3B5TA

Crystal structure of novel immune-type receptor 10 se-met extracellular fragment mutant n30d
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
109
structure length
109
Chain Sequence
b'IKELHVKTVKRGENVTMECSMSKVKDKNKLAWYRQSFGKVPQYFVRYYSSNSGYKFAEGFKDSRFSMTVNDQKFDLNIIGTREDDGGEYFCGEVEGNTIKFTSGTRLQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Novel immune-type receptor 10
publication title A bony fish immunological receptor of the NITR multigene family mediates allogeneic recognition.
pubmed doi rcsb
source organism Ictalurus punctatus
molecule tags Immune system receptor
total genus 21
structure length 109
sequence length 109
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3b5tA00
3FQWB 2J4WL 3V95A 3K8MA 2Y5TA 2AV7B 1U3JA 1CL7I 3MCLH 1I8IB 4WUKL 1BFOB 3NGBB 1XZ0A 3CFDA 3BPLC 3TV3L 2B20A 5I16B 5CZVH 4WGVB 3HMXL 5I1GL 4LHQB 4I8DA 3VFTB 3ZYZA 1NCTA 1OP3H 1LO2H 4PJ8A 1J05A 2BVTA 1MCIA 1T3FA 3G6JA 4MJIA 1S7UA 3FMGL 4OI7A 4LP5A 1HSAA 3ELAT 1KCVL 2OR8A 2F8VA 1ACZA 3F7YA 2WNGA 3TH3T 1Z3GH 1J8HE 4JFOA 1MVUA 1W8NA 3ZHKA 3HNVH 4JFDB 1HHGB 3MRFB 4I2XA 5TF0A 3N1FC 5HI3C 2VKXA 2AABL 1ZLSH 4CRPA 5EZIL 2OXGA 4Y16B 1E27A 1J0ZA 4FQLH 2PR4L 5I30L 3GIVB 5JHDB 4N0RA 3TWCH 3PV7A 4FFWD 1K2DB 5DRZA 2DM4A 3R4DA 1FCCA 1Q0XL 2HAZA 7FABL 3L7FB 1MRFH 3RX7A 4LPXA 1SVCP 3UTTD 1C5CH 2FJGA 4XWGH 2YEZB 1AE6H 4GSDH 3SE8L 4DCQA 1YEFL 3JVGC 1VFBB 3UJJH 2KPNA 2P8PB 1OAZL 1BVKA 3MV8E 4MQXD 2EH8L 2DWDB 2ZUQC 1K8DA 4LARH 3PG2A 1A64A 1BWWA 4WWKC 4DK6A 1A7OH 2DB8A 1MFAH 5C0RL 2ZG3A 3REWA 2NY4B 1UJTA 1FHGA 5JNYB 3CVHB 2XZCL 2IEPA 3NGBC 12E8L 1P5UA 4BZ2L 1H3UA 4G43A 4PJ9A 2Q6WA 1LNUB 3LN5A 5I75B 4O2EB 5B22A 2D0FA 3PWUA 5A3ID 3BWUC 1QHOA 4LL9A 4XWOD 2NY7H 2D03H 4LDLB 4Q6IA 4QCIA 1A3RL 3UYOD 1SY6H 4QXWA 4WU5B 1RIHH 4ZO7A 2XN9B 3OJVC 4HLZG 1ZLVH 1A6UH 3QIWA 4PLJD 4JLRA 3CCHA 5C0AE 4JQIH 3E0GA 4ODXA 1ZANL 4NN5B 4XBPB 1CT8A 3CFBB 4Y16C 1QFWL 2J5LB 5F7DB 4XP5L 1QLFB 4JKPH 1JNLH 4NQED 1CGXA 4ZFFA 4N8VG 2E8ZA 1KBGL 4HLZH 5IGXH 3UYPA 4R90L 1S7TA 3AS2A 3UC0L 2Q8AH 3U0TB 1UZ6F 5I1KL 3OKYA 5CBEA 3PWVA 4LSPH 5CP3H 5D1QB 3WFCH 2ICWI 4N90D 2WBKA 4TTDC 2QHRL 3MLZH 2HMIC 1D5MA 2A73B 4HDIB 5J1SC 1MWAH 1JNNL 1M71B 1INQB 2PO6A 1NUDA 1RZ8B 2GTWB 4DW2H 1FFNA 4AEIH 3BW9A 3P2TA 3MUZ1 5EO1B 3RZCC 2KQNA 1DFBH 3U30B 3RWEB 5C0CA 1IJ9A 4NQCA 1AGCA 5DHXB 2NY4C 3D3VD 3OB0K 2VR9A 3D85D 1HSBA 1H8NA 3MOQA 1JTOA 1AD9A 1AQKL 1D5ZB 4IM8A 1FLRL 5C2UB 4X80L 1AJ7L 5JLZB 1BQSA 2HJLA 2DYPA 2VDLL 1FNAA 2XRAH 3CNKA 1DQLH 1MREL 4HLJA 1F4YL 3H9ZA 5DJCB 4PJBB 5EU5B 4AENB 4AZ8A 4NIKB 3T0EB 3I6GA 5BV7H 3C08H 1NAMH 1U41A 4HK3J 4GQ9L 3KPSE 4N0CC 3H42L 3RVXC 3RJQB 5HDBF 3TN0B 4FN0A 4NN5C 3FO0H 3AUVA 4KJYB 2HKHH 3ZE0F 4OIAA 2J5LC 4OD2A 5DT1L 1OF2B 1A3QA 4M5ZL 4HUMB 1FFRA 4KROB 1T0NB 5F9DC 1K5NA 3V6OE 1KPUB 2A2QT 4OFYA 5HGBA 1QEWB 2OI9B 3RPKA 3P0YL 4MVBC 1BQLL 3IETA 3G5ZA 4P59H 3FJTA 1LK2A 4JVPA 1OB1B 2VAAB 1GGBL 3CH8A 4NT6B 1Q0YH 3Q6GL 1ZA6B 3LKQA 1R0AH 2W9EH 3MA7B 3QNZA 1MUJA 2CIKB 2CRYA 2GJ6D 2HTLD 1NBVH 3L9RA 4TPRH 5DJXB 4N0UA 5EFIB 3U30C 1OP3K 3W0WD 2WLZA 2WIMA 5I18H 4MD5B 3ZT5A 4DUWA 5ABDE 5CEZE 2Q76B 2BNRE 3PHOB 4PJ7B 3WFHA 1CFTB 1NMAL 3U4BH 1IGFL 2M26A 4Q0XL 5EN2A 3VFOA 5TQ0H 3WSQL 4J6RH 4O00A 3G5VB 1NEZB 3HPJA 2APTA 4YWGL 4PJDF 4HV8A 3HR5A 1IAKB 1WWBX 1YEDA 4X6CB 1F90H 3KXFA 4JJHA 2GQHA 1TMCB 4U1GB 2UY6A 4C56B 6CGTA 3SE9H 4OZFG 5L2KD 1BIIB 1H3VA 2I07B 4YAQA 2VQ1B 5F9WB 5FEBA 3EYUH 3BIBX 5LXGH 2HJFA 3GMOA 3VDBA 2KQMA 2FWOB 4HW6A 1MJJA 3TYGL 4N0YH 4OI9A 2PCPB 5E5MA 1Q1JL 4JRYA 4XBGA 5TFSL 3SCMA 1W0WA 4OZFH 5F6HI 2BNQA 3NA4A 2ZUXA 3LS4L 1RUPL 2OI9C 4XNYL 3HS0B 4U6HA 5FUCE 5ELIA 2DJSA 5CFHA 2CR3A 4TUJB 2PTVA 4NFBA 1Z0MA 4XXCC 3LS5L 3U9UB 1TZHA 5MENB 1S3KL 1F4XH 1CLCA 2AK1H 1FV1B 4IMKC 4LSUL 1F00I 1FH5H 3C2AH 2M1KA 2C5DC 2VXTL 2IH1B 2BVUA 3LIZL 5GGVL 2ZWLT 3EDEA 5L2KB 3TZVB 4MJIE 1RI8A 1JWSB 2W60B 2E7BA 1HQRA 1N0XH 1FVCA 4IS6A 4O2FB 1JWMA 2X9XA 5DRXB 3SGDH 4U1NB 5E2VL 1AXTH 3BZ4A 4XAWL 1T0PB 3GM8A 4CVXB 4YHIB 1CFSA 1QVOA 1LGVA 5JPMA 2R0WL 3BZFB 4LOUD 2A6IB 3L3JA 5I8CB 4TULL 3MOAH 5FA3B 4R4FL 4M5YH 4LVHB 3WKMH 4TVPE 2CDFB 1DBML 1UM6H 5FGBA 1P9MC 3DX8A 2QQNH 3NPSC 3NABL 4RCAA 5F9WC 4D8PB 4LLDB 1FGVH 3RWJB 3UDWA 1HDMB 4POUB 2L0DA 4PRIA 4K2UH 3KPNA 4GMTL 4RRPG 5JW4Q 2DLTA 2PYEA 4NO0A 3TO4B 1TZGL 2OTUA 2ATKB 4KKNA 1AGFA 1JWUA 2JB5L 4CJ0A 3ZHLA 1VEMA 3F58L 3HZVB 1XCTB 4XHJD 4JM2A 5JO5B 4APQA 2HRLA 5EUKB 4PS4H 3U0WH 1D6EA 4HWUA 1FZJB 3B9KA 5IVZB 3LSOA 2H3NB 4PLKD 4WU7A 2A1WL 5H2BB 3LEYL 4MAYB 4WY7H 3P73A 5TQ2L 4M7JL 3BAEL 2QQQA 3DV4B 4TSAL 4K8RC 5JOFA 4LMQI 3RY5A 3ARBC 3MLTA 5T3XH 3VGHA 1LHZA 1KCLA 4NNXA 1YYLH 1S7SA 4CUCA 4QHUA 3QXDA 2VAJA 4PRAB 4PGBA 1NDGB 3MRGA 1FC2D 5T5FH 1IMHC 1CDUA 1NLDH 4PJCF 1BOYA 2R23B 3ARGA 1F5WA 5DEGB 1E6OH 1K8IA 4J3TA 2Z8WC 4HC1L 3JTTA 3PGCA 4O58L 4IHOA 3VXMA 5CEZL 1X44A 5I71B 4E0RA 4Z95L 4F7PB 4RFEA 3INUL 4JQVA 4JFEB 1DQJA 2B4CC 2OR7A 1NCCL 5I1JH 1KSRA 5CZXC 1WZKA 1MCJA 3K80A 3UTQB 5I76B 1NSNH 1YEGH 2DLFH 4HBCL 2H1PH 4M93B 4E41B 1HI6A 5DI8A 1KGCE 1U6AH 3QDJB 4OLYH 4LNRB 1SBSL 4TVSa 4ORGB 4YFEA 4EN3B 2VXUH 4P4KA 2F54D 1U8QB 5SWSD 2HFFA 2HG5A 4NHUB 1QBAA 1BF2A 1IEBA 2JCCA 1QSEB 3OKDA 3BPOB 5J6GA 4M3KB 4FA8A 4MAUH 4KDVA 1SJVA 3TBSA 3ROOA 3WFDH 4MAYC 4WFED 1JPFA 1F42A 1VFUA 5IB1B 2HLFC 1GOHA 5C08A 1NCAL 2H26A 3LKRA 1T20A 4FTVD 2R29L 3BT2H 2V2XA 3GBMH 4ENED 2O5ZL 4XVSH 1IKNA 3RWGA 3MRBA 1AI1L 3MUJA 2Q3AA 5EOTA 1DLFL 2AGJL 3FQTB 5DUMH 1JL8A 1U8PA 4ETQA 1I7UA 3EBAA 5IQ9B 1JPGB 4QRRD 2Z92B 3SQBA 3GI8L 4WCYL 2NW2A 5C09D 2X89A 3CDYA 3L95A 4FQ2L 4PRHA 1F11A 3BP7B 3ME0A 1A1OA 4WFFD 5I71C 3L5JA 5C0BE 3BIKB 3KLAB 4PIRF 4DJMA 1RZKC 1BECA 1P1ZA 1TCRB 1ETZA 3JV5A 3MBEA 5FKPB 4L1DA 1OAUL 4M7KL 2NX5D 3CUPB 3QWRD 2FJFA 3IGAB 4M93C 3F62A 3ECBA 3KPOA 5EOQL 2L4OA 5KJRH 2R9HC 3MRIA 4TVPL 2YKLH 5IB4B 1I3GH 1A7PH 5ECJE 4QEGA 5IIEA 4U4BA 5F9AC 2AI0H 1MCKA 2N7BA 4D9RD 2ZSWB 1FORL 1WWCA 3NZ8A 2VITB 4R26H 5FYLE 1P7HL 1ND0B 3PDDA 3BPOC 3BEVA 2EXYC 1ZHLB 5C09B 4M4RA 1KLUA 1QFPA 1WCBB 2UZIL 1BM3H 2BSRA 2FYYB 5AAWA 1MHHB 2Z93A 2R39A 3NCJH 1X5HA 1CLYH 5I1AA 4DGYH 1RULH 4Q9RH 3WBDA 3OKEB 4JN2A 3ZMRA 1WIUA 1OSPL 3DUUA 2C3WA 2ITCA 5IVXB 3VFMB 3QUZA 1HH9A 4K07A 2R4RL 1MCDA 1OTSC 3JWDH 1SYSB 4RA0C 5ID1B 5J3HD 3BVNB 1BOGB 5BMFH 2IGFL 1G0DA 1NC2B 4KK5C 4TNVF 1UWXH 4Z8FH 3ARYA 5HHOB 5A1AA 1RZJC 3M8OH 5DHYA 3BQUC 4JRYE 5FO8A 1YPZB 2NY3B 3LOWA 5TDNB 3WN5A 4GLRH 1HILB 1B88A 2F53E 1A3LL 3MUHL 4IDJH 3K2MC 1EMTL 3MV7D 4JFHD 5C07E 3ZKQD 4V1DA 1AY1H 3TVMA 3B2UD 3WFBL 5CD5C 2C7UA 5E8EA 3QDAA 3Q5YA 1FSKB 1WBYA 2H32H 3HE7A 4PTTA 4OCXL 2BCKA 1MLBA 2YD1A 3X11A 4KMQA 1DBBH 1G9NC 3TBWA 1S7RB 3EKCA 5ICXA 2DQGH 3FT4A 1PZ5A 3S36X 5IV2B 1CICA 1CZ8H 1JGEA 1I8KB 3GFUA 5DD3L 4MCZA 2CKBL 1MAJA 1WBZA 4KQ4H 4HWEH 4OM1H 5JDJA 5FDWA 1Y6NR 1AXSA 2CMRL 3LV3B 4UDTA 3QXTA 4HUNB 1RK0A 4I5BA 1OVZA 3BUTA 3SKOB 3IDUA 1OCWH 4WW2B 1NGWA 2X1PA 4J4PC 3QEQD 3GMRA 1F3JA 1ZGLP 1GC1L 4P2QD 2FGWL 1RZGB 2VLJD 1CR9H 2A74B 4K7PY 4G6AC 3GSVA 4LPUA 1QNZL 2NY3C 4X9FA 2NR6D 4YHNB 4NRZB 3TFKC 4MCYB 2V17H 4ODHH 3PHQA 5ID0B 4OQ1A 43C9A 1SBBA 4AQ1B 3LQAH 1KJVB 3VWJB 3QDGE 1NGPH 5DD1L 2FHCA 3MREB 2VH5L 3QEUA 4JHAL 3MRQA 1T7VA 4XPHH 1TQCB 3F7PC 2OMNA 2D31A 4NZRL 4WJ5A 1S5IL 3HC4H 3U2SB 3ARFC 3N0PB 5DTFB 3UYRL 4OZHE 3KJ6L 5DURD 1NKRA 2VR4A 1I9IH 3C6LA 4CMMB 5C0JA 2E9WA 1ZT1B 3CAFA 3DBXB 2R2HA 4YBQC 4HJJH 4P2QB 3PABA 2ZCLH 3RGHA 5FUOH 2B39A 4G6JH 4M7LH 1UWEL 5IT2L 2YC1A 5HJ3A 3UPRA 43CAB 3GI9L 3SGEI 3MLVH 3CD4A 2J7LA 5HPOA 4UT9L 4KWUA 5FYLL 3OKNB 2ZG2A 4LCWE 4Q97A 2ZOLB 4F9LC 4U31A 4Y5XB 2A6DA 5FDYA 3HI6L 1K85A 4WW2C 2C1PA 3MA9H 5TH2B 5E5UB 4YFLF 2AJUL 4Y4KD 2P5EE 4FG6C 3JWOL 5IFJB 4ZPTB 4Q6IC 1LE5A 2FBJL 1NFDE 5BO1L 5KS9A 5E0QA 2QSVA 4QRSB 5E9DD 5J0BA 5IM7B 2QADD 2W91A 3P77B 4RAUA 1A4KB 2VL4A 4F9PC 3IS0X 5F6IB 1ACYL 5IB5A 3ZE2E 3CXDL 1LEKB 1X9QA 1KJ2H 3T8XB 1EGJH 1UH3A 3QQ4A 4H26A 1X5XA 3RY6C 3VWJC 3ARDB 4C57C 4NPYA 3SGKA 2E9JA 3QYCA 5D1ZC 4LCUA 2OK0L 4OFKA 3QUMB 2EE3A 4G9FB 1J0JA 1R24A 2DL2A 1S7XB 2CJUH 5CJXC 4Z78B 1IILE 1V3MA 1W8OA 2JJSA 5HVHC 4R4ND 1DSFL 4FOMA 3RWDA 1ONQB 3RWIB 3ZT7A 3FT3A 2MCG1 1MI5D 1BBDL 4QXTB 2HT3C 1S5HB 3QO1B 4G7VL 3DJ9A 5DMGD 3W9EB 3LEXA 3NIDF 5E9DB 3GM0A 2VWEE 3IJSA 5DHVB 2AK4B 3I9GH 3ESVF 4HUXA 3O41B 5ISZE 4YIQB 3I84A 3SDCA 4LKCA 3V5HA 1EFXD 1E28B 2AAVA 2OQJA 1BP3B 1A21A 1UWXK 3L3GB 4X4ZA 2R0LH 2J88L 3OXSB 1DQQB 4P2YA 3BX7C 1KCSL 6FABH 3WJJA 5TGBB 2HVJB 4XHQA 3VWKA 4PJXB 1PG7X 2E6PA 1I1AD 1YEHL 4LLWA 1T0MA 4PYHA 3ARED 2NYYD 4YLQT 3LHPH 5TDPB 1G7LB 1P84J 3N9GH 5GGQL 3UPAA 1CGVA 5KSBE 3PWPE 1FRGL 3OWEA 1OM3L 5CGMA 5F6IC 3Q6FB 2BVPA 3VXRB 1T89C 2AEPL 4PUBL 4KUCD 1MHPH 4X7FC 3EDDA 4G9DB 2C4FU 4I3GA 1IAIL 4YNYB 3ARDC 3MNWA 4ELME 1NL0L 3T2NL 4DGIH 1N5AA 5CS7A 4JY6A 4PJBF 3C87A 1U36A 1PKQB 2NXZB 1NGXA 2DM3A 5DJZA 2HT4C 2Z4QB 4BSVA 1B3JA 1DVFD 1XGQB 5DR5L 4F57H 1FDLL 5IBUB 5L9DL 1U3YA 3S5LA 2QSQA 2YR3A 5IHZB 4IOIA 3VFGL 3AREB 5MHSD 1Q9OB 4KVNH 1MEXH 1QRND 1FCGA 5DJYB 4POZC 2G5BA 1Y6KR 4YE4H 4TQEL 1JGVH 3B5TA 2EDRA 4RBPH 5FYKH 5I6XB 1X5LA 2J2ZA 4M9OA 5I2IA 4UBDD 4XCCL 2HTKC 1MF2L 5E2JA 4HPYL 4UB0H 4GRWB 2A6KA 2BY0A 1FO0H 2DTMH 5SX4H 2A6JB 4LRNH 1A6AB 1LP9B 4XXDA 1HCVA 1IAMA 1B4JL 4KTEH 1FG2B 2Z9TA 5JXEA 1IRAY 5EA0L 1HHIB 1J10A 3DO7B 2GJZA 2HLAA 4HHAA 5HDBE 4RMWA 2J6EH 4WHYH 3TCXA 1GGYA 1YNLH 3L3HB 3MJ8A 4P2RD 2YS4A 1MJ7L 3QUYA 1OAQL 3AY4A 3QO0A 2RFXA 4PJ7F 4Y19D 3VFVB 5A2JH 5DZOA 3WD5H 3EOAA 2C4FT 1HH6A 4Y4FA 3WHXB 2MOVA 2Q86B 3BJLA 3ZKNC 4ONHA 1KELH 3GHEL 5AYUH 1ADQH 4YR6A 3PL6D 3BO8B 4IRJD 4V2BA 2GCYB 5FOJA 1B0WA 3Q5OA 4X6CF 1XFPA 1AO7A 1RURL 3H7BA 4S1QL 2CLVB 4N0FB 3C5SB 3U83A 3RGVD 5FO7A 4EVNB 1UB5A 4Q9BA 5L8LB 3MCKA 3WNOA 4DVRL 5KSAC 4LPCA 3H2WA 4KMTL 2AJYL 1EXUB 2VDQL 1I8MB 2YPVH 3EUUA 2QQKL 5BRZE 4PV8A 2GTZA 5CJBA 1XIWA 3MNVA 2GY7B 5I6XC 4G80A 4OCYL 5DK0A 4OCLC 4MA3A 5GGTA 3MRRB 1QFUL 1OARL 4NWTH 3Q3GA 1OD7A 3PL6B 3QZWB 2NY1D 4TNVK 5I8OH 3LN9A 3SY0B 1CD0A 2GUOA 1CDHA 3BGMB 1MIML 3KDMB 4MD4A 3R06B 4MDIA 1Q9WA 3RUGE 4NZJA 3OF6A 3S97C 5HI3D 3SPVB 1AP2A 5E2TL 1HOCB 1WC7B 2FIKB 2YXMA 3UTSB 5JUEL 1QFWM 1KTLB 1LK3L 2DQHL 3MOBL 4G6KH 3VRIB 2IADB 4LGSB 4UV4H 2AKRA 2JK5A 3C60A 3NMEA 3O8XB 5IW1B 1A9EA 4PRPB 1XGTB 2IQ9H 3DVNA 5E8PA 1CL7L 3QPXH 5GS3A 1XGYH 5F3HA 2BERA 2EDDA 2X6MA 3I75A 4G5ZH 4WIQA 3FFCD 3HN3A 2WINB 4Y1AA 3HKFA 3VFRA 4RFNC 5F9OL 5IB2B 2HWZL 5FK9A 3V6FA 2YPLB 3D1MC 1A1MB 4WWKD 3TM6A 5CJOL 3MFGB 4OFVA 3OXRA 2P5WB 1FYTB 4LHJB 2CKNA 1P2CB 4JM2C 4RGNE 2X5PA 4J3XA 2JIXA 2CDGB 1W72B 5D7LD 1J1PL 1U91B 3MRNB 4YGVA 5ESQA 2EDTA 5F93C 1IARB 1JNJA 2X1XR 3N50A 2CXKA 3Q48A 3NCFB 2WLYA 3I6LD 4KRPC 2XTJD 3B6SB 3H3PH 4MSWA 2E9IA 1R3IH 3AC0A 3GMPB 5DYOA 1PAMA 3T2PA 5C6PB 1HYSD 3TPUB 4IRZL 3IT8D 1RSFA 3DO3A 4Z7QE 4Y4HC 5DK3A 1EO8L 2P24B 1V5JA 1CXFA 3WLBA 4YDVB 3BDYH 4OZGB 1NANI 4K94L 3QCTL 5D70H 3KYNA 4V2CB 2VB5A 1S7VA 4JCLA 4XPTL 3IJHB 4KXZI 2B0SL 2QR0B 4O5LH 1P84K 5J6HB 4FXLA 4XRCA 5FYJE 4KU1A 2EYRB 3TO2A 1XF1A 2A0LC 4OGAD 4TUOB 2O5YH 1OT2A 4R7NB 2Z35A 1IZKA 1M7IA 4WI2A 3MMEA 5HGDA 4UNVA 3RWFB 5FF6A 2NY2B 2VDOL 5DVMA 3O8XC 4AL8H 3CSBA 5GRUL 1JZ7A 5SWZE 4JQVC 4H20L 4M8QB 4K7FB 4TTDD 1CFBA 3IU4H 1GL4B 2IJ0C 4ZXBB 1IEAB 2ARJA 1MRDL 2JKXA 1EPFA 3MFFB 3SDXB 1CFVL 4KI5E 2NXYC 3LEVH 5K9JH 3RZCD 5D7SL 2BVQA 5IMMB 5D1XB 3RKDD 1J18A 4HXBL 5GS0C 3U9PH 4RBPK 2WMPA 5F3BA 1BPVA 2ADGB 1B9ZA 5MP6H 5BJTB 1VEPA 1Y0LB 3N85H 4KAQH 4JFYA 2PW1A 3QWOA 3OAUL 3B9EA 5DMKA 3NN8A 3QI9B 3QUXB 5ACZA 4Z77B 2V6HA 4PJGB 4HPOL 1I7TB 1S7QA 5D7IA 5D6DC 2DF3A 1Z2KA 2X10A 4F58H 5J12B 3QPQC 3RU8L 2X70B 1IKNC 5FM5M 5GIRB 1UJ3B 4OIBA 4HMDA 1J12A 5AUMB 4N0CD 3KNBB 32C2A 4E9LA 3RVXD 1FFPB 2R15A 3BWAA 3T09A 5IESL 4FQHB 4P23B 2V2TA 3O3BB 1VB9A 2XFXB 3NACL 3NIFE 4XMKL 3FRUB 4H1LB 1YY8B 5KTEL 2J12B 2YBRA 5EWIL 3TNMB 4HH9A 5LVEA 1A6VH 1N26A 2ESVB 1IC5L 3BP5A 1KT2A 3DXAB 4Z7VB 2EXWC 3K3QA 4NNPL 1ED3A 4X8XA 5ETUB 3OKLB 3VJ6B 3IDNA 5IMKB 4ZXBC 3JV6B 3D0VA 1QBBA 4JAMA 4QWWD 5BS0A 2Q8BL 3TCLB 3WS6C 3EYSH 3JUZA 1A0QL 1ITBB 4TOYL 3UTTA 5D1XC 4J1UA 4X4XA 2QKIA 1K6QL 3V6ZB 4DFIA 1T2XA 4L4TB 1VHPA 5DVOA 4OCSH 1IVLA 1B2WL 5A2KH 3QI9C 5FECA 3QUXC 1E4WH 4L4VE 3DMMC 4URTB 1IGJA 1C08B 4IMLA 4NKMB 2YSSB 3O4LA 2UUDH 1T1XA 4I9WE 3ROLA 4M7ZB 3EOBB 3L3KA 1I7RB 4PPTA 3L6FB 1XF5A 5EU6D 2XPGB 4PY7B 1OT1A 1UJ3C 2WWKT 1MAML 2I60H 3QFJD 4WUUB 3STLA 1XF2A 3U7YL 3S4SB 2ADJB 3RPIA 1OAYL 2DLHA 3QUKB 2GKIA 4P23C 2XOTA 2LVEA 4HS8H 5F7LB 2OSLB 3S37L 5IHUH 3MODH 1OSZB 5ICZA 5FOBA 2DN7A 4GRMA 2APWA 2AQ3A 4KFZC 3G5YA 3E8UL 4F7CA 5T3ZD 2DMCA 5IVXF 2G2RA 4PREA 1SJHB 5FYJL 1FJ1A 5IQ7L 1MNUH 3QRGH 2OX5A 1IQWH 5TDOB 4NO5A 1WLHA 1JV5A 4X7SH 4JPIA 4S10A 3VXNA 4PFEA 4XCYB 4L4JA 4KK9C 4PB9L 2C3VB 4GQPH 2D7MA 4KDTC 1AFVH 1KJMB 1RZKH 3TH4T 4CKVX 4DQOL 4X98B 4Z7UA 5GGRB 2Y07H 3VCLA 4BH7B 5HYJE 4GW5A 3ZSTA 3U0PA 4MNHA 5JQ6H 4LLMB 3X3GH 2X4QB 4X8JA 5D7KE 2Q7YA 5DZLA 5E4IA 3D18B 4DWHA 5B38B 3GKWL 4P4RB 3MLSH 2FO4B 2X1OA 5DJDA 3B83A 1I9RL 3RHWF 1UH2A 1MCEA 5EBLA 5GRVK 2FO1A 4JANA 1MJ8L 3ISWA 1CCZA 1TTGA 5TF1H 2IAND 5GJTL 3WIHA 1ES0B 3F7RA 5LGJB 3SGJA 5ITFA 3RAJL 25C8L 1F58L 4Z0XB 1MOEA 1KIPA 4U1JB 1D7FA 4KHTH 1YMME 1Z5LA 4W70A 4EUPA 1M05A 2VDRL 4NM4L 2PTTB 1PSKL 3FTGB 1XGUB 3MGOB 2HYMA 5J11C 3VW3H 4NHCL 4OIIL 4WW2F 1PKOA 1PDKA 3MRMB 3THML 4QRTA 2D7NA 5FYJU 4M1GL 2OBGA 1KFAH 1MPAL 3TYFA 1XGRB 3HZKA 3FRPG 3WNKA 2EYSB 3CC5A 4GBXD 4OFIA 4YUEH 4KTDH 5DD0L 3CFIC 4PJHA 4NZUL 4K8RD 5EU4A 1VPOL 3ARBD 3MRCB 4BKLB 1EBAA 4TRPH 3VFPA 1RUQH 4QNPE 3GGWB 2YRZA 3EDKA 4D0BB 4HZLA 3IFOA 1FNGB 1MLCA 1AGDB 3X14B 1SEBA 4CU8A 1MFCH 5EO9B 1GH7A 3D39E 4KZEH 1J8HB 1DJSA 5HI5D 4EEEA 3BKMH 3U4AA 2E27H 1KTKE 4OTXH 2O61A 1T1ZA 3S36H 2EDKA 2IMNA 4XNMB 1MIEH 1G9NH 5FB8A 4FS0A 5SV3A 1TZIA 4H25B 3BFOA 4QY8B 1JYVA 5HDQH 3QA3A 1KEMH 2VXVH 1HXYA 4BQ8A 4UQ3B 2EKSB 4GXVL 5E94B 1TLKA 2FHBA 1IZJA 4HWZB 3ORJA 5F1IA 1ZE3C 1J8KA 5HHME 3D2UD 3EGSA 1RU9L 1FZOB 2H2SC 3AU1A 3UBXI 1DL7H 1I1FA 1EVUA 4XNQB 4C4KT 2WUBL 5J06A 2DD8L 4XNZB 4MNQA 5I1HH 4DK3A 4AY0A 2DBLL 3MV8B 4P5TB 1P4IH 1E6JH 3NOIA 1VGEH 3IFPA 2I9TA 1BAFH 4ZTPH 3P4NA 4MDJA 1D5XA 1PFCA 1DEEA 1FL6B 4ZYKA 3U6RA 2LE9A 1SY6A 1II4E 2R69H 1IGTA 3I50L 2D7TH 4AK1A 4G42A 1HHJB 4F7MB 5D7IE 4J3WA 4EQ3A 2IPKB 1U8MA 1YNKH 5L6YL 2UUDK 4N5EC 5FA4B 4S2SA 5HHQA 5GSVB 5FHAL 3W11C 2AEQL 1WZ1H 4B41A 4OV5A 3P4MB 2EKJA 1CF8L 5AYQA 1MFEH 5J7CC 3KYAA 1BEYH 4JRXD 5C0AB 4TUKL 1D9KB 4NGHL 5B4MC 2WW8A 4WI3A 1G7JA 4Y0GA 3PGFL 4U3XA 3MUY1 4R7DB 1K4CB 5D2NA 1WEJH 1P6AB 3NCYS 5AZ2H 3D69B 5AG9A 4DKEL 4W4NA 2J1KA 1GZQA 1KCRL 4N8VA 5LCVL 4P46C 2CK0H 4LIQE 3RVUC 3QDMA 4XCFL 3G04A 4C54A 2ZPKL 4GW4A 3I85A 1YYML 3BKYH 3LPFA 4MMZC 4XZUA 3UTTE 5JW3L 3HR6A 2XN9E 5CP7B 1CGUA 4P5MB 5E8DH 2IQAB 4P5TC 2VIRA 3FOLB 3S9DB 2XZAH 2ZCKH 3KYMA 2EXYD 4PJXF 4UINL 1YA5A 4S0SD 1UADC 3ULUF 2XNAB 3GSRA 3T3PF 3OR7A 2XG5A 5IVNA 5C2BL 3SEPA 2DBJA 3RTQB 2WV3A 1GVIA 3ILPB 3O81A 4U2YA 5GSRA 1KCUL 3H3BC 3GJFB 3UTZA 1NAMA 1KPRB 1WUNT 1CDCA 4Y5VA 3L5XH 2FJHB 4Z7OF 1OGAA 3VXTB 3D0LB 5CEYA 1IQDB 4JJ5B 4XCEB 1G7QB 2P48B 1OTSD 3C8KB 4IOFD 4YHLL 1JRHH 3QNXB 1UH4A 3O6MH 3FN3A 3ULVD 1PGRB 1MH5B 3ZZ1A 1EH9A 1BQHB 3CGTA 3KPSB 2VZ1A 1FFOB 1VFAB 1UFUA 4GRLD 1ORQB 3MSPA 3BQUD 3HNTH 3SDDA 4KI1A 4ZAKA 3VI4F 3MV9D 3FT2A 3JSSA 3O3AB 5DQJA 4CADB 5CAYB 3SKNB 2Z91B 1Q9KB 4Z5RB 3S3PA 1U8JA 1RY7B 1AD0B 4PJAE 5JXEC 4X9IA 1GJIA 2NLJA 1P6FA 4NQEE 1ZWIB 3HAEB 2QQLL 3T1FA 1UQSB 4K71B 5CD5D 1ZT7A 3BH9A 4GRWF 1A7RL 1LP9F 2VDKL 1PG7H 4N90E 4IJ3B 5GGUA 4QT5A 5C0GB 4P9HC 1N7ML 4JFXA 4YK4C 4Z7UE 1Q94B 2P8MB 3LMJL 2HJKB 3FCTB 3REVB 4R96A 4GRLB 4PV9B 1FZMB 5EZOL 3IDJB 1RHHA 4QXGL 3RTQC 5FO9A 4K7PH 3NCMA 3OX8B 5LBSH 2BNRB 3C5ZB 3D3VE 3QHFL 4U6VL 1ZTXH 1NCUA 2X40A 3RFZC 2KZ1B 4I18A 4HKBA 2VLLB 3EO0A 2EEDA 4O4YL 3UJTH 4Q9QL 3WEXB 4L3EA 2Z8SA 5JHLL 1JGUL 3B2VH 2CPCA 2DQIH 1YN7B 2YXFA 2QEJA 3VFSA 3O2VL 1ERNA 4JB9H 3QUMH 4J4PD 5CGTA 4OD1H 3B4NA 3GK8H 2NZ9D 3TA3B 4I0PB 1XIWC 2ZKHH 4ZUSA 5HYFA 5H35B 3SKUD 2EICA 1Z9OA 3P30L 4OZFA 1CFQB 3CSYB 8CGTA 4AH2B 1KN2H 5JR1L 2AJ3B 3ARSA 2NTFB 3CFJB 1EX0A 4RQQB 2HKFL 2ZSVB 4NKDB 5J1AA 3DX6A 3VD4A 3BJ91 1NBZB 2C3HA 1QG3A 4PGDA 4YDKL 5EIVA 4Z76A 5C7XH 4DKDC 5DHVH 3P0VH 5DUBB 4K71C 3OKMA 1RUMH 1VDGA 4IIQC 4EIZC 3VA2C 3IAQA 2EIZB 3GB7A 3ARFD 4Z7NF 4OCWL 1SMAA 4M6OL 4JN1L 4MX7A 4HK3N 5SWQA 4XPBH 5AZEH 3RNQA 4ONGL 5DJ6A 4YBQD 3GO1L 1CK0L 4PJ8B 4XB7A 4LIQL 2GJ6E 1E0OB 1QSFA 4MJIB 3VXOA 3ULUH 4KZDH 1JTPA 3VFNB 1OAKL 3F7YB 4HCRH 2HRPL 1JIBA 3O6KH 3OG4B 4OGXL 2WBWB 1MVUB 3W0WE 4LLUA 3C5ZC 1AC6A 3U79A 4I2XB 3BSZL 5DVLA 1GGCL 4FFYH 5IBUG 3QR2A 2FX9H 1H0DA 4DZBB 2BZDA 1LDPH 4LHUB 2BMKA 1E27B 4PJ9D 3IDIA 3RHWK 2OJEA 5GS1C 3BD5A 4WNQB 5LGKA 3ZDZE 4U1KA 1M4KA 2G60H 2DQUH 3VGAB 3TA3C 5BQ7A 4UTAL 2VLKA 4MA8L 5T1DH 4CU6A 1YEIH 5L2KE 4RISL 1GHFL 5JOPD 3QIWD 2HN7B 2BOBA 4MQ7A 4DKFL 5K9KA 4RRPA 1LMKA 1VACB 1D5IL 1OLLA 1FIGL 1NMCC 2NY0B 4CN6A 1AH1A 1K8DB 3LKNA 5KW9L 1IAIM 4Q58C 5D1ZD 4GH7B 5INDA 5JIKA 1OP9A 1CE1H 5FUCC 3REWB 3EW3B 3EO9L 2CUMA 2FHFA 1VFOA 4GRWH 2VDNL 4OZGF 5EORH 3BPNB 4NKQB 3KPRA 3LN5B 4XPFH 1G7MB 1AKJB 4D0DB 5IEKA 1ULVA 3M1BA 4YQXL 4LCIL 3FO2A 5LKNA 1WBXB 5F1NB 3E2HB 4DN3L 1ZS8A 2ICEB 2YZ1A 4QTIH 3NZHH 3QG6A 1I7ZB 4LCYA 1PQZA 4NP4H 3FZUC 1RPQA 3QG7H 1S7WB 5JW5A 3WNMA 2B2XH 1FNSH 5C0CD 4X7TA 4F2MA 2DQJL 4NC0B 1BIHA 4NQCD 4Z9KB 2OP4L 1CYGA 1U95A 2A9MH 1CT8B 5C3TA 4UU9B 4MA1C 4F33B 4OUOA 1DANU 1FPTL 4ZFFB 3TF7C 3BP6B 3DX7B 4YHPA 3VGAC 2DYPD 1S7TB 4M43H 3PUCA 5I1CH 3PXJA 1HINH 4KUZL 3HLAA 3HNSL 3VGFA 2X4RB 3S34L 3PWVB 5BXFB 1TIUA 3FO1A 3QZWG 4UIMA 2PO6B 3QEQA 2CKBB 2VLJA 4AM0A 5ALBL 3BW9B 4EXKA 1UKTA 4L9LA 4PJGF 2DQFB 4FFZL 1RUAH 2P8LB 1AGCB 4LEOA 4AIZB 3FONA 3KHOA 1TITA 2AJXH 4XVTL 3D25B 3MRDB 2YN3A 2VZSA 4G8GA 5DJ2B 3WS3B 1QA9A 3OKOB 1UT9A 4OFYD 1IBGL 1UWGL 3MO1A 3DRTA 1AD9B 2Y36L 3O2WL 4WEBH 4CW1B 1N5YH 4FP8H 2NY6D 3I02A 3H9HA 3QIUB 4GXUM 3E2HC 4NZDA 2CK2A 4JKKA 4LSVL 3FOMB 3WFZA 1CLZH 4XX1E 4HFUL 4YX2L 4ZS6C 1KNOB 2FB4H 4IRSC 4RDQF 3ZL4L 3FN9A 4GKSA 4CVWA 2B8OT 4Z7VF 4ODSH 1R5IA 3HI5H 4GG8A 1Z6JT 2Y9RT 1UA6H 1JUFB 3QHZL 4B0MM 2R56L 1DANT 4LLVA 1VADA 4QO1A 3PQYA 5F7YC 1WQVT 3V6BR 4LAQH 3T77A 1BVLB 4ZO6A 1MQKH 1MY5A 3EZJB 1JBJA 5F1KC 5C0BB 3HE6C 4OFDA 1CFNA 3IETB 1MRFL 2NY6B 4KV5F 1LK2B 3BRDA 1QD0A 2VE6A 1W72H 4XWGL 1PVHA 4XP4L 2CIIA 3F12B 4JFZL 1NFIB 3ZKND 4N9OB 1UACL 3L9RB 5L2JA 3NFNB 2LABA 2OJZH 2X42A 1F4AA 2F54E 3MUGA 3VMPA 5SWSE 1MFAL 1N2RA 1ITCA 4ONFH 1XH3A 2AJVH 2BNQD 5K9QG 1ZT4B 3MXVH 3WFHB 5K33A 4N9GA 4MNGE 1RUKL 2VSDA 3QIUC 4PJCA 2BJML 4XNUL 5IJVA 4WFEE 1TETH 1R5WB 3KXFB 5JORB 3H0TB 5DVKA 3JV4A 4FTVE 1AGEB 3B3IA 3O3EA 4P5KA 3HFMH 1MCNA 3O3DA 1RIHL 3QXWA 2NQCA 1LQSR 4OQTH 2VL5A 3MYZA 1ZHKA 4JQIL 2XWBA 2F58H 4JO2H 1IC7H 3RVVC 2WBJA 3FFDA 3S88L 1JHKH 3G08A 4ZFOL 4J3SA 1CLOL 3HB3D 1FN4A 4F15C 4QRRE 5EIIA 1DCLA 5H94B 5F70A 2UYLB 4F8QA 1WIOA 3GSQA 4X6FA 2VLRA 3MACL 5C09E 1H15B 2FSEA 5HVWA 4KKAC 4FZEL 4JRYB 4XBGB 3SCMB 4MMXC 1I1YA 1PEWA 1LO0L 4PGEA 2WQ8A 3FB6A 4HIJA 4XGZB 4OUUB 3BI9X 4WFFE 5I8EB 3WUWB 1DBKH 5FHBL 4U6HB 3JXAA 3GSOA 4GKNB 4J8RB 4X7EC 4YHMH 1IGIL 4P9MH 5ADPH 5JDSB 2YD4A 5C07B 3NA9L 2LTQB 1N3NA 1RZIA 2NX5E 4OD3H 3TGXA 3ILQD 4BM7A 1PG7W 1MCFA 4R2GB 4IEFB 4PRID 1JYNA 2YD6A 4JFFA 3IF1A 1U3HC 2Y1VA 3Q1SL 5D8JL 3QCVL 2PYED 3QH3A 1G1CA 4NO0D 1HQRB 5AD0B 2E7HA 4IS6B 5I0ZA 4YXKL 1L7IH 3OGCB 4U1HB 4MA7H 4D9RE 3TPKA 4HUVA 4HJGA 3ZHDA 4X4MA 3D9AL 4JM2D 5AWNH 4E5XB 3RP1A 1NJ9A 2ORBH 1PJ9A 4M02A 4APQD 4H88H 3V5KB 2NMSA 4NUJB 3BN9C 3JWOC 3K2UH 4KKLC 5CCKL 3B9KD 3IXAB 1FL3B 3CZJA 4LVEA 1C1EL 4KRPD 4BFBD 1DVFA 3QIBC 1YECL 4WUKH 2OM5A 4CDGC 4Y4HD 1FGNL 3TV3H 5EO0B 1BREA 5DSCB 4QOKA 1BBJA 1GGTA 4XTRD 1GAFL 1X5GA 1LE9A 3RDTB 1UZ8B 4U1IA 4P3DB 4WI5A 5GGSY 3IDGB 1T21B 4MB4A 2Q20A 3UAJD 3FMGH 1KENL 3EAKA 1CTOA 3ARGD 1KCVH 2DI9A 4JFQA 3ARTA 1JMXA 4XVJL 2E7LA 4L8CA 3P9MA 3G6AA 1JZ6A 1VFMA 5F9JB 4KY1L 4Z7WE 4UT6L 1JGDA 1NPUA 3TLRA 1JYWA 3VXMD 2AABH 3QDGB 2LTQC 5EZIH 3QFDB 1D6EB 3S4SG 3LSOB 2EO9A 1ZVSB 5JPNB 2XV6B 3MV7E 4JFHE 2PR4H 3RWCB 5I30H 2E3VA 3P73B 4OB5L 3DWTA 2ARJQ 1S9WB 2IAMA 4OZHB 4P2RA 5D4QA 4Q6YA 1Q0XH 7FABH 3OSKA 3MLTB 4NNXB 3D5OF 3K8LA 1WT5A 5T33L 2V7HA 2NXYD 5I9QB 4Y19A 3SE8H 1YEFH 4P4KD 4ZODA 4XPAH 5GS0D 4LSRL 2Z31B 4FQXC 3X17A 2O26U 1OAZH 4LCCC 1TCMA 1KLGB 2BNUA 4WFHE 2EH8H 5CHNA 4U7MA 2RQ8A 4QHKJ 1MHCB 3RGVA 3P3YA 5C0RH 3WJLA 4CN1A 1UB6A 5F1OB 3PGCB 4LCWB 4E0RB 2XZCH 5C08D 4BZ2H 3CSGA 5I1LA 1KB5L 2X9WA 3BYTA 1JF6A 1H3PL 2BY3A 1WF5A 3QPQD 5I73C 3VFUA 4NO2A 4OKVA 5FKAB 4BQ9A 1KJ2A 1NGZA 1EGJA 1UM4L 4PY8J 1J5OL 5GGSB 3QEQE 4BH8A 1NFDB 1A3RH 4P2QE 5IVOA 4XP9L 2VLJE 4UQ2B 1HK6A 4FMKA 4P2OB 5B38G 4ZSOA 2HG5B 4UV7L 5KVFH 2X89D 4WO4C 2EEAA 1ZANH 1IEBB 1IM9A 3VH8B 3OKDB 4BFEA 2WIIA 4L8DB 1V8HA 3FB7B 1QFWH 4YH6A 1GSMA 1YNTA 2EXWD 4XP5H 1BJ8A 1JPFB 1UM5H 1R3LB 3MBED 4EDWL 1KBGH 1MRCL 3UTPD 3K1DA 1YJDL 1F6AA 4H5SA 4R90H 5D2LE 1HXMA 3UC0H 5T1MA 3IKCB 3VE0B 5I1KH 5I9QC 2A38A 5IBTL 1BD2A 1LILA 5ICYA 2X4SB 3PWNA 4RZCB 5EOTB 3T4AB 3GSNL 1U8PB 2Z31C 3JVGA 4W81A 1JNNH 3EDJA 1QOKA 3AROA 5IMLA 4NSKA 4XNXL 5C0FB 2VTFA 4Q2ZB 4FQJL 3CH1B 1XR9A 5ISZB 3QJFA 1QQDB 4PRHB 2WQRA 3AAZB 4LDOB 1H8OA 1MCCA 1V3LA 3HZMA 5DA0B 5EBMB 1F6LL 3FQWA 4Y89A 2AV7A 3KPLB 1I8IA 1GZPB 4HT1H 3TIEB 1BFOA 3U1SL 3C2SA 5D7LA 1AQKH 5JIPA 5I16A 2BHZA 2MWCA 4X80H 1AJ7H 2VDLH 3ECBB 2K9UA 1MREH 3QUZD 1U8HB 1HEZA 1INEL 3MRIB 4MWFB 3K7UA 5IIEB 3EFFA 4P2OC 4OGYL 4JFPA 4CJ1A 3GSUB 5KSBB 3PWPB 1BMGA 4KJWC 2OYPA 1J0HA 4GQ9H 5KVGL 1IC4L 3H42H 3ALWA 5E9DE 4NQSA 3NZ8B 1A7NL 4C4KO 2GT9B 3DTXA 3BEVB 5EZJB 3MRFA 4ELMB 2YD8A 1PY9A 3CDCA 1JHTB 5DT1H 1J0YA 1FG9C 2Z93B 4Y16A 4MXVE 4OLXL 5I17A 4L8BB 1JI1A 3GIVA 5JHDA 1N59B 4V1DD 4QHNB 1K2DA 5IK3B 2FNBA 3DGGA 3L7FA 1BQLH 3P0YH 2FL5B 2AP2A 4KK9D 1AC0A 4RGOL 4YHOL 1RJYA 4BSJA 1GGBH 3HE7D 3PNWB 1FO0A 5F88B 1HH9B 3Q6GH 1VFBA 4HX1A 3GUTB 1MI5E 3F6IA 1XT5A 4RAVB 4X6BA 2P8PA 3S96B 1I75A 1YQVL 2VWEC 4WI7A 3U4EB 1TVDA 4A2MA 1CICD 2YA0A 3RZCA 5DHYB 4NYLA 3EYFB 3KYOB 5GRJL 2WM0A 3WLWC 1NMAH 1IGFH 4GG6A 3WSQH 1T2QL 3QAZB 1A7QL 3DV6B 1QR1A 4YWGH 3TVMB 1YEGL 1ADQA 4UTBL 5E6IB 2BSSA 4N8PA 3CDGB 5E99L 5E8EB 1U8KB 2AJZB 1WBYB 5HHNB 1KXTB 3JZ7A 4WU5A 4EI5B 1FZKA 1KB9J 3P0GB 3X11B 3EYOA 1LEIB 1Q72L 4LLYB 3FT4B 2CLZB 1U93B 1A9BA 1N4XL 1QP1A 2HP4A 3TYGH 1EEUA 4UIKL 5JW4N 3CFBA 1JGEB 5FGCE 1FQ9C 4MCZB 5F7DA 3OTTA 1Q1JH 4ZNCD 3WFDL 5CSBA 5TFSH 3DVIA 1DLHB 3SOBL 1WITA 3DOSA 1PD6A 5M95B 3LS4H 2HFGH 1RUPH 4D3CL 4XNYH 3KHQA 4K55A 3U0TA 2CRIA 1OD9A 5HHXH 3C09C 2J8HA 5BRZB 3LS5H 1S3KH 2ICWB 3IFLL 1BJ1J 1JK8A 2A73A 4HDIA 2EIDA 4LSUH 3ARUA 5MHSE 1M71A 1X5IA 1INQA 1QRNE 2VXTH 2BHYA 3LIZH 5GGVH 1BJ1H 4ZUTA 4PBWD 5GQBA 3G9AB 5EO1A 2PXYB 2J3SA 5E2VH 3HRPA 4XAWH 5D5ME 3L7EB 3RUGB 3HRZA 2EYTA 3MRPB 3RVTC 1D5ZA 5ENWA 5DC0A 5AG8A 5GXBB 4S0TD 4B50A 2R0WH 5JLZA 2Y06L 5C0IB 3MRQB 5JMOC 2GAZA 4TULH 3WIFA 4R4FH 2ADFL 5KJRL 4PJEE 2D31B 4WJ5B 3VRJB 4CNIB 5DJCA 1DBMH 5KN5B 4PJBA 5EU5A 4P2RE 1NDMB 4EI5C 3GJFH 1BQHG 3T0EA 4HAGA 3NABH 1EZVY 3C6LB 1QYGL 2FRGP 1I3RB 1DTUA 1Q9LB 1WAAE 4UDUB 4Y19E 3H9SD 4GAGL 5C9JB 3PABB 3LD8B 4GMTH 4KJYA 3KPQB 2EDNA 1CG9B 5TPWL 5HJ3B 2M8XA 4NRXA 4YBLB 1OF2A 5DFWH 5GS2H 2JB5H 3FB5A 1CLYL 1ZHBB 3HAEG 3F58H 4LU5H 1T0NA 2BXYA 4PGZA 1KPUA 5D96B 2X4OA 4RGNB 3V8CA 1QEWA 2PKDA 3BRFA 1OB1A 2VAAA 4B7LA 5FCSH 4XXCA 3ZO0A 4NT6A 1OTUC 2A1WH 5MEQB 3LEYH 2W9DL 3MA7A 4N5ED 4LPYA 4IMKA 5TQ2H 2CIKA 3W11D 4M7JH 5CKGA 3BAEH 3HAEH 4TSAH 2P45B 5DJXA 2W92A 4ZUVB 5EFIA 2UVFA 5A43C 2KH2B 2PXYC 2DWEB 5ALCL 4MD5A 2V9TA 4LRIC 1KYOK 1REIA 2CDEB 5B4MD 5E2WL 1UYWL 2Q76A 2GJJA 3PHOA 4PJ7A 3MRKB 3SDCD 1E4KC 5I1DB 4H26B 3QQ9D 5FGSA 5IMOA 4K3DL 3E6HB 3BP4B 1IAKA 4HC1H 1G9ML 1ZSDB 4X6CA 3VWKD 2MHAB 4O58H 2OZ4L 5CEZH 3U82B 4C56A 1JZ2A 2Y6SD 4U6YB 1H5BC 4DFHA 2YD7A 3RVUD 4QRPD 5SWZB 3RWDB 3INUH 1P9MA 1N6QL 1BIIA 1NCCH 4WVRA 4ISVB 4BFIB 2I07A 2VQ1A 4HBCH 2D3VA 4MXWH 1HQ4A 3QNYA 2FWOA 4Z0BL 1CZ8L 3LEXB 1SBSH 1HN1A 3FFCE 4BSWA 4RGMC 5DUPL 2E9BA 1ZAGA 4XAKD 3KPPB 5D7JB 4OZIE 1NGQH 2OQJB 2X1WL 4ERSL 3A67L 4TUJA 4NOBA 2DAVA 3U9UA 2SEBA 1DN0B 1I4FB 5MENA 2G9HB 2ZUVA 5I74B 1UXWB 2IH1A 3I6LE 2XTJE 2R29H 4GAYA 3TZVA 1CR9L 2IFFL 4XP6L 1JWSA 2O5ZH 2V5YA 2W60A 4OCMC 4MJ4A 1AI1H 4KJQD 3S37X 4O2FA 2IWGA 1DLFH 2AGJH 3CVIL 4HKXB 5DRXA 4JCMA 1R3KB 4CVXA 4YHIA 4LHUG 3GI8H 4AEEA 3LQAL 4WCYH 1F97A 2RBLA 1KB9K 1M6OB 5JA9A 3KG5A 2A6IA 5I8CA 5JXED 4XPHL 5FA3A 2V5RA 4X9HA 4KHXL 5L7XL 4G3YL 1NLBL 2WWMC 4XBEH 2AXFA 2P46B 3QUYD 4ZNEE 4D8PA 4LLDA 3RWJA 1WV7T 1OAUH 4M7KH 2VJXA 5T1KD 3IRPX 3CSPA 2WK2A 5EOQH 1EZVX 3SDAB 4JDZB 4HIEB 4TVPH 3TO4A 4G6FD 3MJ9L 3KS0J 2ATKA 1PYWB 1N8ZA 1QLRB 1XF3A 2HFEA 5IOPB 2GITA 1AO7D 1FORH 2XQBL 3KS0H 5IBLC 4CMHB 1XCTA 2DQEL 4M62L 5LQBH 3DVFA 5JO5A 2V7NB 5EUKA 4KJPC 1A6TB 2UZIH 3BDBA 2AV1B 3O9WC 4L3AA 2AW2A 4KKBD 1FZJA 5ESVB 5IVZA 4L4VB 5I74C 1YEKL 5E8OA 5C71A 5HHPA 3DROB 4MAYA 3JWDC 4QRUA 5EULV 1CE6A 4YO0B 2B1HL 3NPZB 2APBA 3OG6B 2FECI 1OSPH 3GRWL 1XIWD 3LB6D 3QO0B 2RFXB 3UJIH 4GW1B 4PRAA 1NDGA 3BMWA 4Y4FB 2R4RH 1A1NB 3GBLA 2R23A 3OR6A 5AAMA 4HIHB 2IGFH 2J8UE 3QQNA 1MCWM 1MHEB 3FQNB 3OF6D 1ZVYA 5KVEL 5EC1B 4XI5C 2W38A 3W9DB 4N68A 3T0DA 3MCKB 2QTEA 2CUIA 4F7PA 1RIUL 3QEGL 1IAOA 1A3LH 4JFEA 5TE6L 3C60D 2BVEA 4K3EH 2UWEE 3UTQA 5I76A 4DVBA 3RIFF 4PJIA 4E41A 3WFBH 3WXVL 3K8KA 3QDJA 3MNVB 4G80B 5IROA 5ANME 5CJQL 4MA3B 1HWHB 4OCXH 2ZUUA 1BZ9A 4Y1AD 4CMHC 5I15L 4N1HB 3F8UB 3V0WL 4GUPB 1UXSB 2ZG1A 3OV6A 2X7LB 2H8PA 2X4NB 3P9LB 5ADOL 1QSEA 4K23L 1ZGLM 2GSGA 1U8OB 1C5BL 5DD3H 5LWYL 2CKBH 1D5BB 2VXQL 4M61A 4JPKL 3B8YA 2G75A 4RNRB 5IB1A 1JZ4A 3K4AA 1B4RA 3LHPL 2CMRH 3MNZB 1MCOL 3O6FB 1IEHA 5DJAA 2I27N 3MC0A 5BZWB 2O5XL 5EU6E 5E8PB 1V7NL 3QFJE 3FQTA 5F3HB 3NBNA 2O93L 3I75B 1JPGA 1JZ3A 2FGWH 2H9GB 2Z92A 5GHWL 3DIFB 3EOTL 4JG1L 5LG1A 1QNZH 2E7LC 3IXTB 2COQA 3FKUS 5DQDL 3HHRB 4X0KB 3MV9A 5E5RB 4YHZL 2JIXB 3BIKA 5T3ZE 3KLAA 4BYHA 4QHLA 1TCRA 2A77L 1WZLA 5IJKC 2XKSA 4D0CB 2APFA 3ZT6A 3CUPA 5DD1H 3IGAA 2VH5H 4JHAH 1MEXL 2V5MA 4P57B 4NZRH 1S5IH 1Y18B 3FRPA 3UYRH 2R4SH 5IB4A 3V7MA 2F15A 3KJ6H 2ITDB 2JTDA 4HMCA 4M48L 1I8LA 1WT5C 5L8JB 2ZSWA 1N0LA 2ICES 1JHLL 4RMUA 2VITA 4KKCD 3TJHC 1P7KB 1FO0L 3KYNB 1QACA 2PN5A 2DTML 1ZHLA 5KZCB 1UWEH 5IT2H 4XRCB 2FEDC 3R1GL 1WCBA 3D39B 4XC3L 4AEHL 2FYYA 2CLRB 1HZHL 4GMSL 3GI9H 4OZHF 3KLHC 2FCBA 2R8SL 3QQ3A 4BZ1L 1EK3A 2Z35B 3EYQC 4NQTA 4XC1L 4FFVD 3MMEB 5JMRA 1QBML 4HUUA 3O6FC 4UT9H 5K9QI 5FYLH 1AR2A 2ID5A 4MQSB 4U1MA 4XP1L 1OGTA 2I5YL 3HTLX 1TPXB 3LKSB 1L7TL 5F96L 2YWZA 1NC4B 4G8EB 1OP5K 5IVXA 2N1KA 3VFMA 2IANE 4X5WA 3Q5TA 3C9NA 3QWQB 4PGCB 2AJUH 2EE6A 4J4PA 3BD4A 3BVNA 1BOGA 3JWOH 2FBJH 3IDXL 1NC2A 1OQXA 4RMTA 5HHMB 4Y2DC 4A6YL 1OAXL 4WRLA 5BO1H 4JZJB 5HHOA 3QT2A 4WTZG 2OS7A 1CQYA 4ETYA 1KOAA 1YPZA 2BSTB 3WUWG 1NUNB 5TDNA 3VFWA 1ACYH 1SEQL 3KAAA 2P7TA 3CXDH 3B9VA 4B5EA 3OJDB 2I26N 4NO3A 1P4BL 1J11A 4R0LC 1NFDF 4JFYB 4KK6C 2PW1B 3QWOB 5EUOE 1G7IB 5CGYD 1N64L 4DTGL 5DMKB 5F7WC 4YJZL 5HD8C 1FNEB 1M7DB 1AQDB 1S7QB 5D7IB 1YQ2A 1H3XA 4BUGA 3ARFA 3MGAA 3ZE2F 1DSFH 2VLME 5A16B 4ZS6D 5BS0D 3SO5A 3T3MF 3PJSB 4IRSD 1BBDH 32C2B 3SE3C 1J86A 1LVEA 4G7VH 4OSUL 3DLQR 2YD5A 1I8KA 5DO2D 1CIUA 1NH6A 2LFGA 4JKMA 4ZO8A 1L0QA 4HH9B 1KJ3L 4YXLL 1U8NB 1V05A 4G6KL 3STZA 3LV3A 1H3TA 3CZFA 1CQKA 3BP5B 2FX7L 1S8DB 1X3DA 3O4LD 3T0BA 4ONOA 4HWNA 2J88H 5C86A 3L3DA 1ED3B 3PGDA 1KCSH 2E7CA 5DEFA 4F9LA 3SKOA 1KXVC 3JUYA 4WW2A 1EFQA 1YEHH 1T83C 4HS3B 3T2OA 4JAMB 3W5NA 4NN7B 5CWSB 5EIQA 2A74A 4JZJC 3V9FA 5KANI 3LVEA 4U3CA 1A7BA 3UTTB 3LDBB 1FRGH 4M1CD 4HWBL 5EBGA 2QKIB 3HUJA 4YHNA 2AEPH 4NRZA 4MCYA 4F9PA 4PP2B 1IAIH 4RAHA 1NL0H 4MD0A 3RY6A 3T2NH 3VWJA 5DK2B 5K59E 2UZXB 1EV2E 5D1ZA 5DLML 5KSBF 4IMLB 3H3PL 2AEIT 3PV6B 1R3IL 3U2SA 1KPVB 3ROLB 3DVGA 3Q0HA 5DR5H 3TT1L 5CJXA 1FDLH 5T3ZL 5E1AB 5L9DH 4CMMA 2VSCA 2R2CA 3V5DA 3STLB 4ELMF 1XF2B 3VFGH 1NUFA 3BKJL 5KOMC 5I1IL 4JDTL 4KK8C 4ZD3L 3F7VB 4P3CL 3E3QE 2ZCHL 4TQEH 1B90A 43CAA 4HD9A 2KKQA 2WP3T 5GRVL 4XCCH 1MF2H 2JJVA 4GRMB 4JRXE 5DVNA 4YPJA 4FQCL 4HPYH 1NGYA 2YA2A 3PP3K 1JPSH 3H8NA 3ARPA 4F7CB 3X12B 3OKNA 4OCNC 1WFOA 5JIHA 2ZOLA 1B4JH 3NAAL 2X05A 1FJ1B 4PJAB 1OW0A 5I75C 2HH0L 4NQEB 5EA0H 5TH2A 3ARRA 2GSIA 4FFWC 3KWWA 1JV5B 2XY1A 4PJIE 3C5JB 5IFJA 4JPIB 3VXNB 3SKJL 1MJ7H 1OAQH 3W82A 3LDBC 3VDAA 2RCSL 1ZGLB 5JZ7D 4Z7UB 1QUNA 3VH8G 3GHEH 1LEKA 1T89A 2OMBA 5EOCL 3VCLB 4MQXC 3L3OB 4GW5B 4MNHB 3ARDA 1RURH 4S1QH 5CBAA 2XZZA 1VERA 2R1WB 3QUMA 4G9FA 1U42A 2CO7B 4W6WB 3D3VB 1A6ZB 2FDBP 4UNUA 4Z78A 3D85B 4OLWL 5BW7C 4DVRH 5F7FA 2QHLA 2XWTB 4OAWA 5CMAB 1BF8A 4KMTH 3PHSA 2AJYH 3QIBD 4JANB 2VDQH 3WHE0 5A3IC 1ONQA 2QQKH 1CDJA 5D1QC 4ODBD 3RI5F 1SMOA 4CVZB 5ITFB 3U46B 5DRWB 4D9QD 3GSWB 5DDHB 1L6ZA 4QXTA 4LEXH 3QO1A 2PW2B 3W9EA 4YDIL 1FE8L 4OCYH 3ULVE 4FQQA 1MJUL 3CU7A 5DHVA 5MI0B 1G7PB 2AK4A 4K8RL 4QXUL 1QFUH 1OARH 3O41A 2X4UB 4RFOL 3VG0L 3BGFB 1E28A 1TENA 1G7HA 1MIMH 3PIQB 3MV9E 5T1LD 3L3GA 2E8YA 2CGRL 2H2PD 1GGUA 2GK0A 3P4OB 3S98A 1EJOH 5E2TH 5TGBA 5JUEH 2HVJA 1U8LB 4PJXA 4YDJB 2F5BL 1LK3H 2DQHH 3MOBH 4RWYL 4NQXB 1C5DA 5TDPA 2FGZA 5HYSB 4HCRA 5EU4B 3ZLQC 5F7NC 4R4BB 3O45A 3T0EC 5I1EL 1CL7H 3RUGF 1RZFH 3VFPB 1CN4A 3Q6FA 4ALAH 2B4CL 3VXRA 3QEHB 3VXUD 5DEZA 2DL9A 2GJ6B 4HZLB 3TN0C 1MLCB 4G9DA 3IVKA 2VRAA 4MNQD 4FQXD 4YNYA 4PJFE 3HG1D 4I3RL 3O2DL 3WXWL 3W0WB 5F9OH 4ELKB 4PR5B 2HWZH 5I66A 1PKQA 1ZEAL 1UEMA 2DQTH 4KROC 5CJOH 3EHBD 2BC4B 3O3UN 2ARWA 3FQXB 4S1RL 4OKDA 5CILL 1TZIB 3BE1L 5KSAA 1J1PH 3TNNA 1DDHB 4U3HA 2V5SA 4GKZB 4FQIL 1Q9OA 3KR3L 3CXHJ 2XXCB 1NCDH 4LF3B 4IRZH 2C9AA 5HHVL 1EO8H 3BUYB 3EGSB 3AU1B 3G6JE 3MJ6A 4NKIL 1JNHB 4JY4A 4K94H 1OTTC 4S1SL 1NCWL 3QCTH 1CU4L 4WO4D 4XPTH 2A6JA 2B0SH 1A6AA 1LP9A 1A6WL 2OR9L 4C58B 1FG2A 1ZLVK 3IFPB 4R3SB 4Z7QF 4I2XE 3AMLA 1HHIA 1C12B 3I6KB 1HKFA 1DEEB 3HI1A 3DO7A 1CS6A 4ZYKB 4PP1D 3CPLB 4JG0L 4P0DA 3U6RB 5IFAL 3L3HA 2VDOH 2BK8A 4PB0L 1KLFA 4U1GC 3QCUH 1YUHB 1IKFL 2R0KL 3QDMD 5GRUH 3STBA 3TBYB 1KIRB 4H20H 1FL5A 3VFVA 1FBIL 3ZTNL 4S2SB 1RZKL 5HHQB 1RFDL 3WHXA 2Q86A 4ZFOB 1QSVA 2HTLC 1SQ2N 3DETD 1I3VA 3MLPA 1CFVH 4NJAL 1NUGA 2CLVA 5D7SH 5MEPB 1XAUA 4N0FA 3C5SA 3RIAF 4HXBH 4EVNA 5F7HA 2R1YA 4X5XB 1S9VB 3AFLA 3GZKA 3K74B 2IPTH 2MSPA 3P4LA 1I8MA 3A6CL 5D2NB 5A2IH 1TVBA 4KI5F 3OAUH 3C6SB 1OGAD 1XGPA 2P49B 2P5ED 5C1MB 2HT2D 4HJ0D 1VGKB 2D2OA 4I0CC 1T4KB 4HPOH 5D71L 5DFTA 3G04B 5DJ0B 3TZVC 4Y4HA 3MLWL 2R0ZL 3RU8H 5B8CB 3MRRA 2MFNA 2NCMA 4OZ4B 2ICWJ 4XZUB 1X6LA 4KJWD 3QZWA 5JOPE 4OBRA 2JB6A 3SY0A 5IESH 3KDMA 3KYMB 3SDDD 3R06A 2F74A 4ZAKD 3NACH 4XMKH 2Y7QB 4QTHA 3SPVA 3RX8A 1V3KA 4EOWL 5KTEH 2OL3L 1HOCA 1WC7A 1WISA 2FIKA 3UTSA 1W0VB 1KTLA 5EWIH 5GSRB 1JP5A 4RSVA 1RZJL 1T1YB 4XPGH 4LVHC 5GJSL 3V0AC 3UTZB 3VRIA 1RVFL 5IR1B 1IC5H 1P53A 3HC0B 3O8XA 3GMLB 3ZDXE 4PRPA 1XGTA 3RA7L 4NNPH 4TRPL 3NIFF 5CEYB 4PJ5A 8FABA 4WTWA 4ACPA 4JZNB 2DIAA 4ZPVB 4U2ZA 3EO1A 4TSBL 1IGYB 2WINA 3TO4C 2YN5A 2Q8BH 2XA3A 5IB2A 1A0QH 3JTSB 4TOYH 4RMVA 1O7VA 3WE6B 2YPLA 1A1MA 5C6TL 1YC7A 4MLSA 1K6QH 5C0CE 1FYTA 1LD9A 3FT2B 2Y25A 4NQCE 2YUXA 3VXSD 3LRHA 5HGAB 4TSCL 2CDGA 5HI4C 1BFVL 1W72A 1KN4L 3IJYA 1U8JB 2VXVL 3V7AE 1B2WH 5GPRA 1YEJL 2C1OA 2NLJB 3UZVB 4L3ED 1O0VA 4I77L 5M94B 3GMPA 3TPUA 3BH9B 3ARQA 2Q3ZA 5SX5H 1G6VK 5B8CC 5D6DA 1NBYA 4LK4A 1L0XA 4WGWB 2P24A 1MAMH 2IG2L 3U7YH 3UP1A 1OAYH 2VKWA 3T65A 3BXNA 3IJHA 4OJFL 2JELL 1X4ZA 2P1YA 2QR0A 4M4PA 4ZUUB 2CRMA 2EYRA 4R96B 3S37H 5C0EB 5J13B 3RL2A 2F54B 5SWSB 4R7NA 4CAGA 4XHJC 4HKJB 4F37F 1E4XL 1JE6A 2DLGA 3RWFA 2V2WB 3E8UH 5HSFA 1KB5B 3CIQA 4OQTA 1D6VL 3EIFA 4MNGB 5FYJH 4PLKC 5IQ7H 3GMNB 4M8QA 1T6WA 2WUCL 5ERWB 1RJZB 4K3HA 4K7FA 5F1SA 3SJVD 3VFSB 1J88A 3KLDA 2OLDA 4FTVB 4ZXBA 5EU3B 3MXWH 3SDXA 3MFFA 1BEYL 1QSFD 2G5RA 4PB9H 3IAPA 1JF5A 4NFDA 4PRNA 3RY4A 1TNMA 5DS8A 5IROC 3WS6A 4EN3C 3SQOH 5D1XA 4N0UE 3FL7A 3CXHK 4DQOH 1TQBB 2EE9A 2VABA 4QRRB 4PLNC 2ADGA 4J3VA 5J1AB 5BJTA 5JW4R 1I1CA 1U9KA 4PGDB 3ES6B 1Y0LA 5AZ2L 2ZNXA 1EHXA 2FH8A 15C8H 3GKWH 3QI9A 3QUXA 5CIPB 5C8JA 4Z77A 3DMMA 4PGJA 1T6VN 1I9RH 1I7TA 3KJ4B 1RMFL 1INDH 1IGCL 3KXFE 1TJIL 1I9JL 3ZKMD 2X70A 2VLKD 4KQ3L 1U92B 5GIRA 3GSNB 2Q87A 1UJ3A 2NX5B 3RNQB 2DTSA 5AUMA 4XVUD 3KNBA 3RAJH 25C8H 4NKOA 3V4UL 1F58H 4FQHA 4P23A 1C16A 4AQOA 2F5AL 3O3BA 3PP4L 2XFXA 1S9XB 4EJ1C 3FRUA 1YY8A 4UI2A 3VD7A 2VDRH 4NM4H 4R8WL 1PSKH 4IDLA 3VMOA 1IM3B 3T4YA 2ESVA 4NHCH 2A83A 4LQFH 2BNQE 4OIIH 3DXAA 5CSZB 4OLVL 3CFKA 5T3XD 3V8OA 4Z7VA 2BMKB 3ZYOA 3THMH 5LGHL 1I9EA 5ETUA 3KPRD 3OKLA 3VJ6A 2OJEB 1MPAH 1OTUD 1CDGA 5IMKA 4X9GA 3RI5K 3VA6A 1F8TL 5DD0H 4NZUH 4NZTL 1VPOH 2BVOB 4KPHL 4HMEA 3IU3B 3OGOE 1I8LC 4Z6AT 1WSST 4I3SL 4KDTA 1P69B 2W9LA 3V6ZA 1T1WA 2BDNL 4L4TA 3OL2A 3LKNB 2EZ0D 4O2CB 5BOZG 2ED7A 1YJDC 2IBZX 4JHWL 1QBLL 3GSXA 3W39B 1C08A 4Z7WB 2YSSA 4EZMA 2XY2A 3MLYL 4QNPF 2VDPL 1I7RA 4JO3L 3L6FA 3BDXA 2XPGA 4PY7A 5F7EL 5E08H 4WUUA 3MV7B 3T04D 3S4SA 2ADJA 1XR8A 3QUKA 4GXVH 4I48A 3RWHB 3UO1L 1BVZA 4WFGD 3IS1X 4JDVA 4PRIE 2OSLA 3N1QC 3QG6B 4DGVL 1PQZB 2PYEE 1RU9H 4K7PL 4W6XB 4M6ML 2WUBH 5LBSL 2DD8H 4X7TB 3QJHB 1G9EA 2FR4B 1U95B 2DBLH 5F8RC 4G8GD 4JM4L 3DSNA 2AERT 4F3FB 3S35L 3HPLB 4DEPB 4D9LL 1GPOL 5KSVB 3I50H 4ODWB 2OTWB 3IDYB 1FSKC 2IALA 4NQDD 2C3VA 1KXQE 5MEOA 3FO1B 5L6YH 1KJMA 4UIMB 5LAXA 5SX5K 5FHAH 4LSSL 1C7SA 2AEQH 3QEQB 4HEME 5J3HC 3TJEL 4WEMB 2VLJB 3ARXA 4LSQL 1CF8H 2ZUWA 4U1SB 2QSCL 4LLMA 1F2QA 4QYOA 2X4QA 3EFDL 2I24N 4P48A 2EDEA 4LVNB 3LN4B 5D7IF 3PQYD 3D18A 5B38A 4LEOB 3FONB 4NGHH 4P4RA 1U3ZA 2GEEA 5JXAL 4HKZA 2FO4A 5BVJB 4F7EB 1HHKA 3PGFH 5JOEA 3DRTB 3RVWC 5FV1L 2WWMD 4OF3A 2BOCB 3VXME 3H9HB 3B2UC 5LGJA 3WO3B 3GBNL 1KCRH 3L5WB 5LCVH 3PF2A 5D2LB 3MJ7B 4U1JA 4XCFH 3ZTJG 4FNLL 5DURB 2VYRE 1YYMH 4HCRL 5JW3H 3V52L 2PTTA 3FTGA 1XGUA 3ABZA 3H9SA 4JPWL 5B3JF 2VO5A 5BCAA 2N56A 5TE7L 4UINH 1X7QB 3MRMA 2Y4SA 2JCCE 1XCQA 2NNAB 3O9WD 3O0RL 5D6CB 5ESAB 3T3ME 5C2BH 3ZTJH 5CLWA 4AJ0A 4DEPC 4NM8L 1XGRA 1KCUH 1TQCC 4KTYA 4KMLB 2EYSA 4HXAL 4YPGB 5MERB 5EC2B 2XWJA 5C08E 1K4DA 3MRCA 4BKLA 1S9YA 2B5IB 2XG4A 3GGWA 2JJUA 1A4JA 4Y4KB 4UILL 4D0BA 4OLUH 1FNGA 4YHLH 1AGDA 5CINL 3X14A 2WBJD 3GHBL 1RIVL 4LVNC 2IH3B 1KC5L 1GOFA 1R5VA 4XH2B 1Z9SA 3MUGB 4G7YL 2NR6C 1KIQB 2QADB 2VLRD 1AXIB 4XI5D 4XNMA 4ZQKB 4PRHE 1LO5B 2HVKA 1G1YA 1YDPB 4QY8A 1T5WA 4Y5XC 1OW0C 5IJVB 4RIRB 4EDXB 4MXQD 5E8NB 4UQ3A 2QQLH 2EKSA 5E94A 1SYVB 5DFVD 3UTPE 4P46A 4G8FB 3JV4B 3NZHL 3B3IB 1NEUA 4HWZA 3LKPB 2VISA 4QRPA 5B3NA 1OOAA 4N8CL 4JFFD 2VL5B 1FZOA 1A7RH 2VDKH 4XNQA 2FECL 3A6BL 3RL1A 1MI5B 3UBXB 1TNNA 4PJAF 3FFDB 1N7MH 1DE4B 3MV8A 4P5TA 3LMJH 3VRLE 4X6FB 4JO1H 5EZOH 4BK5A 4M03A 4J23A 5HXMA 2FSEB 2HA1A 3AB0B 4QXGH 3U7WL 1I1YB 1FL6A 3LQZB 4HSQA 4FABL 3MLXL 3AXLB 3QHFH 4U6VH 4O9HL 1EFXB 4BFGA 4M43L 4NCDA 3SDYL 3NCBB 4F7MA 5EPMA 4O4YH 4Z7UF 4Q9QH 5DGQA 2I9LB 1J1XL 5JHLH 1JGUH 5FA4A 1RZIB 4QOKD 5GSVA 1I1AB 3O2VH 4RWHA 3R8QA 1YMHA 3UROR 3QH3B 4HUKB 3P30H 3OQ3B 2GFBA 2YD3A 3BHBA 2QADC 2YHGA 5C0AA 2A9NL 3CJJA 3I3BA 2KUTA 4WHYG 4F7TB 1AGBB 3W5MA 3EYVA 2HKFH 3MYJB 5FGCB 2Z8VC 3PWLB 4F37K 1K4CA 2X4PA 3RNKA 5KVDL 4YDKH 1KTDA 5ILTL 3D69A 2KZWA 4OF0A 4HGWB 4K3JL 1EVTC 3QP3A 1DVFB 4V1DE 3ULUC 4R4NC 3FO9A 4AT6B 5CD3A 2IAMD 1DUYB 4OCWH 3VXPB 3WUZA 4M6OH 4QRQA 1BBJB 4A2LA 3CVHH 3QULB 4ONGH 5T1KA 3HI5L 1QRNB 5CP7A 2IQAA 1CK0H 3GO1H 3FOLA 4LIQH 1GOGA 4MS8D 5HYJD 2R2EA 3S7GA 2QJDA 1OAKH 1J0IA 2JJTC 2CXGA 3D48R 4L8CB 2HRPH 2DQCL 4OGXH 3KLHD 2VXSL 3G6AB 2NY5L 3RTQA 2WP3O 3TP4A 3ILPA 2BFVL 4LASL 2NXZC 5D5MB 3UPCA 1T22B 4M6NL 3TBVB 5GS0L 3BSZH 3KPTA 3GNML 1RZ7L 3F5WB 2FJHA 2JE8A 4LKXA 1O7SA 3D0LA 1I1AC 1IQDA 2VDML 3AREC 4QGTA 4PJEB 1G7QA 1K3ZA 4WW1B 3C8KA 2IAMB 3QNXA 3EJZC 4P2RB 4UTAH 3O11B 1YMMD 1J9CT 1MH5A 2MCPL 3SKMB 3G9VA 4MA8H 1BQHA 4Y2DD 4JZOB 4LAJH 4YC2B 1FFOA 2EH7L 1FAIL 4Y19B 1U58B 1ORQA 1GHFH 4RISH 4YEFA 5CJ8A 5TE4L 4HAFA 4DKFH 1P7QD 2ZZUT 3O3AA 4ZOEA 5F8QC 4IRJB 4CADA 1D5IH 3SKNA 3ZDZF 5M7QA 3BH8B 4X99A 1IM9D 1FIGH 1Q9KA 4RX4D 4Z5RA 4C83B 5KW9H 3DX9A 1AD0A 5IB3B 1CGSL 4MJ6A 2H6PA 1ZWIA 3RGVB 3FQRB 3EO9H 3E6FA 1UQSA 3SGEH 2VDNH 4IIQA 1RK1B 3HMWL 2EDLA 5D9SB 4AMKL 4RMQA 1G0YR 4UT7L 5IFHL 4NO2B 4OKVB 1BD2D 4D2NA 3QXAA 3ARVA 2DKSA 4YQXH 3NTCL 1NGZB 4LCIH 3NH7L 1AHWB 4DN3H 2P8MA 3GMMB 3FCTA 5AEAA 3REVA 4OT1L 4PV9A 1FZMA 3IDJA 1BLNB 1DUZA 3ALPA 3OX8A 3T0XA 2NY1B 1ZKAA 1S78C 2BNRA 2DQJH 1V7ML 3C5ZA 1TJHL 2W07A 3VXQA 4OCRL 4WHTB 4HEPG 2VLLA 5J9PB 2WIIB 3HZYA 5C0DB 4GS7B 1YNTB 3V79C 1FPTH 5ACMA 1YN7A 3LPGA 1DQDH 5I8KL 2IF7A 3BISA 5GS1A 1NCNA 1HWGB 1HXMB 3LRGA 3TA3A 4KUZH 2W0FB 3HNSH 4WV1B 3S34H 4U1LB 3FN0L 2WSKA 5C9KA 1CFQA 3PWNB 4U6XB 4NNYB 3OHXB 3LRSB 4AH2A 4YXHH 2PNDA 4J2XA 1NMBL 5KS9E 2JJWA 3H9SE 3PL6C 4IRJC 3MRJA 2H41A 4JFDD 2ZSVA 3FFCB 3NVQA 5ALBH 1CIDA 1DBAL 4RMSA 4HQQL 4FFZH 5EG6C 3ULVL 1NEZG 4Y16D 4WWKB 4OZIB 3FHAA 4N1CA 3HZMB 1URLA 4XVTH 5HYSG 5JHDD 2EIZA 1IBGH 1UWGH 5D7LB 5FYKD 2Y36H 3O2WH 1CD8A 1IGML 4MHHG 4HH8A 3W2DL 2NW3B 1AHWC 4NUGL 4PTUB 2XTJB 1HIMH 4KK8D 2XIDA 1HEZB 2HMID 3DI3B 3MX0A 4LSVH 1ZLWH 3EFFB 3VFNA 4HFUH 4JFPB 4YX2H 3WYRA 3WCYA 2C26A 5CZKA 4LGPB 3ZL4H 2NY1C 4Q7DA 1T80A 4DAGL 4LSTL 3B9AA 4NQSB 5B39B 4FQ1H 3DTXB 1JI2A 3QHZH 2NY4D 2R56H 4DZBA 4GS7C 4LHUA 2YK1L 4L29B 5I17B 3WFEL 5FUZL 4WNQA 1R3HA 5E00B 1FVEA 4WV1C 3TBTA 3DGGB 5KG9B 5FCUL 4QRPE 3C8DA 1RJYB 2VC2H 3LKOB 2XN9D 3SGDI 1FO0B 5DA4A 3HCVB 4XP4H 2YPKB 4XPAL 2HN7A 4HX1B 1WFTA 4LLQB 4WHDA 4X6BB 1RQ5A 4JFZH 5KOVC 2YUWA 1UACH 1VACA 1JPTL 3WHE1 2GY5A 3UX9B 2W0LA 5EZLA 1SVZA 1SJEB 1J1OL 2YWYA 2I25N 1ZMYA 3RZCB 3PWJB 4XMPL 4NYLB 4XAKE 1T04A 4M1DL 2NY2C 4MYWB 4GG6B 4NQVB 1G7MA 1AKJA 1RUKH 4D0DA 1A5FL 1I85C 2BJMH 3BPCB 4XNUH 4MVBD 3M17B 4GAJL 5D1QD 1QR1B 3M45A 2XTJC 1HYSC 2BSSB 1WBXA 2EECA 5F1NA 2ICEA 5IW6A 4A6YB 4PG9B 1I7ZA 4MJ2A 5BVPL 2D7QA 2DJ4A 1MCBA 1FZKB 4HF5L 2W0KA 1S7WA 3ET9F 3EYOB 1YZZA 5KVFL 1CD1A 4IRSA 4X4YB 4TNWF 1A9BB 2AJSL 3S88H 4GOSA 5DMIL 1CLOH 3BN3B 2J8UB 5GGRY 4OGAC 1ORSB 4NN6B 4UU9A 3BEWB 4F33A 2VZOA 3MACH 2F9BT 4FZEH 1UM5L 3WNNA 3BP6A 1LO0H 3DX7A 5J89A 4DN4H 4L8SB 3WDJA 5FHBH 2MPAL 3HE6A 2X4RA 1G6RA 1IGIH 5BXFA 3NA9H 2UWEB 5J12C 4X6DA 3T0ED 4WI8A 3QXUA 1JK8B 4LMQE 4EBQL 3PXHA 2D9CA 4PG2A 4PRBB 1QKZL 4ZUTB 1MCPL 2CKBA 3TN0D 5IWLC 3T0WA 3Q1SH 5D8JH 5ANMB 3OZ9L 5IEHB 3QCVH 3WKNA 1P5VA 5CJ5A 4OV6F 3RKDC 2DQFA 3NFSL 2P8LA 2PF6A 4YXKH 4AIZA 5FM4A 3Q2CA 1AO7E 2DQDL 4KROD 3MRDA 3D25A 1F02I 2N7AA 3D9AH 5DJ2A 3WS3A 4HT1L 3HRZB 3OKOA 2EYTB 4JO4L 5ENWB 1OHQA 4CW1A 4K9EL 5IHBA 4R9HA 1PW3A 3QIUA 1UVQB 2GAZB 5CCKH 2VZTA 3WIFB 1UCBL 3GJEA 4MQTB 1C1EH 4XX1G 2X4TB 4C59B 1JF1B 1AIFB 1YECH 1YN6B 1HNGA 3FOMA 3CFCH 4NC1E 1LEGB 1FGNH 5EU6B 5F7MC 1GGIL 1KNOA 1GAFH 3QFJB 3UMTA 5A2FA 3ULSB 1OTTD 1JUFA 3IAGC 1W2KT 2PETA 3GIZL 4NN6C 1LO3L 3X13B 4WI6A 3VGGA 2RHEA 1KENH 4NRXB 3CK0L 4XVJH 3FB5B 1G0XA 1BVLA 1TVHB 4FXKA 4X9BA 3TESA 5DZNA 1BZ7B 3ZYIA 4L8SC 3NFPA 2X4OB 4KY1H 5C0BA 2BRRL 2VN7A 4UT6H 4Y5YB 3KVQA 4M7ZC 4CDHA 5K9OB 3GEWB 4C56D 2PUQT 3BZEB 1MFDL 1LO4L 2LAAA 4HIXL 5DQ9B 3F65A 4O51B 4DUXA 3F12A 3BD3A 4OB5H 1NFIA 4QWWC 3NFNA 4ODUB 4Z7WF 1U3HA 2GI7A 3FHQA 3LH2L 5T33H 3SE4A 3VI3E 4Y1AE 2DDQL 3MR9B 3TIDB 4LSRH 4YHYB 3OPZL 1ZLWK 4H8WL 1TXKA 4CGTA 1ZT4A 1NANH 5DD5L 1Z9LA 1EHNA 5IMOB 4ZDHA 4KXZH 1CXLA 5HY9B 3DURB 1VSCA 4O02L 1R5WA 5MEND 5JORA 3H0TA 4LFHG 1AGEA 3MJGX 1KG0A 3QIBA 1KB5H 1PX3A 3TZVD 5GZNC 1H3PH 4JQXC 3NPSB 2IANB 1JFQL 2DLIA 1UM4H 1J5OH 1HQ4B 3QNYB 4L5FL 1A2YA 5H94A 2UYLA 4XP9H 1MCWW 4BSWB 1T03L 3MROB 1H15A 2GHWB 5E2UL 3L3IB 4UV7H 4WTZA 4J3UA 2HFGL 1SM3L 4XGZA 1VKXB 3KYKL 4HUWB 4OUUA 3WUWA 5I8EA 5IHLB 4Y5YC 4ODTL 3VGBA 2F53A 4Y7MA 5T1LA 4G8IB 4GKNA 4J8RA 4JY5L 1CXEA 5HHXL 5JDSA 5C07A 4QF1B 2DKUA 1HKLL 5EUOB 3JV0A 2SEBB 4BQ6A 4EDWH 1MRCH 1XEDA 1YJDH 5GGVY 5CZXD 4GAYB 4GBXB 5CIPH 2C4XA 4HFWB 3ZE1E 4S1DC 5IBTH 1ZK9A 3ARBB 3TO4D 5AD0A 1EHLH 1QHPA 3OGCA 4U1HA 4YHYC 4PRDB 4GLRI 3GSNH 3RBGA 5E03A 3VXUA 4FQXA 1A14L 4LCCA 3HC3L 4XNXH 3HG1A 4P9HL 4KRLB 4E5XA 4KH2A 5HI4D 5D2LF 3V0VB 4FQJH 3V5KA 4NUJA 1FC1A 4U7SA 4LLAA 4B7IA 3IXAA 1IL1B 2WZPD 1FL3A 4AG4L 1HCFX 2UZYB 3IFNL 1HHHB 4HGKC 4ZUWB 3VU2A 4DOHE 4MAYD 1EEYB 2FATL 3FQUB 5HYQB 2HLFD 3OKKA 3U1SH 5EO0A 2AXFB 5DSCA 4YZFE 2IFGA 4X6EA 3MBXL 2BSED 3RDTA 1GIGL 3LZFL 1UZ8A 4JGJA 4HULB 4P3DA 5IP4A 4U0RB 2ZUTA 3IDGA 1T21A 1INEH 3CFEB 5DMJB 3G6DL 3WIIL 2FEEI 1N8ZB 2HFEB 1XF3B 4OGYH 3D2UB 1FVDA 2GITB 5KVGH 3BMVA 1IC4H 4LU5L 1V3JA 4WI9A 1A7NH 2AXGA 5HGHB 4PYGA 5CUSL 5F9JA 3S3JA 1NAKL 4WO4A 5GGTL 3DUSB 1QO3B 3QDGA 3QFDA 5CP3A 4OLXH 5JPNA 1ZVSA 4JFED 3MRHB 5E8OB 3RWCA 5HHPB 5B3JE 4WDIB 4E42B 1BJMA 4QRUB 5TJWK 1MWAA 1OPGL 4GBXC 1CE6B 1S9WA 4OZHA 4E41D 3AM8C 3QDJD 3JBG7 3TT3L 9CGTA 1JYXA 2R9HD 2MMXA 4RGOH 4YHOH 5GISL 2ICCA 1ZA3B 4EN3D 5BS0E 4MXVF 5KSUB 4I1NB 2B1AL 4XNZC 4EQ2A 4UAOB 2Z31A 5D72L 1YQVH 3OR6B 1KLGA 5EU7E 4FXGA 1CXKA 5HI5C 1QSED 4XCNA 3DSFL 4JRXB 3SBWC 3KPMB 2ZJSL 1MHCA 2ZOKB 1YEEL 5ITBL 4P49A 5GRJH 2F19L 4LCWA 3RBSA 3IDMB 4HK0A 3WNLA 1Q8MA 3QSKB 1IAOB 4NBYB 3O4LE 2FX8L 4HS6B 1T2QH 1A7QH 5FKAA 4X6DE 4GT7A 4DVBB 1DBJL 2ADIB 4U0RC 4PJIB 4UTBH 4ODVL 1FLTX 2P5EA 2CQVA 4DZ8A 4MXWL 5F89A 5GGSA 5E99H 1NFDA