYUA 3UJDA 1XWFA 4PGGA 3RYHB 1NXVA 3UN1A 4JXXA 3K2EA 4D99A 1Z29A 5JISA 2IZ6A 1U3VA 1WZ2A 4A7PA 3KDSE 4CGZA 3JALB 1UC9A 1IJFA 4GOMD 5EUCA 3OWXA 4JEHA 3N2NA 3N6VA 3DOJA 1N36B 1Z34A 1E2LA 4RKRA 1HKUA 5EMLA 4CGYA 5JADA 4DB2A 3M6AA 2NZXA 4JUIA 2O2DA 1U3GA 3B2NA 3HDHA 4LJKA 4Q93A 1BH2A 1MG0A 1SIWA 3H9EO 3KUKA 1QRSA 1BH6A 2QAGC 4V0LA 1G1AA 1T6ZA 1MNAA 1P73A 2XHZA 3KLPX 1NE2A 2OAGA 1GQSA 1V3TA 3PL1A 4NHOA 3ZH9B 4BFVA 4DMMA 4XZ3A 3E82A 5KREA 3P9YA 3LFHA 1JS1X 1UBGA 2X0RA 4MHOA 4EMTA 3O03A 1NUSA 3TTXA 2PPVA 3DZCA 5HKKD 4IHAA 4FFOA 4NNPA 4M1QA 5DM70 4BLQA 4IPTA 3TL3A 4GNKA 3SHVA 4HDMA 1V3QE 4R9NA 4UEQA 4EYQA 2YRFA 3FUCA 4JBHA 1U3UA 3AEXA 1SKMA 2JS7A 5L3SA 2JL1A 2IPOA 3MAJA 4B87A 5A03A 3ASUA 1GGKA 3FDZA 1RTTA 4JQYA 3B78A 3P9IA 4MGIR 3CX6A 4IXMA 4U7GA 3RSCA 4ALIA 1BE0A 4F92B 1CDOA 4N7RA 3GARA 1QE0A 4Y6RA 4MV6A 4XD2A 5DJ5A 3IO3A 1VC2A 4AZSA 3ICWA 4LC9A 2N3ZA 4ZJUA 1QKIA 3AHCA 3I45A 2GM3A 1Z2DA 3OTIA 4GG1A 4REQA 3U4AA 5MF6A 3HKBA 4H35A 4F4HA 4I14A 5C5IA 3OCJA 3H97A 4K6HA 1ID8A 3DQPA 3USZA 1N0IA 4FJ2A 3PEUA 4JP2A 2EKBA 4Z9XA 1HDOA 3ICQB 4B83A 3EPRA 4WXRA 2RAVA 4YH1A 3V4FA 1KI9A 1TCCA 1JQLB 2AB0A 2C31A 4BNZA 2YMQA 5FB3A 4KYTA 3RSLA 1NG9A 3O8LA 1E20A 5EMNA 1T8TA 4O2AA 1XP8A 4YAOA 2B61A 3R76A 1NX6A 1HTBA 3PVSA 5LUAA 3OF5A 4KWCA 3ER6A 4E70A 4ETMA 4YUAA 1T36A 1W5EA 3ZV7A 4ABYA 5L3QB 1PL7A 3B6IA 4NECA 3Q41A 4NBNA 4HS9A 2RONA 3JQFA 4MXDA 4DDUA 3T7AA 4CKEA 4AIRA 4X41A 2CD7A 3CLSC 2ZUVA 3Q6IA 4ZIRB 4MRAA 1OX5A 2JCSA 3EOBI 4NI5A 3THYA 3QKTA 5HMLA 5TGTA 5CDFE 5T8KC 3T9CA 1CZLA 1J25A 3UMVA 4C7VA 1GXSB 1W46A 5ALEA 1W4RA 4U2DA 5I8ZA 3CRNA 1YRAA 4X1KA 3NDRA 4HFJA 2FE4A 2J31A 2H29A 3FFBA 2ONKA 1DS6A 2CYAA 1M2GA 3VZRA 1TMOA 2VFAA 1FTNA 5KX5F 1XN4A 3BPSA 4BRUA 3ESBA 3AL3A 4XI9A 3N87A 3G0CA 3ROGA 4MR7A 5GTDA 2MHCA 2A57A 2YJTD 5FO0A 3BMOB 8OHMA 2I6SA 5IJAA 2GKOA 2D8MA 3QEKA 4E5PA 4JI8B 2IHUA 3UF0A 4EA7A 4H18A 4F5ZA 4RLFA 1D1SA 1VJ1A 3H4MA 2OG2A 3Q5DA 2HU7A 4O2BA 2GUGA 1RYMA 2F43A 1NQ5A 4TSRA 3KB8A 2MINA 4QU9A 4EW6A 5KPJA 3HYNA 3CG0A 2JLBA 4HH4A 5DNVA 4TUYA 3RS0A 2P8SA 3T7DA 5BYKA 5KVSA 5LQJA 1U5BB 5BXYA 1Y6JA 3PYLA 4REQB 2ATEA 4ERNA 4AN0A 2RAPA 3FYUA 2WHYA 3KBBA 5LNK6 1LXCA 4KR3A 4IWXA 1BX0A 2I99A 4RPIA 2NVUA 4A8JA 4D0GA 3LI2A 1OV6A 4MVJG 1UFOA 1USGA 2QVLA 5LN1A 2ADFA 1KL7A 2BMDA 3C41J 4MQBA 5AW0A 1BHQ1 3WO1A 2PUJA 3MCZA 4PZLA 2ZSEA 4G5QA 4Y2VA 1H6CA 3BCUA 4HMOA 1A9PA 1LTKA 3JQ7B 3ML1A 4I4LA 3AJ8A 3G9QA 3DC7A 3L41A 3OP4A 3THYB 1Z8HA 2XODA 4Q3DA 3ACCA 1XK6A 3A4VA 3BK1A 4KFRA 4EUEA 4Z99A 5GAJA 4CDRA 5F12A 3MPUA 3DEJA 3MTBA 1ACJA 4DMRA 1GQ2A 3LK7A 4N47A 2YRXA 1U8FO 2Q45A 4NU6A 4KREA 1ISRA 2BJWA 2WFAA 2D00A 2QTRA 3DWGA 2IP1A 1W4AA 1WCV1 3B7GA 3NXKA 3RRJA 2YDYA 3NH9A 3OZIA 1VJRA 3RROA 1J2JA 3KPYA 3PQ3A 1ICEA 1QHYA 2ZI5A 3L8GA 1VIAA 3FPCA 2QSUA 4IF4A 1OBCA 2IXFA 2BE7A 1XN1A 2JZOA 3GIWA 4P4UA 1MEEA 1SVNA 1ZHHA 1RCFA 4Y6QA 4XM2A 1VPWA 3O3MB 4X1IA 1OB2A 1AKYA 6REQB 3X1JA 4JLDA 3IJEB 1FZTA 3RLFA 1MP0A 2A78A 1KJNA 3A6DA 2HHAA 2NOAA 3BWMA 2OA0A 5IAEA 2Z83A 1Z82A 2X8JA 2NO0A 2HWKA 4O4HF 5KNCA 3TSWA 2IH5A 3VYWA 1ZSNA 1TT5B 1P2BA 4MVJD 4ZHSA 4YX9A 3AU9A 2AFHE 3QNWA 4OQLA 4C5BA 1KVRA 4FC6A 3O7MA 1P5HA 4DDMA 1J7KA 2VDRB 1Z7GA 3HCEA 3KYDA 5KKAA 1QJCA 4JB2A 2FSUA 2RHGB 2WD7A 3ENWA 4J2TA 4U7FA 3BXPA 1TO6A 1HNWB 4A73A 1OLUA 4FIZA 1U5BA 3L7LA 4GQAA 3RYIB