3B6CA

Crystal structure of the streptomyces coelicolor tetr family protein actr in complex with (s)-dnpa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
214
structure length
202
Chain Sequence
b'MAPLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEVEVPEPEPGRWAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDELAAYGGDLLSTFVTAEALEQSSRVFADQLHGYLKSLPATSFPNLVHLAGPITSLDSDRRFELGLEIIIAGLLAGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ActII protein
publication title Crystal structures of the Streptomyces coelicolor TetR-like protein ActR alone and in complex with actinorhodin or the actinorhodin biosynthetic precursor (S)-DNPA.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 79
structure length 202
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3b6cA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3b6cA02
3BNIA 1WGXA 3S17J 4A3BJ 3JRHA 1QVUA 3CMYA 1MBKA 2YUSA 3GTMJ 3GTKJ 1JKQC 2K9NA 3BRUA 1ZQ3P 3BQZA 3CJDA 2FQ4A 2HXOA 2JA5J 2L7ZA 1JT6A 4DYRA 3BTCA 2H8RA 2YU9J 1MBJA 2XDNA 2JA7J 1GUUA 3BR0A 3PO2J 4MK6A 3HTJA 3TW6A 1MSEC 2JN6A 4M3FA 5EFYA 2JA8J 1A5JA 3A02A 3BG3A 3PM1A 3BG9A 4I76A 4M6VA 4GCTA 2E2HJ 1WCMJ 3FIWA 2UXHA 4C3JJ 3F0CA 3LOCA 2CU7A 5M5XJ 1HOMA 1B8IA 2EZKA 4EEFG 3ZQLA 1P7IA 2LK2A 5EG0A 2EQRA 3JRBA 3TP0A 4ME9A 2O7OA 3D1NI 3HOUJ 2EH3A 2EZLA 4A93J 1XS9A 3G56A 3SFIA 1HF0A 1BW6A 1TWHJ 4FE7A 1ETVA 3CQZJ 3S5RA 2KT0A 4D5FA 1IJWC 1TWFJ 2G0EA 1JTXA 3LJLA 1OJLA 2NVTJ 1GV5A 5J1YA 3HOZJ 1APLC 3BR6A 2QIBA 2M34A 2XGDA 5FKOA 2R93J 1E3OC 3M4OJ 3V6GA 1U9NA 2E2IJ 1JUSA 3JRFA 2UXIA 2Q24A 5C44J 3VP5A 3MKLA 1YRNA 3OSFA 2EZHA 3NAUA 2P81A 2Y9YA 2OERA 1IG7A 4IHWA 5FKLA 5IP7J 5EYRA 4AUXA 5DTDA 5EDNA 2HI3A 3GTLJ 5CW8A 1PUFB 3RZOJ 1RETA 5M3MJ 5JLWA 3ZQIA 5C4YA 3ANPA 2ME6A 2TRTA 2VI6A 2X6OA 2R5ZA 2O8KA 3MN2A 2PMZN 2OI8A 4ABZA 2HYTA 5F1JA 4CYCB 1ZGWA 5EF6A 3PPBA 3QPSA 2XPUA 4A3KJ 3LWJA 2CQXA 3AQSA 2E19A 3K7AJ 3HOXJ 3JRCA 3W6VA 3VIBA 4W97A 1S7EA 3LSRA 3AQTA 1XG1A 2ECCA 2QKOA 4JX4A 1K83J 2WAQN 2XSDC 5FHPA 3KKDA 3M3YJ 3ZOBA 3VUQA 3NI7A 2Y9ZA 2COBA 4X6AJ 5FMPA 2ZOYA 3G1LA 3CDLA 1K61A 1FIPA 4UUSA 5IPAA 4V2GA 2YVHA 2FBQA 3S2HJ 1ETYA 1LFBA 5AQCA 1UMQA 2WV1A 2O7TA 3QPLA 1OCPA 3KZ9A 3A01B 3MVPA 3JR9A 4XRMA 4B3AA 1TWGJ 3BTLA 3CRJA 1UHSA 5DS9A 4BBRJ 3SDGA 1NTCA 3LNQA 1HDPA 2NS7A 5CXIA 4JL3A 3HEFA 3DCFA 3Q0WA 1I3QJ 3S15J 2GFNA 2DA7A 2PBXA 2NP3A 1ZR2A 1RPWA 2XPWA 3G1OA 3RH2A 3BR2A 1ZTRA 4FTHA 2YVEA 4MXMA 1MBGA 2X48A 1UI5A 5F0CA 2WGBA 3ON2A 5EGOB 1EF4A 1RESA 3IH4A 2MGQA 5FJ8J 3ZQCA 3RZDJ 3NARA 3S1NJ 3GTJJ 3GTPJ 2ZCXA 3F1BA 4M3GA 3JRDA 2CUEA 5EEAA 5J1RA 4DZJA 2FJ1A 3V78A 4D7NA 2REKA 3ANGA 1QRYA 3S2DJ 3H3VK 1H89C 1UG2A 5J3LA 2F07A 1LE8A 2LR8A 1AHDP 2OPTA 1BW5A 2DMTA 3RKQA 3CCYA 5GP9A 1AU7A 1TWCJ 2DMUA 4B1RA 5C4XJ 3HIMA 2XGCA 3OSGA 1JT0A 1BL0A 4XRSA 2G7SA 3HTIA 2YS9A 3B6CA 3QBMA 1IC8A 4M3DA 3Q0UA 1W0UA 2M9HA 2ME0A 4PXIA 3Q0VA 4DW6A 2LY9A 2Y0SN 2HDDA 1SANA 2VKEA 4XRSG 4BY7J 2LFBA 5M5WJ 2ZCMA 1HDDC 2PZ9A 5FLVA 3HB9A 2WUIA 4J19A 2K40A 2EBIA 4A3EJ 2ID3A 1A6IA 4Y7NJ 4XK4A 5K7FA 2E1OA 3S1RJ 5EGOA 1GDTA 4IHYA 2HKUA 4IHVA 2QF7A 3MNLA 3S14J 3IUVA 3NNRA 4IEJA 2DJNA 1Y1VJ 3HGGA 4UUTA 5JLXA 1NK3P 1MNMC 3JRIA 3HE0A 2L7MP 1CQTA 3KNWA 1B72B 2G7LA 1ETKA 2K9QA 4CGRA 3FISA 4KWAA 4GFLA 5K7ZA 5IP6A 1QVTA 5IOYA 2VUMJ 4FCYA 1XC5A 3GEUA 5K7HA 4A3MJ 4QSHA 1TC3C 2HOTA 2DG8A 2JWTA 2D5VA 1IDZA 4GCKA 3ZQHA 2MSYA 5K58A 1Z77A 1ETXA 2DA4A 1FJLA 1MBEA 3GTGJ 3VW0A 4DZPA 1NK2P 2HXIA 3OOUA 2TCTA 2UXPA 3BTJA 3QKXA 5F08A 3A03A 2B63J 4MO7A 3BT9A 3HOWJ 5FLMJ 1MBFA 2L7FP 4A3LJ 2JK3A 4YZEA 1ORKA 2VPRA 2RHAA 5IP9J 2DMNA 2IU5A 2DA3A 1B72A 3KKCA 1G2HA 2MG4A 1Y1WJ 9ANTA 1I50J 3FRQA 1ENHA 2R5YB 2DMQA 3BJBA 3EGQA 2DG7A 1AKHB 2CRGA 4BBSJ 4NN1A 1PUFA 2GM4A 3IV5A 2KDZA 3O8GA 4XIDA 2E2JJ 5F0HA 1WH7A 1ETOA 3ZQGA 4AF5A 3HGYA 1ZR4A 2H1KA 2R92J 4S0HB 2GENA 4CYCA 3S1MJ 2MW8A 2ZOZA 3BHQA 3S16J 2OF7A 3HOYJ 2Y2ZA 3ON4A 1WH5A 3H0GJ 3WHBA 2ECBA 4A3FJ 2R7ZJ 4A3CJ 4MLOA 3QQAA 4A3DJ 1GT0C 2NOGA 2X9DA 3VW2A 1IGNA 1H88C 2AO9A 3JREA 1JKPC 1UI6A 1VF9A 2L9RA 2CQQA 2NX4A 5IYDJ 2M2EA 4NELA 4L62A 3GTOJ 5E3LA 5F27A 1DU6A 3E7QA 3NPIA 1RKTA 4QTRA 1JTYA 4AC6A 2QTQA 3G1MA 2XPVA 2Y30A 2LLKA 2I10A 5GPAA 1T56A 3FK7A 5IOZA 4JNNA 3O60A 4ACIA 1BA5A 3L1PA 1U8BA 5HBUA 5D19A 1X2NA 2FX0A 5EG0B 5J1UA 1IV6A 2W53A 3HOVJ 4NDLA 1TWAJ 3A01A 5E3OA 2CUFA 1WPKA 3TP3A 3JSJA 3ZQFA 2DA2A 2XB5A 3LSJA 4MFDA 1X58A 1W0TA 5D18A 3LSPA 3O8HA 3VVXA 3VVZA 1OFCX 5FKNA 4BKXA 3Q3SA 3FK6A 2K9SA 4JKZA 5C3EJ 1H8AC 2UXOA 4MFEA 3E7LA 3B81A 1OCTC 2AHQA 3IH2A 1FTTA 2EZIA 1YRNB 4FE4A 1X2MA 3LSGA 5M5YJ 1SGMA 2XGEA 3BCGA 2G7GA 3G7RA 2ZCNA 2RAEA 2HOSA 3I4MJ 2LD5A 1FTZA 2GBYA 1VFCA 2M0CA 5EZHA 4C2MJ 1Z0XA 3BR3A 2RASA 1WI3A 3RD3A 2R0QC 1HCRA 5H9TA 2IEKA 4A3IJ 2ID6A 2R5ZB 5M3FJ 4HKUA 5GPCA 5BNGA 3LHQA 4M3EA 1I6HJ 4LOCA 2IAIA 2QCOA 3HBLA 1GV2A 1MH4A 4D7MA 4RDUA 1T33A 3GZIA 1O4XA 1MBHA 4BXXJ 2JA6J 4JYKA 4UDSA 4AC0A 5E3MA 3S1QJ 3PASA 3BTIA 1P7JA 3HDDA 2W48A 4FISA 3FKIJ 5IYCJ 4QIWN 4I6ZA 1R9TJ 1IRZA 3BR5A 2DTZA 2IBDA 2LKXA 3HKZN 4IHXA 4MIMA 5EZGA 5E3NA 1ZKGA 1VNDA 4JX6A 2DA6A 1GVDA 3K2AA 2GLOA 4UUSB 3VPRA 2ELKA 3I4NJ 4BY1J 5CXGA 3OIOA 3WHCA 2N8GA 3BQYA 1JKOC 4Y52J 3COLA 2NVQJ 3TW7A 5DAJA 1IDYA 2VKVA 2DA5A 2L0KA 1FIAA 4W1UA 3DPJA 1D5YA 3HM5A 4D5CA 1LFUP 3HTAA 5HAWA 2LVSA 1BJZA 3IH3A 1JUMA 2XB0X 1U9OA 2QWTA 3HTHA 2DA1A 5FKMA 3B6AA 2FD5A 5IYBJ 2D6YA 3NXCA 3NRGA 5F0FA 1FEXA 1JJ8C 3VOKA 2LTPA 2DMPA 1MSFC 5FGLA 2CJJA 2HOAA 3T6NA 3C2BA 2NP5A 3GBGA 4GFBA 3PO3J 4A3GJ 4C3HJ 4GCLA 1QPIA 3VW1A 3BR1A 4L5EA 5HODA 2ZB9A 5FKKA 1Q1VA 2QOPA 1F36A 1JJ6C 3CWRA 3SJMA 3VVYA 4A3JJ 4V2FA 1ITYA 1RKWA 4AYBN 2V57A 2GUHA 2JJ7A 4B4CA 1IUFA 3C07A 2DN0A 3JRAA 4X1EA 3JRGA 2NVXJ 1DU0A 1RR7A 2Y31A 5F04A 1JKRC 4C3IJ 2LP0A 3EUPA 1LE8B 1F43A 3DEWA 5HSZA 2O9LA 2NVYJ 3P9TA 4A69C 1VI0A 1SFOJ 3VOXA 4DYQA 5C4JJ 2UXUA 2M8GX 4JP0A 4XICA 3TEDA 2HYJA 1HLVA 1JGGA 2NS8A 5D1RA 2R5YA 3BG5A 2XRLA 4M3BA 3RQIA 4JX5A 1B8IB 1MH3A 4RBOA 1ETWA 4DYCA 4GFKA 1ETQA 4HNVA 3UKGA 1AKHA 3GTQJ 2JMWA 4ICHA 1U78A 1POGA 1JUPA 4G12A 2G3BA 1ZK8A 2WB1N 2HQ5A
chains in the Genus database with same CATH superfamily
1WGXA 2DODA 1MDMA 1TW3A 3GTMJ 3E5UA 5ED4A 1KZHA 3BRUA 3LFKA 2ZBKA 2FQ4A 4L9NA 4XM3A 2HXOA 2CO5A 2HZDA 2H6BA 4PSXA 3KYLA 2H8RA 1PUEE 2DFFA 3QYBA 1H9GA 4C9YA 2JA7J 2FNAA 3BR0A 4MK6A 4D9JA 1ZG1A 3TW6A 1IAWA 1MSEC 1WJ5A 4ZC3A 2IPQX 3TBIA 1X1AA 1J9IA 2AS5F 2NYXA 2H1LA 2GAUA 2W57A 2ZXJA 5EJCA 1VQ9I 1H9TA 3FIWA 3H3UA 2Q8KA 4C3JJ 3F0CA 1BC7C 1Y8QB 4Q48A 2CU7A 1W7PD 1U5TC 3ZQLA 4JK1X 3HRSA 5EG0A 1BBYA 1FP2A 1ON1A 3HOUJ 2HQNA 3E0JB 2WADA 5HLGA 3J7YJ 1TWHJ 5F64A 4UVCA 3RCOA 1ETVA 2OZUA 3S5RA 4XQFA 2CV0A 1RRJA 1OJLA 2D2WA 2OTJI 3BR6A 4EJOA 5FKOA 3L2UA 1E3OC 4HQEA 1U9NA 3P9IA 1JUSA 4AVZA 3Q5FA 3V6GA 5TGTA 3I71A 5C44J 3VP5A 3MKLA 2VB6A 2M4KA 2EZHA 3REOA 2VQLA 2HDWA 2QZ8A 2P81A 3NAUA 4M9SA 1W5CC 1IF1A 2OERA 4A6DA 2O6GE 3VWBA 5EDNA 3R0JA 3HTSB 2FEZA 2EK5A 2OAZA 3R60A 4JQFA 5M3MJ 5JLWA 1IN4A 2ME6A 2VI6A 1V5EA 1R1TA 2R5ZA 2JZYA 3MN2A 3JCUC 5F1JA 4N4OB 2IGNA 1QPMA 1Z6RA 3LWJA 3AQSA 2E19A 1MMGA 4ZZDA 4FX0A 3JRCA 2W24A 1OYYA 1S7EA 1QO0D 2KJBA 3HHGA 2ZMEB 5FO5A 2XSDC 2YU3A 3ZOBA 4CDGA 3NI7A 1C0WA 3CZ6A 3U2RA 5FMPA 4BXUA 2ZOYA 2IS6A 2XF6A 1YJNI 4HSTA 3G1LA 2UWMA 5JFRA 1LDDA 2VC1A 4ETSA 4WCGA 4BJTA 1K61A 5BS6A 2FMLA 3DTIA 3NQOA 2YVHA 3L00A 2A2FX 3R0AA 3PFYA 2WV1A 4WXDA 1AOYA 2O7TA 2BE5F 4F55A 1VQKI 3JR9A 4RGSA 3BWGA 2OUMA 2R7WA 1TWGJ 4EATA 4UUVA 1TQIA 1ULYA 2KRFA 3WTXC 4BBRJ 3M07A 3LNQA 4IOCF 3SWHA 3A2KA 2VIXA 3ZP5A 2L9NA 3DEEA 3HEFA 3W6KB 1A36A 2EINH 3ISPA 3Q0WA 3DBLB 2E5ZA 3CP8A 2HPIA 3H3ZA 3QP6A 1JI8A 4PZJA 3HJEA 4LG0B 4XKCA 3FWEA 3GVAA 3HSFA 2XHKA 5L3EA 1FZPB 1ZR2A 3K9TA 3LAPA 2ESNA 5LRRA 1D3YA 5FLXK 4FTHA 4IQJA 3KCCA 3OYJA 3F8FA 3F8CA 2K3PA 2RREA 4E7KA 3RI4A 1ZAOA 3FMRA 2IT0A 3ZPLA 4A2UA 2K9LA 1B1BA 3FXMA 5DD8A 5LBQA 3CUOA 5EEAA 4RB3C 1R49A 4Z2YA 3D5RC 2REKA 4P5OA 4LGWA 4PK4A 3ML6A 3FXUA 5DM6F 4YRVA 5B66C 1WJDA 4M74A 2DMUA 4ME9A 4I99C 4L5JA 2XGCA 1QU3A 3I4PA 2G7SA 2YS9A 3B6CA 3QBMA 1K78B 2M3AA 3F3XA 3KZYA 2HOEA 3KEYA 1IC8A 2M9HA 1DPRA 3TGNA 4EM0B 3I3LA 1FWZA 2E34A 4PXIA 3BPXA 4EJVA 5GAHJ 2Y0SN 1IN8A 2PG4A 1SANA 1HDDC 1ZH5A 2LSOA 4HSRA 2ID3A 2QYOA 1GDTA 4XK4A 1RNLA 2E1OA 3V42A 5EGOA 3DXJF 1WSUA 5FRNA 3LA3A 4O6JA 3TOAA 2CV1A 3MNLA 1AWCA 3HTUA 1ZN2A 3X2QH 1OQYA 1Y1VJ 1MNMC 3PIPF 4MNUA 4ZYHA 3FXLA 3PL8A 1S7AA 3OYKA 3JRIA 3KNWA 2RNJA 3F9KA 3LSHA 2GZWA 4OAYA 3U1DA 5L3GA 1B72B 2HEOA 4GYGA 5GAEJ 1XMAA 3KPHA 1HW1A 3T1BA 4ENKA 2DDBA 1FOXA 1G4DA 1XX5A 4GFLA 1KQ0A 3V7CA 1XC5A 3GEUA 4ASNA 5K7HA 2PEXA 4QSHA 3JAMZ 1YYVA 1TC3C 2RV8A 5LFAA 2VE9A 2Z16A 1LEBA 2VONA 1ETXA 5E1ZB 2EV5A 4Q4ZF 2DA4A 2KIFA 1T6SA 2X6WA 4FASD 2XUBA 4MQ9F 4OINF 2TCTA 2XC7A 3ZN1A 1XGSA 2F2EA 2Q0OA 1DPUA 4MO7A 1R5GA 3QU6A 3KYDB 5DCFA 3HXLA 3K1PA 3V8KA 3PIOF 1IRXA 2DFEA 3MFKA 3ESWB 3ZGKA 2DA3A 2XRNA 2Y0SA 2IA2A 3FRQA 9ANTA 5CQGA 4F7ZA 2XF5A 1ENHA 2Y75A 2MH9A 4P1WA 4LB6B 2DMQA 5BMZA 1BR4A 3HL2A 2DG7A 1UELB 3OOPA 2P0WA 1WI9A 2DO7A 1QA6A 3AG3H 1ZREA 1XGNA 3M1EA 2HNHA 2CWEA 2FBHA 1ZR4A 2H1KA 5E79C 4KIBA 1ON2A 4CYCA 1V54H 1B9NA 3GFLA 2FBIA 4PDKA 2K4JA 3QOEA 1UFMA 1BM9A 2K85A 2QUFA 1UJ8A 3WHBA 4A3FJ 1MJAA 1WJBA 2K4BA 5AIPA 4L18B 3SZTA 4A3DJ 3HPHA 2Z5UA 1JGSA 1GHCA 1DP3A 4Y17A 2QQBA 4NHJA 4UY8I 2ZNZA 2FSWA 2NX4A 4CCMA 3P9CA 3GTOJ 4L62A 2OQRA 1LEAA 5E3LA 4WF2A 1DU6A 2DDAA 1JTYA 2K3FA 2L4AA 3CTAA 1QHGA 2QTQA 5GPAA 2Y30A 2LLKA 3H5NA 4HLYA 3AG1H 4HRIA 4JNNA 1S8NA 3WTVC 4ACIA 4A0XA 5J8FA 1R23A 1TQMA 5E8IA 3GXOA 5J1UA 1PP7U 2W53A 2V9KA 3HOVJ 4WXCA 1TWAJ 2IW5A 2P7CB 3CC2I 1TLHB 1XGMA 4ON0A 4I0BA 3ZQFA 3LSJA 5HS9A 1OISA 4KISA 5FFXA 3RTRA 2GXAA 2MC3A 5A2QZ 2W25A 2ISYA 4BKXA 1STZA 2ETHA 3CD6I 2X85A 1H8AC 2UXOA 4MFEA 4XLHA 2JUGA 5L3BA 1FMVA 1QZYA 3LSGA 5M5YJ 3KFWX 2AXTC 2DK8A 3G7RA 2XDVA 2RAEA 3J81Z 1VFCA 2M87A 5EZHA 3EQLF 5CPRB 2KQRA 4DGWB 1R71A 3RPUD 2IEKA 2KKOA 4A3IJ 2YSRA 1WWXA 3T0YA 3KP3A 5E1WA 5BNGA 2VJ4A 1QZEA 4G6TB 3SHFA 3LHQA 4BACA 4LOCA 2R7SA 2IRFG 4BE2A 2HR3A 1OCOH 4D7MA 2FE3A 3OYGA 4OIRF 3DTKA 1A31A 4RAGA 2FQ3A 3RKWA 5DUIA 4BXXJ 2LBFB 5FD5A 5DD4A 1P7JA 3ZXSA 4MTEA 1LKXA 3SXYA 1QGPA 1HKQA 3FKIJ 4F3QA 1YO5C 1F1ZA 1R9TJ 3M8JA 3KEOA 3IKTA 3E6MA 4IHXA 3HKZN 4MIMA 1VNDA 4JX6A 3GWZA 1GVDA 2QENA 3OL4A 2ZNYA 1VQNI 5JVTA 2BW3A 4UUSB 5CXGA 2XAUA 4WIBA 2EV6A 2MYSA 3CF5F 3QWLA 2H94A 2LG4A 3EUKL 5FRMA 3TW7A 4N9HA 5DAJA 4PFOA 1GVJA 4RB0A 4DBQA 4W1UA 4KMUX 3V7SA 1JE8A 3HM5A 4D5CA 4P9UA 2DQLA 2LVSA 2RQQA 2VBZA 3HHHA 3FX3A 1SVMA 1XD7A 2HYFA 3K4KA 4LLGF 5IYBJ 1FBQA 3K10A 1F4KA 1OCRH 3NRGA 2MBFA 2P6SA 5F0FA 1WQ2A 1JJ8C 2LTPA 2DMPA 5D5VB 2FXAA 3IC7A 3GBGA 4A3GJ 3LFUA 6PAXA 1IZ1A 2V6CA 2FOWA 5FKKA 1S5LC 3CCVI 2W1OA 3VVYA 4EGZA 4A3JJ 1D0XA 3SFZA 3GFJA 4HNUA 1F5TA 3ABTA 2PMHA 3O3KA 2W7NA 1DU0A 4OD5A 2Y31A 1JKRC 4ZYGA 2LP0A 3MKYB 1E3HA 3HSEA 4PSWA 3W2WA 2BEOA 2JT1A 2NVYJ 1LE8B 1F43A 1U0JA 4ZYEA 3OYEA 4XICA 3HUGA 2I8DA 2OQGA 2WTEA 5D1RA 3RQIA 1R6RA 4MEXF 4RBOA 4XSZF 1ETWA 3KP5A 5J40A 4OAZA 1AKHA 1YX3A 1RIOH 1EV7A 3ELKA 3GTQJ 5TRDA 4G12A 1J7KA 3L2VA 2DU9A 2HQ5A 3NS4A 3J7ZI 1QVUA 1IXSB 3JTHA 2GA2A 3ZR8X 2ZJ2A 1R36A 2WY7Q 1Y39A 1JKQC 4BL0B 4CGZA 2JVGA 1X1DA 3V8LA 2ZY9A 2L7ZA 1JT6A 2P5KA 1Z1DA 2EFPA 4IJAA 1MBJA 2L2OA 1GUUA 3CCJI 3EYYA 1FC3A 2JA8J 3A02A 2KIQA 3H1CA 5J4YA 1W5SA 1T38A 2PLYA 4IHSA 2CV2A 1Z67A 4RLFA 4I76A 4M6VA 1E2XA 2M30A 5ICEA 3I5UA 2E2HJ 2R4GA 2NRAC 1NG6A 2BY2A 2PQ8A 1I3AA 3LQQA 4Q47A 4CSWA 3WU1B 1YG2A 2CS3A 5BPDA 3DLAA 5CVRA 3BOQA 2ZXHA 4LG3A 5HLTA 1FSEA 2EJRA 2ZC2A 3JRBA 1N75A 2O7OA 4IRGA 4L0ZB 3DWLE 1ZARA 2F4OB 4XKVA 1BW6A 3DQVC 3FDYA 3QOPA 4P96A 4KNYA 4FE7A 2BXZA 3G71I 1FPQA 3GF2A 1A6QA 3BPVA 1JTXA 3LJLA 4Y3OA 3MD2A 3HOZJ 2M34A 5CLSA 1R22A 2XGDA 4KDPA 2R93J 1MNEA 4ZDLA 4U7DA 4Y13A 1DDNA 2E2IJ 3JRFA 1K6OA 1YRNA 2LH9A 1P6RA 2Y9YA 1IG7A 5FKLA 5IP7J 3OMYA 2MC4A 5EYRA 4AUXA 5DTDA 5BOXA 2J5PA 4NC7A 1IN7A 1PUFB 1L0OC 4XMYA 1FYKA 3RZOJ 2R7XA 4BDYA 2O3FA 3ZQIA 2TRTA 4BXFA 1VQ5I 3I59A 3UR3C 1EA3A 3J7AO 4MEYF 4O5VA 2FOKA 1P2FA 1LQ1A 2O8KA 1G3TA 3FHNA 5TISC 2VN2A 1ZGWA 1WKMA 5EF6A 3CCSI 5BPIA 4A3KJ 2VXDA 4NB5A 3KLNA 3K7AJ 3HOXJ 1D8JA 2HDCA 4BHBA 4P9FA 5IY5H 1NG7A 2GXGA 2DPUA 4XLPF 1YIOA 2FA5A 4ESBA 3VUQA 3B73A 2RQPA 3CC4I 2B7EA 1MMSA 1LVKA 2BVLA 4LD5A 5IPAA 5ILVA 3K4MA 1W1WE 3S2HJ 5D5WB 5AQCA 1HKSA 4YG2F 4OWRB 3FKJA 3QPLA 3BCBA 3CJTB 4II3A 4CYDA 4HF0A 3JSPA 4YFKF 1VQ4I 1UHSA 2X1EA 3H5RA 4E7IA 2B9SA 2FF4A 5CXIA 4JL3A 2NS0A 4IRIA 3VFZA 2DOFA 4I2OA 1USSA 3RSNA 2VODA 3S15J 2GFNA 5D8LB 2DA7A 2ZJRF 2ZMEA 2KMUA 3KP2A 4A12A 2PBXA 3IRRA 1RPWA 3WE2A 2OCEA 3NRVA 3BR2A 2YVEA 4MXMA 1MBGA 4G6QA 2WGBA 3V7RA 3ON2A 1NH3A 3IH4A 4AVPA 5FJ8J 4CZZA 3GTJJ 3GTPJ 4IRVA 3J80K 5J1RA 4M72A 3ULQB 3ZCOA 4DZJA 3V78A 4LB5A 2IXSA 1Y6IA 3ANGA 4IHTA 3S2DJ 2VQHA 3WTSC 2KIUA 5J3LA 2LR8A 1BW5A 1R58A 2GA1A 2MD0A 4RAZA 5K5OA 3CCYA 1FNNA 2BYVE 2HTJA 2QSGX 4AM3A 2IGMA 3H36A 4B1RA 4ZH4F 2HGCA 5FGMA 3ZN0A 2VPLA 3EUHA 1BOBA 4PJ0C 1PVEA 1TBXA 2WAEA 4A6EA 1MJBA 3DBHB 3LSIA 2LY9A 1J59A 2BY1A 4YFNF 2LFBA 1SAUA 1YW7A 2PZ9A 1Q1HA 4HAMA 2UZKA 3CESA 4A3EJ 3F6VA 4Y7NJ 2HKUA 5K7FA 2AQEA 3KZIC 4IHVA 3SZPA 1LVAA 2QF7A 3IUVA 4ANJA 2A07F 3EYIA 2DJNA 3PNTA 3FXRA 4UUTA 5JLXA 3L2QA 3DBRB 4E6KG 2BVMA 3AG2H 4CGRA 3OYNA 1CF7B 5D6FA 3CMEI 3GZ6A 2EWNA 2VUMJ 3CO7C 4RAYA 4UB6C 3DLLF 2Q2EA 1B9MA 4A3MJ 4GDFA 1MJ9A 3BY6A 3FZVA 4PFPA 2F5DA 2DG8A 2JWTA 3WG9A 1IDZA 1VQ8I 3Q9VA 2F5EA 4M6XA 1X4OA 4NQWB 3ZQHA 1J2XA 1I6XA 1Z7UA 3CF2A 2MSYA 5KK1A 5K58A 3F6OA 4C2TA 1VQMI 2EFQA 3HOTA 2BGCA 4G94A 3K4BA 3VW0A 1R5ID 2RC4A 1G3WA 2CSOA 3OOUA 1T2KA 3CCQI 1T0FC 1T39A 4HX7A 1VQLI 3BTJA 3A03A 4CA0A 1PDNC 3AAFA 2PJRA 3K6GA 3N05A 1SFUA 2L7FP 3SYTA 1ZGJA 2O0YA 4A3LJ 2JVHA 4XKBA 3CCUI 4YZEA 1U5TA 1R00A 2DMNA 3FF5A 3PNYA 2YPRA 3TO6A 2LREA 3GZNB 1J5YA 2XKOA 5CJ9A 1RZ4A 1B72A 5LHHA 2PBIA 1G2HA 3OYDA 1KQ8A 4R79A 2R5YB 3S3NA 2Y0MA 1ZRDA 2V7FA 2Q1ZB 3VB2A 3IV5A 3O8GA 4HV6A 2C6YA 4PJNA 3SQNA 2EB7A 1IXCA 1MDMB 1X3WB 4AF5A 2F4IA 2VBYA 3CDHA 4ITVA 2MLGA 2R92J 3GW2A 3S1MJ 2K86A 3I58A 2GWRA 5ERIA 2OF7A 1OR7C 2X4HA 2Y2ZA 1F9NA 3HOYJ 4CCOA 2V79A 4B3XA 1X3UA 2ECBA 2JPCA 4BHPA 3LAJA 4OD4A 4MLOA 2DPDA 5IT9K 5H6QA 3U21A 2BY0A 4U0VA 1GT0C 2WY8Q 1B59A 2X9DA 1IGNA 3VW2A 3CUQA 2AO9A 1UI6A 4FX4A 3VSLA 2VL8A 3T8TA 1YITI 4NELA 1YFHA 1BI2A 3S2WA 1SEUA 3NPIA 2I5UA 2XPVA 2I10A 1T56A 2PFBA 1UAAA 3FK7A 4IF4A 1IN5A 3L1PA 1T8IA 5HBUA 5D19A 5EG0B 1IV6A 3RYRA 2NAZA 3A01A 1KYWA 1TQPA 4BJ5C 5LGNA 4U88A 3A1YA 3D5LA 2M7AA 5LHGA 3CCLI 4L9TA 4D1QA 4MFDA 1W0TA 3DU5A 3MCZA 3H0DA 3VVXA 2J5OA 4H4KC 2VC0A 3V4GA 2DFHA 2CMPA 5CYVA 1D1AA 3CLQA 3DKWA 4L9VA 3Q3SA 3IWZA 5C3EJ 4CZCA 5DEQA 5JHFA 3B81A 2NVUB 2WC2A 3K4LA 2AHQA 3IH2A 1W7PA 4HPQA 2XF7A 4FE4A 1X2MA 2LC2A 3WG7H 1WRJA 3BCGA 3HPGA 2E1NA 1FYLA 3VYRB 3IWFA 1FOKA 3F23A 4B44A 1QQIA 5LHIA 2O61A 2M0CA 2Z3YA 4UV8A 4C2MJ 3MZYA 1WI3A 4ZDOA 3RD3A 2R0QC 4XLEA 1HCRA 1MGTA 2ID6A 2R5ZB 1WHUA 1DQUA 2ELJA 4M3EA 5FD6A 2QCOA 3LSMA 2R7FA 2QQ8A 1MH4A 2ZJQF 1S3JA 4OMYA 3FBNB 3WTUC 1FLIA 4GO1A 4L5IA 3GZIA 1O4XA 1MBHA 1ZRFA 4JYKA 2IS1A 1A04A 4LIUA 3DV8A 5FLXZ 4AIHA 2W48A 3AG4H 1YW8A 1IRZA 4QIWN 2E71A 4BHCA 2KRHA 2IBDA 1KA8A 3AFHA 3CMAI 4AIJA 1AA7A 1EH6A 2DA6A 2IVMA 2EA2A 4TV7A 3VPRA 4FHTA 4R1HA 3W2VA 1HC8A 5HLIA 3WHCA 3HZJA 3HYIA 3SDBA 2NVQJ 5GAGJ 1SD4A 3R4KA 2DA5A 2YX4A 1SD6A 1BR1A 4QLCU 3C18A 4BE0A 2JQ7A 2R7TA 3JW4A 4E4HA 2QBYA 1HW2A 3GO5A 1P92A 4DVYP 4HQMA 3RYPA 2ADUA 5LD2C 5KCMA 4L9JA 2RN7A 3HIFA 1SMTA 1X1CA 2XB0X 3MQ0A 4WX9A 2OA4A 3PUBA 4DBRA 2QWTA 3HTHA 3M8EA 1P9QC 3B6AA 4MHGA 2D6YA 2LRDA 4JBAA 3ABLH 3UNGC 1ZG3A 1O7LA 3PQKA 3QYFA 2M7BA 4BH9A 3VOKA 3T6NA 2NP5A 2VBWA 4GCLA 3VW1A 5KAIC 4YIRX 2JSCA 2UXXA 3BR1A 5HDKA 1ZLKA 5HODA 4BNCA 2QGUA 4KUMA 4E7JA 1Q1VA 3OYMA 2QOPA 3WGGA 3HG9A 2R7UA 1JJ6C 4H0EA 3CWRA 3RQ4A 4J00A 4UNOA 3AL0C 1ITYA 1RKWA 5D5UB 4HDVA 1UZCA 2NOJB 4KJZA 1YIJI 2DN0A 2JUCA 4X1EA 2DT7B 1L3LA 4EJUA 3EUPA 4C3IJ 3GEZA 3OWTA 4LITA 1SFOJ 1VI0A 4LK0F 3QAHA 2Z99A 4DYQA 3CC7I 2EFWA 3VOXA 3TEDA 2HYJA 2NS8A 3BG5A 4M3BA 4NC8A 3ONQA 1B8IB 2ESHA 1MH3A 4YEJA 3H9GA 4HNVA 4UV9A 3CCMI 4YELA 4BQAA 1U78A 1POGA 1ZK8A 1A35A 2WB1N 2Z1DA 2BV6A 2HQRA 1KONA 3KYCB 4WXHA 4LFUA 1WJEA 2ZXIA 3JRHA 2IA0A 1MBKA 3TDUC 2YUSA 3CMYA 5CVUA 1VQ6I 1G3YA 3GTKJ 1X1PA 1Z3YA 1ZYRF 2K9NA 3GLXA 1VQOI 3BQZA 2L4MA 2DLLA 2L02A 1S72I 4HYEA 3VTIA 2DW4A 2JA5J 2IJLA 3KZZA 4ZYAA 1FT9A 2YU9J 2QQ9A 4DYRA 3BTCA 1FBSA 4MTDA 4C2UA 3ZMUA 2XDNA 3N4MA 1P4XA 3PO2J 3G2BA 5K1YA 3HTJA 4U9NA 3HOSA 2LOOA 2BHYA 1HA8A 4ESFA 1RUOA 4V19K 3BG3A 3BG9A 2KPMA 4IL6C 3ZMDA 2DYSH 4GCTA 1WJCA 1K79A 1WCMJ 1E17A 3E5XA 1X19A 2BHZA 2EZKA 2K5CA 1B4AA 5LLQA 5J6XA 1P7IA 4XONA 2EPFA 4O3MA 4BEHA 1VZ0A 1OYIA 1LB2A 3D1NI 2L54A 2EH3A 2EZLA 1Z7LA 3F22A 2E36A 3G56A 3GZ5A 1TNSA 4BDZA 2GQQA 4XLCA 3GUDA 4D5FA 2G0EA 2PMUA 4CCNA 1BC8C 2CW7A 3ABMH 4HX4A 2KRCA 4YIIA 3M4OJ 2WB1A 2UXIA 5LGUA 3OSFA 5TJJA 4PCQA 1BI3A 3PNVA 1RUNA 1R4NB 1T08B 3ZMSA 1WJFA 5L3DA 2XAJA 4C2MA 4M71A 4KA4A 2HI3A 3GTLJ 2DT5A 5CW8A 4I0AA 1RETA 2XV4S 4EMSA 3Q9SA 3G73A 1SVLA 2HVRA 3ANPA 3TQNA 1TL8A 2B1EA 2X6OA 1YE9A 1U8RA 1QHHD 2VQGA 5KAFC 2V1UA 4B09A 5E8GA 3OYBA 4CYCB 2OCCH 1IRGA 1OCCH 3PPBA 2A6TA 2LYCA 2L5QA 3G6EI 2XPUA 2HVQA 3K1NA 3TDZC 1KGSA 4Y4RA 2XIGA 3ROUA 2DCEA 3WE3A 4LK1F 5ICCA 2OBPA 3IL2A 3AQTA 1XG1A 2WAQN 5FHPA 3WODF 2GIZA 3TMOA 3OS0A 3CCEI 3M3YJ 2COBA 2HWVA 5DCMA 1KQ9A 4X6AJ 5ICGA 4MQVA 2H6CA 1PJRA 1YHQI 4KT5C 4KN4X 1FIPA 3ERED 2OJED 4V2GA 4ZYDA 2FRHA 2DK5A 2ISZA 2CFXA 3G3ZA 1ETYA 5CVJA 2X6XA 1UMQA 2VASA 4XORA 3KZ9A 3OIPA 3MVPA 2EILH 1LPQA 2IP2A 4BE1A 3BTLA 1HQCA 3HKZA 3CRJA 2VJJA 1NTCA 3C3WA 1O7FA 3ZRGA 2CUZA 1EKEA 1HDPA 2NS7A 4HOBA 4BQOA 2EIJH 4FT8A 1TW2A 4EQQA 1MZBA 1X4PA 3I55I 3AL0B 1ODDA 4B8XA 3CJQB 4YFXF 2ZCWA 2D1VA 3IRQA 1D5VA 1O3TA 1J75A 4GRIA 1YJ9I 3BG7A 3G1OA 5LEKA 3RH2A 3F72A 1D1CA 2GOXB 2DFIA 5F0CA 5D4SA 3W2AA 1RESA 1EF4A 3ZQCA 3RZDJ 2R7OA 1P4WA 3NARA 3NWTA 4XNFA 4M3GA 3OV8A 3JRDA 2CUEA 1YJWI 1XB4A 2AXLA 2PI0A 4D7NA 2KL4A 1LFPA 3FHZA 2WAQA 3H3VK 5B1BH 2UV1A 4DOZA 4ZTFA 1H89C 4AWXB 2VT3A 2F07A 1YI2I 1AHDP 4U7BA 2CH0A 3OS1A 4BS9A 2CFOA 2ACJA 2DMTA 1XMXA 2IGOA 4ZTJA 3RKQA 3L9FA 2G7HA 3HIMA 2M8EA 2OZ6A 3DF8A 3HTIA 4XRSA 3S32A 4OIOF 4M3DA 4X0GA 3Q0UA 4XN0A 3WTYC 1H0MA 1XSXA 2ME0A 2STTA 4UXNA 2VBXA 2P5LC 1FOYA 2VJIA 3RPUA 4A5NA 4S05A 4BY7J 2ZCMA 3HB9A 1LDKB 1MIJA 2K40A 4J19A 4BGDA 2EBIA 1YW9A 3FXJA 2A69F 3WTWC 3L2WA 1JXSA 3S14J 4S04A 2ZSIB 1V55H 3HGGA 2A61A 1NK3P 3H9QA 3HE0A 1K7AA 1CQTA 2W85A 1ETKA 2K9QA 3P5JA 3FISA 1N77A 1OYWA 1WZ2A 2VLAA 2BBYA 2VJ5A 1QVTA 5IOYA 3KEQA 2XVCA 2OU2A 4OIPF 2DT6A 4N0BA 2KP6A 2HOTA 3IKVA 4RGRA 3RIRA 5JI6A 2D5VA 1XCVA 4RMNA 5EEGA 4GCKA 2QA4I 1E0EA 3OY9A 1LJ9A 2FMYA 2BZTA 2RKHA 3TL4X 1T98A 2LF7A 3GTGJ 4HF2A 2QKMB 1OMIA 1XPXA 2HXIA 1GLNA 2K7LA 2X1DA 4U9LA 3QKXA 3QPTA 2B63J 4E7SA 3GCMA 3BT9A 1ZHFA 4NC6A 4LLLA 1MBFA 3H92A 3LSKA 4CICA 4ESJA 1FX7A 2A68F 1ORKA 2VPRA 1OPCA 1DP7P 4XN3A 2O5RA 1W36D 3P7NA 5JR3A 3OR1C 3RDIA 1TT5B 4BAYA 3HUGB 2MG4A 1Y1WJ 1RC9A 2V6EA 2E7XA 3BJBA 3E3VA 3EGQA 1AKHB 2CRGA 4NN1A 3BJ6A 1MD0A 5ILSA 4OIQF 2KDZA 2E2JJ 4RLQA 2PJPA 3MMYB 2V9PA 2ZXWH 1HW5A 2Y48A 1D8KA 2KZGA 5D5XB 3EPZA 4BUPA 2QSHX 1MMDA 1PP8F 4RM2A 5HDGA 3HGYA 2HZTA 2GENA 5HLHA 1FMWA 4PJLA 4GYIA 4E7HA 2ZOZA 4RGUA 3O6BB 4ZDPA 5K5RA 3S16J 3JSOA 3H0GJ 5DV5A 1TT0A 2W00A 5B3SH 1WVRA 3QQAA 1MW7A 2NOGA 4I98B 4Q5SF 1YOVB 1I39A 1JKPC 1NHAA 1R1UA 2HYGD 2VKDA 5CVIA 2EIKH 1U3EM 4ZJZA 2M2EA 4N9IA 4KIGA 4A0YA 2JA2A 5F27A 3JTGA 3E7QA 2XROA 4QTRA 2A6EF 2LF8A 3G1MA 4KIFA 5H6RA 3F8MA 1U8BA 3DFGA 3CP2A 2GXBA 3QRFF 4CHUA 4NDLA 5HVQC 4UVAA 5DUKA 2FU4A 2K9MA 2CUFA 3OYIA 1UHMA 1XCBA 2FJI1 2A05A 3JSJA 2R3SA 3G4SI 2XB5A 4G8XA 1X58A 3MAJA 5D18A 3LSPA 2M5WA 3VVZA 2M45A 5FKNA 3C2HA 5B5EC 4A5MA 2MABA 3W3CA 4AD9A 2K9SA 2ZSHB 3COAC 4LG0A 2EZIA 3ECOA 4ENJA 1ZG5A 3PFIA 1YRNB 3DPUA 1W36C 2XGEA 2VXZA 1GXQA 2ZCNA 2Z33A 1SAXA 3I4MJ 3LA7A 3CCRI 2GBYA 5K5QA 3L2CA 3F8NA 3DPTA 3BR3A 1D1BA 2CQNA 3I59B 2V1DA 5GPCA 2WV0A 4M73A 4CCKA 2IAIA 1GXPA 3IP4B 4EJWA 2F48A 1YS7A 1T33A 1FP1D 4IO9F 2P7VB 4QWQA 2JA6J 1OLTA 2L3DA 1ZGAA 2A5YB 3K1MA 5E3MA 3I56I 5DM7F 3BTIA 3H5AA 3F8BA 1K78A 1FOWA 3WTTC 5IYCJ 3BCAA 2KLOA 3BR5A 3E6DA 2H27A 1R1VA 5E3NA 1ZKGA 3J80Z 2R7DA 3K2AA 2F4MB 3NEUA 4WWCA 2QSFX 4QPOA 2BXYA 2FNPA 1M1EB 3OL3A 3I4NJ 5KHDA 4BY1J 4B43A 3K4CA 3OIOA 3BQYA 2P6TA 4Y52J 1I1GA 3COLA 2DYRH 3WU0A 3CUQC 2Z9OA 2XSJC 2BOLA 1VQ7I 2OTLI 2L0KA 2YVXA 4HBLA 2L9SA 3DPJA 2G9WA 2FBKA 3BG6A 5HAWA 2FUG2 3WGIA 3IH3A 2WBMA 5AIQA 3FM5A 1U9OA 2L01A 2DA1A 1IRFA 5FKMA 2QKLB 1FSHA 2FD5A 3M8FA 4KN7X 1IO2A 3DEUA 5KNLA 2XAQA 1BI1A 1I27A 2CJJA 2KJCA 2P5VA 3C2BA 2VT2A 2YR2A 4GFBA 1ONVA 4C3HJ 2PN6A 3KLOA 5L3FA 1IN6A 4L5EA 1G6NA 1KU2A 3K4NA 2XASA 2O03A 3S8PA 2MH2A 2H8WA 3PUFA 1ZLJA 3ABUA 4U0YA 2V57A 4AYBN 3SZGA 1Z21A 2GUHA 1XN7A 2E1MB 3C07A 4FETA 2QVOA 3C1DA 3JRGA 2F6CA 4BJ6C 5F04A 1R5HA 3K0LA 3I9V2 3P9TA 5HSZA 2V26A 1E3PA 2IGKA 3MZHA 1EJ9A 2UXUA 1SC7A 3CDIA 2L7KA 3CJRB 3VYSB 1HLVA 1BI0A 4JX5A 2X51A 4RGXA 4DYCA 2VKHA 1T0FA 3UKGA 2RDPA 4I7HA 2G3BA 1JUPA 2RGVA 3LWFA 4IX7A 3C2GA 3VSKA 4CXFA 3HC7A 3ASOH 3L7WA 3S17J 1ERDA 3BNIA 4A3BJ 1O3RA 1YQAA 2V4JC 3I53A 4HF1A 3A0HC 3M7GA 3JAMK 4HG2A 1ZQ3P 2V1NA 3CJDA 1Z3XA 5B1AH 3K8PC 5E18F 3OR2C 2X6YA 3FXKA 3H9JA 5DDGA 3HRUA 3QU3A 3LSTA 2F5CA 5J47A 4GGGA 1OCZH 4XOTA 2JN6A 2TDXA 1OKRA 4M3FA 1A5JA 5EFYA 4LMYA 1XDUA 1Y8RB 2DAOA 1K4SA 2CG4A 3PM1A 3QODA 4XKWA 1SFXA 1Y0UA 2MD5A 4AIDA 4C30A 3TO9A 2UXHA 1HSTA 2Q2EB 3BZKA 2IS4A 4NBQA 3M1CA 2E1CA 3LOCA 5M5XJ 1OR7A 3A0BC 4NUBA 1B8IA 1HOMA 5LGTA 2XAHA 1FY7A 5LRSA 4EEFG 2CW8A 4IZZA 4AYBA 3KP7A 2LK2A 1KU3A 1YLFA 2EQRA 2W84A 4I02A 5IT9Z 3TP0A 3ZMTA 5E17F 4A93J 2DTRA 1XS9A 2VE8A 5ILUA 1S9HA 1BIBA 3SFIA 1HF0A 2O8XA 3QP5A 1O3QA 2F5FA 3I0TA 3CLOA 3CQZJ 2PJRB 1IUYA 2KT0A 2X0LA 3EDPA 1TWFJ 5KVRA 1IJWC 2NVTJ 5D6EA 1GV5A 5J1YA 4AIKA 2R7VA 1APLC 2QIBA 3DU6A 2D1HA 3OYCA 2ICWG 4XL9A 1U5TB 1SFKA 4XLFA 2Q24A 4EJTA 1Z05A 1LUJB 2EIMH 2DQRA 2H09A 3K70D 2IA1A 4IHWA 2KZVA 2RVCA 4XSXF 2ZJPF 2LNBA 3HSRA 1LDJA 1I1SA 3D0SA 3GMEA 5C4YA 5L3CA 2QLZA 4D0PA 1SVOA 4F91B 1BR2A 4G7ZF 1WFXA 3FXOA 2LDUA 2PMZN 4ABZA 2OI8A 2HYTA 2V9VA 5JVGF 4CH7A 2NXNB 4EM2A 4DQ2A 3W6JB 3T5XA 1TTYA 3HRTA 3QPSA 3DPLC 2CQXA 1IV8A 1T95A 2EA4A 5J4VA 3W6VA 2LBFA 1HXDA 3NWSA 3VIBA 4W97A 3LSRA 2ECCA 2QKOA 4JX4A 3VDXA 1K83J 3CUQB 3KKDA 5GTHC 2Y9ZA 1W5TA 3TO7A 5LEJA 3BP8A 4CUGA 3H35A 3DTEA 2A5WA 3M9AA 4XLNF 2CQKA 5A2QK 3MKZA 2JSPA 4KFCA 3ERMA 3LMMA 3CDLA 4IRHA 1U6GA 1VQPI 4UUSA 3PJRA 2COMA 2FBQA 2UXNA 1LFBA 2K02A 2R7QA 3VYUB 4E7LA 1K4TA 1S6LA 2E7WA 3MWMA 1OCPA 2W4SA 4BYYA 2XGXA 3A01B 3N97A 4XRMA 4U0WA 4B3AA 3OYFA 4JOMA 3J81K 4ENMA 1W4MA 5DS9A 1DUXC 3SDGA 4A0ZA 1G8XA 1G3SA 1HSJA 1UHWA 1YS6A 1REPC 2V1XA 3SEZA 3DCFA 1I3QJ 2LKPA 2CW0F 2LY1A 2M0MA 1TNTA 2DI3A 4HV5A 2R7RA 2NNYA 1CGPA 2EV0A 1W7PB 2A3SA 2NP3A 2HKOA 2JPBA 2XPWA 2VQCA 3BZCA 4G9YA 2OD5A 1ZTRA 2PMZA 2QQAA 2X48A 1XSVA 3LA2A 1JHFA 4BQQA 4CO8A 4J01A 4KYWA 1FBUA 1UI5A 3ZMVA 3K70C 4HEA2 5EGOB 1ZELA 2MGQA 2YX7A 3S1NJ 2ZCXA 3F1BA 3U1KA 3E6CC 1VTNC 3ZQ7A 3FMSA 2FJ1A 2KISA 1QRYA 3PQJA 3DKXA 3P9KA 2WAFA 1UG2A 2VOPA 1LE8A 2QM3A 2OPTA 5FROA 3E1SA 3EETA 1ZRCA 1XDSA 2E5NA 4PJMA 5GP9A 1AU7A 1TWCJ 3KX2A 4UHTA 5BQTA 4HNTA 3OYAA 3OSGA 1JT0A 1BL0A 5C4XJ 2PFVA 2BY3A 2DXIA 2XAFA 4IPAA 4ENNA 3F21A 3ZMZA 3O2PE 1JHHA 2DBBA 5E20A 1Z9CA 1W0UA 2GOMA 2L9VA 1Y56A 3KP4A 1O3SA 2UUZA 3E6BA 2CGPA 1V5GA 3Q0VA 4HZFA 4DW6A 2OC6A 2KHMA 2HDDA 2VKEA 2HKXA 4XRSG 2HS5A 5M5WJ 5FLVA 3IAS2 3FM3A 2WUIA 4G7HF 2PX9A 1A6IA 3S1RJ 4UVBA 3GFMA 4IHYA 1LNWA 5CVVA 2HPMA 2KIMA 2MA3A 3NNRA 4IEJA 3GYHX 2OV7A 3U9GA 3J7AY 2QBYB 2VOOA 5IT3A 2L7MP 1U2WA 2K27A 5HS8A 2G7LA 2KDOA 4CCJA 1Z6TA 4KWAA 2F5VA 1ACIA 2ZFWA 1S7OA 1UG0A 4IQ4A 5K7ZA 5IP6A 4FCYA 3KP6A 2RNGA 3TOBA 5GTIC 2EFOA 3KIOA 5HDNA 3WU2C 1B6AA 2CUJA 2MLKA 1BJAA 4KICA 4OMZA 3L09A 2QEXI 2XAGA 4IKFA 1Z77A 2Z2SB 1DGWY 1HBXG 3GLLA 3IAM2 4Y33A 5CKTA 3BJOA 1FJLA 1MBEA 4F92B 4DZPA 1BOAA 1NK2P 3QPHA 2UXPA 3C7JA 5F08A 1PYVA 4XOPA 5D4RA 3HOWJ 5FLMJ 2JK3A 4HA8A 3OIQA 1BIAA 5IP9J 2RHAA 3ZQQA 5CQEA 3PSFA 1I5ZA 1SD5A 2IU5A 3KKCA 5FB2A 1I50J 1X3ZB 2HU9A 2D45A 3VYTB 3GX4X 3OYLA 4HX8A 1UCRA 4BBSJ 1PUFA 1FYMA 3FBIB 2GM4A 4XIDA 2P8TA 2STWA 5F0HA 3ABKH 1WH7A 1ETOA 2IS2A 4HDUA 5HNFA 1Y0NA 3ZQGA 4PJJA 4HW0A 3VOEA 4S0HB 5JHUA 4ZZLA 2MW8A 1HKTA 3BHQA 3T8RA 3ON4A 1WH5A 2LKSA 4DJAA 2MFZA 2A6HF 2R7ZJ 4A3CJ 3BDDA 4YIFA 3TKYA 2ZFUA 4B47A 3OYHA 2HQAA 1H88C 3K2ZA 1Z91A 3JREA 1VF9A 2L9RA 2CQQA 3K4JA 5IYDJ 1V3FA 5HS7A 1SMYF 3DP7A 2CQ7A 1RKTA 4XBFA 4XRFA 4AC6A 5DYMA 2JRTA 3ASNH 4E70A 5FFZA 3L2RA 1MMNA 3IHUA 2NNNA 2M4GA 4NNJA 4B48A 5GADJ 5IOZA 2DOAA 3A4CA 3O60A 1BA5A 1QNTA 3WTZA 4R8HA 1G59A 1X2NA 4BEHB 2FX0A 1YX5A 3DKYA 3BJAA 5AONA 2CYYA 5E3OA 1WPKA 3KE2A 3TP3A 3RJPA 3BZ6A 1WJAA 2DA2A 2LMDA 1TP4A 4L0YB 1EH7A 2GIVA 3K69A 3O8HA 4OU0A 2P4WA 4FQGA 3I54A 3BLYA 1OFCX 4RM3A 3R6SA 1MKMA 2HVSA 3FK6A 4JKZA 4MGRA 4I09A 2XKPA 3E7LA 3BROA 4II2A 1V5FA 1K6YA 1XSDA 1OCTC 2E60A 3SEQA 1IW7F 2ZO4A 4XR6A 1FTTA 3S3OA 1XMKA 4GXOA 3VEPA 4RAFA 2BW3B 4PGGA 1TZLA 4RB2C 1SGMA 4EV0A 4AU7A 1R4MB 5H2FC 2G7GA 1BN5A 4LLNA 3KETA 1KYZA 3R61A 2HOSA 1KU7A 2KFDA 3GFIA 2LD5A 4BU2A 1FTZA 1S29A 2JRMA 4KITB 3E5QA 1Z0XA 2RASA 2WA0A 5H9TA 4KMFA 1SFEA 5M3FJ 4XLAA 4M9XA 5EEHA 3S93A 4HKUA 3IUOA 3QYEA 1I6HJ 2LY2A 3E97A 3HBLA 1GV2A 3B02A 1J0RA 2QWWA 5F6FA 4RDUA 1N78A 5HNHA 4GCVA 4N4NB 4UDSA 4AC0A 5HOOA 4EGYA 2HTSA 1EH8A 2W82A 3S1QJ 3MKWB 3PASA 3HDDA 4FISA 4PUSA 4CCLA 2E35A 4M6YA 4I6ZA 4EM1A 2DTZA 2LKXA 5DCMB 1J09A 2Y69H 3EUAA 5EZGA 1USTA 2GLOA 3S3MA 3FMQA 5J8CA 2ELKA 4G6DA 4DNCA 4WK8F 2X1CA 4LJZF 4E7ZA 1JKOC 2N8GA 4RB1A 2ZMEC 4IVNA 4BQNA 2M1BA 1IDYA 2VKVA 1QBJA 4Z6YA 5ICFA 3VODA 1O57A 4QPQA 3LL7A 1FIAA 3WGHA 3V8JA 2G7UA 1D5YA 1LFUP 3HTAA 1BJZA 3LQRA 1CF7A 1JUMA 4RS8A 5F1RA 4M9ZA 4F93B 1MNDA 1IXRC 2B3WA 3OS2A 2WWYA 3NXCA 2E1MC 1FEXA 3CO6C 1MSFC 4G7OF 4EVIA 1DGRM 5FGLA 2HOAA 3FXQA 4NQWA 2B0LA 3PO3J 1RI7A 2ZKZA 2EFNA 1QPIA 3RPQA 3BC8A 1N25A 5D8KB 3MEXA 3AKZA 2ZB9A 4IXAA 1QZZA 3ECHA 1F36A 2DJIA 1KU9A 2AQFA 1P4AA 3EUHC 3I64A 4UB8C 3RKXA 3SJMA 4V2FA 1XTAA 2DOEA 4U87A 2JJ7A 4B4CA 1YTYA 1R7JA 1XGOA 4KT6A 1IUFA 3PSIA 3JRAA 4DIQA 3RKYA 3D5SC 2NVXJ 1RR7A 3MZ8A 4I01A 1D0ZA 4Y15A 3DEWA 1V4RA 2ELHA 2O9LA 2JTVA 3CJNA 4A69C 5C4JJ 5H20A 2M8GX 4PGHA 1X1BA 4JP0A 1JGGA 3HRMA 5E1XA 4K2EA 1MMAA 4P55A 4RA2A 2R5YA 1RR8C 2XRLA 4F52A 1SD7A 1D0YA 1ETQA 4HLXA 4OOIA 4GFKA 1UB9A 2HFHA 2JMWA 4IOAF 4ICHA 4LIVA 3CMMA
chains in the Genus database with same CATH topology
3BNIA 1WGXA 3S17J 4A3BJ 3JRHA 1QVUA 3CMYA 1MBKA 2YUSA 3GTMJ 3GTKJ 1JKQC 2K9NA 3BRUA 1ZQ3P 3BQZA 3CJDA 2FQ4A 2HXOA 2JA5J 2L7ZA 1JT6A 4DYRA 3BTCA 2H8RA 2YU9J 1MBJA 2XDNA 2JA7J 1GUUA 3BR0A 3PO2J 4MK6A 3HTJA 3TW6A 1MSEC 2JN6A 4M3FA 5EFYA 2JA8J 1A5JA 3A02A 3BG3A 3PM1A 3BG9A 4I76A 4M6VA 4GCTA 2E2HJ 1WCMJ 3FIWA 2UXHA 4C3JJ 3F0CA 3LOCA 2CU7A 5M5XJ 1HOMA 1B8IA 2EZKA 4EEFG 3ZQLA 1P7IA 2LK2A 5EG0A 2EQRA 3JRBA 3TP0A 4ME9A 2O7OA 3D1NI 3HOUJ 2EH3A 2EZLA 4A93J 1XS9A 3G56A 3SFIA 1HF0A 1BW6A 1TWHJ 4FE7A 1ETVA 3CQZJ 3S5RA 2KT0A 4D5FA 1IJWC 1TWFJ 2G0EA 1JTXA 3LJLA 1OJLA 2NVTJ 1GV5A 5J1YA 3HOZJ 1APLC 3BR6A 2QIBA 2M34A 2XGDA 5FKOA 2R93J 1E3OC 3M4OJ 3V6GA 1U9NA 2E2IJ 1JUSA 3JRFA 2UXIA 2Q24A 5C44J 3VP5A 3MKLA 1YRNA 3OSFA 2EZHA 3NAUA 2P81A 2Y9YA 2OERA 1IG7A 4IHWA 5FKLA 5IP7J 5EYRA 4AUXA 5DTDA 5EDNA 2HI3A 3GTLJ 5CW8A 1PUFB 3RZOJ 1RETA 5M3MJ 5JLWA 3ZQIA 5C4YA 3ANPA 2ME6A 2TRTA 2VI6A 2X6OA 2R5ZA 2O8KA 3MN2A 2PMZN 2OI8A 4ABZA 2HYTA 5F1JA 4CYCB 1ZGWA 5EF6A 3PPBA 3QPSA 2XPUA 4A3KJ 3LWJA 2CQXA 3AQSA 2E19A 3K7AJ 3HOXJ 3JRCA 3W6VA 3VIBA 4W97A 1S7EA 3LSRA 3AQTA 1XG1A 2ECCA 2QKOA 4JX4A 1K83J 2WAQN 2XSDC 5FHPA 3KKDA 3M3YJ 3ZOBA 3VUQA 3NI7A 2Y9ZA 2COBA 4X6AJ 5FMPA 2ZOYA 3G1LA 3CDLA 1K61A 1FIPA 4UUSA 5IPAA 4V2GA 2YVHA 2FBQA 3S2HJ 1ETYA 1LFBA 5AQCA 1UMQA 2WV1A 2O7TA 3QPLA 1OCPA 3KZ9A 3A01B 3MVPA 3JR9A 4XRMA 4B3AA 1TWGJ 3BTLA 3CRJA 1UHSA 5DS9A 4BBRJ 3SDGA 1NTCA 3LNQA 1HDPA 2NS7A 5CXIA 4JL3A 3HEFA 3DCFA 3Q0WA 1I3QJ 3S15J 2GFNA 2DA7A 2PBXA 2NP3A 1ZR2A 1RPWA 2XPWA 3G1OA 3RH2A 3BR2A 1ZTRA 4FTHA 2YVEA 4MXMA 1MBGA 2X48A 1UI5A 5F0CA 2WGBA 3ON2A 5EGOB 1EF4A 1RESA 3IH4A 2MGQA 5FJ8J 3ZQCA 3RZDJ 3NARA 3S1NJ 3GTJJ 3GTPJ 2ZCXA 3F1BA 4M3GA 3JRDA 2CUEA 5EEAA 5J1RA 4DZJA 2FJ1A 3V78A 4D7NA 2REKA 3ANGA 1QRYA 3S2DJ 3H3VK 1H89C 1UG2A 5J3LA 2F07A 1LE8A 2LR8A 1AHDP 2OPTA 1BW5A 2DMTA 3RKQA 3CCYA 5GP9A 1AU7A 1TWCJ 2DMUA 4B1RA 5C4XJ 3HIMA 2XGCA 3OSGA 1JT0A 1BL0A 4XRSA 2G7SA 3HTIA 2YS9A 3B6CA 3QBMA 1IC8A 4M3DA 3Q0UA 1W0UA 2M9HA 2ME0A 4PXIA 3Q0VA 4DW6A 2LY9A 2Y0SN 2HDDA 1SANA 2VKEA 4XRSG 4BY7J 2LFBA 5M5WJ 2ZCMA 1HDDC 2PZ9A 5FLVA 3HB9A 2WUIA 4J19A 2K40A 2EBIA 4A3EJ 2ID3A 1A6IA 4Y7NJ 4XK4A 5K7FA 2E1OA 3S1RJ 5EGOA 1GDTA 4IHYA 2HKUA 4IHVA 2QF7A 3MNLA 3S14J 3IUVA 3NNRA 4IEJA 2DJNA 1Y1VJ 3HGGA 4UUTA 5JLXA 1NK3P 1MNMC 3JRIA 3HE0A 2L7MP 1CQTA 3KNWA 1B72B 2G7LA 1ETKA 2K9QA 4CGRA 3FISA 4KWAA 4GFLA 5K7ZA 5IP6A 1QVTA 5IOYA 2VUMJ 4FCYA 1XC5A 3GEUA 5K7HA 4A3MJ 4QSHA 1TC3C 2HOTA 2DG8A 2JWTA 2D5VA 1IDZA 4GCKA 3ZQHA 2MSYA 5K58A 1Z77A 1ETXA 2DA4A 1FJLA 1MBEA 3GTGJ 3VW0A 4DZPA 1NK2P 2HXIA 3OOUA 2TCTA 2UXPA 3BTJA 3QKXA 5F08A 3A03A 2B63J 4MO7A 3BT9A 3HOWJ 5FLMJ 1MBFA 2L7FP 4A3LJ 2JK3A 4YZEA 1ORKA 2VPRA 2RHAA 5IP9J 2DMNA 2IU5A 2DA3A 1B72A 3KKCA 1G2HA 2MG4A 1Y1WJ 9ANTA 1I50J 3FRQA 1ENHA 2R5YB 2DMQA 3BJBA 3EGQA 2DG7A 1AKHB 2CRGA 4BBSJ 4NN1A 1PUFA 2GM4A 3IV5A 2KDZA 3O8GA 4XIDA 2E2JJ 5F0HA 1WH7A 1ETOA 3ZQGA 4AF5A 3HGYA 1ZR4A 2H1KA 2R92J 4S0HB 2GENA 4CYCA 3S1MJ 2MW8A 2ZOZA 3BHQA 3S16J 2OF7A 3HOYJ 2Y2ZA 3ON4A 1WH5A 3H0GJ 3WHBA 2ECBA 4A3FJ 2R7ZJ 4A3CJ 4MLOA 3QQAA 4A3DJ 1GT0C 2NOGA 2X9DA 3VW2A 1IGNA 1H88C 2AO9A 3JREA 1JKPC 1UI6A 1VF9A 2L9RA 2CQQA 2NX4A 5IYDJ 2M2EA 4NELA 4L62A 3GTOJ 5E3LA 5F27A 1DU6A 3E7QA 3NPIA 1RKTA 4QTRA 1JTYA 4AC6A 2QTQA 3G1MA 2XPVA 2Y30A 2LLKA 2I10A 5GPAA 1T56A 3FK7A 5IOZA 4JNNA 3O60A 4ACIA 1BA5A 3L1PA 1U8BA 5HBUA 5D19A 1X2NA 2FX0A 5EG0B 5J1UA 1IV6A 2W53A 3HOVJ 4NDLA 1TWAJ 3A01A 5E3OA 2CUFA 1WPKA 3TP3A 3JSJA 3ZQFA 2DA2A 2XB5A 3LSJA 4MFDA 1X58A 1W0TA 5D18A 3LSPA 3O8HA 3VVXA 3VVZA 1OFCX 5FKNA 4BKXA 3Q3SA 3FK6A 2K9SA 4JKZA 5C3EJ 1H8AC 2UXOA 4MFEA 3E7LA 3B81A 1OCTC 2AHQA 3IH2A 1FTTA 2EZIA 1YRNB 4FE4A 1X2MA 3LSGA 5M5YJ 1SGMA 2XGEA 3BCGA 2G7GA 3G7RA 2ZCNA 2RAEA 2HOSA 3I4MJ 2LD5A 1FTZA 2GBYA 1VFCA 2M0CA 5EZHA 4C2MJ 1Z0XA 3BR3A 2RASA 1WI3A 3RD3A 2R0QC 1HCRA 5H9TA 2IEKA 4A3IJ 2ID6A 2R5ZB 5M3FJ 4HKUA 5GPCA 5BNGA 3LHQA 4M3EA 1I6HJ 4LOCA 2IAIA 2QCOA 3HBLA 1GV2A 1MH4A 4D7MA 4RDUA 1T33A 3GZIA 1O4XA 1MBHA 4BXXJ 2JA6J 4JYKA 4UDSA 4AC0A 5E3MA 3S1QJ 3PASA 3BTIA 1P7JA 3HDDA 2W48A 4FISA 3FKIJ 5IYCJ 4QIWN 4I6ZA 1R9TJ 1IRZA 3BR5A 2DTZA 2IBDA 2LKXA 3HKZN 4IHXA 4MIMA 5EZGA 5E3NA 1ZKGA 1VNDA 4JX6A 2DA6A 1GVDA 3K2AA 2GLOA 4UUSB 3VPRA 2ELKA 3I4NJ 4BY1J 5CXGA 3OIOA 3WHCA 2N8GA 3BQYA 1JKOC 4Y52J 3COLA 2NVQJ 3TW7A 5DAJA 1IDYA 2VKVA 2DA5A 2L0KA 1FIAA 4W1UA 3DPJA 1D5YA 3HM5A 4D5CA 1LFUP 3HTAA 5HAWA 2LVSA 1BJZA 3IH3A 1JUMA 2XB0X 1U9OA 2QWTA 3HTHA 2DA1A 5FKMA 3B6AA 2FD5A 5IYBJ 2D6YA 3NXCA 3NRGA 5F0FA 1FEXA 1JJ8C 3VOKA 2LTPA 2DMPA 1MSFC 5FGLA 2CJJA 2HOAA 3T6NA 3C2BA 2NP5A 3GBGA 4GFBA 3PO3J 4A3GJ 4C3HJ 4GCLA 1QPIA 3VW1A 3BR1A 4L5EA 5HODA 2ZB9A 5FKKA 1Q1VA 2QOPA 1F36A 1JJ6C 3CWRA 3SJMA 3VVYA 4A3JJ 4V2FA 1ITYA 1RKWA 4AYBN 2V57A 2GUHA 2JJ7A 4B4CA 1IUFA 3C07A 2DN0A 3JRAA 4X1EA 3JRGA 2NVXJ 1DU0A 1RR7A 2Y31A 5F04A 1JKRC 4C3IJ 2LP0A 3EUPA 1LE8B 1F43A 3DEWA 5HSZA 2O9LA 2NVYJ 3P9TA 4A69C 1VI0A 1SFOJ 3VOXA 4DYQA 5C4JJ 2UXUA 2M8GX 4JP0A 4XICA 3TEDA 2HYJA 1HLVA 1JGGA 2NS8A 5D1RA 2R5YA 3BG5A 2XRLA 4M3BA 3RQIA 4JX5A 1B8IB 1MH3A 4RBOA 1ETWA 4DYCA 4GFKA 1ETQA 4HNVA 3UKGA 1AKHA 3GTQJ 2JMWA 4ICHA 1U78A 1POGA 1JUPA 4G12A 2G3BA 1ZK8A 2WB1N 2HQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BNI A;  1WGX A;  3S17 J;  4A3B J;  3JRH A;  1QVU A;  3CMY A;  1MBK A;  2YUS A;  3GTM J;  3GTK J;  1JKQ C;  2K9N A;  3BRU A;  1ZQ3 P;  3BQZ A;  3CJD A;  2FQ4 A;  2HXO A;  2JA5 J;  2L7Z A;  1JT6 A;  4DYR A;  3BTC A;  2H8R A;  2YU9 J;  1MBJ A;  2XDN A;  2JA7 J;  1GUU A;  3BR0 A;  3PO2 J;  4MK6 A;  3HTJ A;  3TW6 A;  1MSE C;  2JN6 A;  4M3F A;  5EFY A;  2JA8 J;  1A5J A;  3A02 A;  3BG3 A;  3PM1 A;  3BG9 A;  4I76 A;  4M6V A;  4GCT A;  2E2H J;  1WCM J;  3FIW A;  2UXH A;  4C3J J;  3F0C A;  3LOC A;  2CU7 A;  5M5X J;  1HOM A;  1B8I A;  2EZK A;  4EEF G;  3ZQL A;  1P7I A;  2LK2 A;  5EG0 A;  2EQR A;  3JRB A;  3TP0 A;  4ME9 A;  2O7O A;  3D1N I;  3HOU J;  2EH3 A;  2EZL A;  4A93 J;  1XS9 A;  3G56 A;  3SFI A;  1HF0 A;  1BW6 A;  1TWH J;  4FE7 A;  1ETV A;  3CQZ J;  3S5R A;  2KT0 A;  4D5F A;  1IJW C;  1TWF J;  2G0E A;  1JTX A;  3LJL A;  1OJL A;  2NVT J;  1GV5 A;  5J1Y A;  3HOZ J;  1APL C;  3BR6 A;  2QIB A;  2M34 A;  2XGD A;  5FKO A;  2R93 J;  1E3O C;  3M4O J;  3V6G A;  1U9N A;  2E2I J;  1JUS A;  3JRF A;  2UXI A;  2Q24 A;  5C44 J;  3VP5 A;  3MKL A;  1YRN A;  3OSF A;  2EZH A;  3NAU A;  2P81 A;  2Y9Y A;  2OER A;  1IG7 A;  4IHW A;  5FKL A;  5IP7 J;  5EYR A;  4AUX A;  5DTD A;  5EDN A;  2HI3 A;  3GTL J;  5CW8 A;  1PUF B;  3RZO J;  1RET A;  5M3M J;  5JLW A;  3ZQI A;  5C4Y A;  3ANP A;  2ME6 A;  2TRT A;  2VI6 A;  2X6O A;  2R5Z A;  2O8K A;  3MN2 A;  2PMZ N;  2OI8 A;  4ABZ A;  2HYT A;  5F1J A;  4CYC B;  1ZGW A;  5EF6 A;  3PPB A;  3QPS A;  2XPU A;  4A3K J;  3LWJ A;  2CQX A;  3AQS A;  2E19 A;  3K7A J;  3HOX J;  3JRC A;  3W6V A;  3VIB A;  4W97 A;  1S7E A;  3LSR A;  3AQT A;  1XG1 A;  2ECC A;  2QKO A;  4JX4 A;  1K83 J;  2WAQ N;  2XSD C;  5FHP A;  3KKD A;  3M3Y J;  3ZOB A;  3VUQ A;  3NI7 A;  2Y9Z A;  2COB A;  4X6A J;  5FMP A;  2ZOY A;  3G1L A;  3CDL A;  1K61 A;  1FIP A;  4UUS A;  5IPA A;  4V2G A;  2YVH A;  2FBQ A;  3S2H J;  1ETY A;  1LFB A;  5AQC A;  1UMQ A;  2WV1 A;  2O7T A;  3QPL A;  1OCP A;  3KZ9 A;  3A01 B;  3MVP A;  3JR9 A;  4XRM A;  4B3A A;  1TWG J;  3BTL A;  3CRJ A;  1UHS A;  5DS9 A;  4BBR J;  3SDG A;  1NTC A;  3LNQ A;  1HDP A;  2NS7 A;  5CXI A;  4JL3 A;  3HEF A;  3DCF A;  3Q0W A;  1I3Q J;  3S15 J;  2GFN A;  2DA7 A;  2PBX A;  2NP3 A;  1ZR2 A;  1RPW A;  2XPW A;  3G1O A;  3RH2 A;  3BR2 A;  1ZTR A;  4FTH A;  2YVE A;  4MXM A;  1MBG A;  2X48 A;  1UI5 A;  5F0C A;  2WGB A;  3ON2 A;  5EGO B;  1EF4 A;  1RES A;  3IH4 A;  2MGQ A;  5FJ8 J;  3ZQC A;  3RZD J;  3NAR A;  3S1N J;  3GTJ J;  3GTP J;  2ZCX A;  3F1B A;  4M3G A;  3JRD A;  2CUE A;  5EEA A;  5J1R A;  4DZJ A;  2FJ1 A;  3V78 A;  4D7N A;  2REK A;  3ANG A;  1QRY A;  3S2D J;  3H3V K;  1H89 C;  1UG2 A;  5J3L A;  2F07 A;  1LE8 A;  2LR8 A;  1AHD P;  2OPT A;  1BW5 A;  2DMT A;  3RKQ A;  3CCY A;  5GP9 A;  1AU7 A;  1TWC J;  2DMU A;  4B1R A;  5C4X J;  3HIM A;  2XGC A;  3OSG A;  1JT0 A;  1BL0 A;  4XRS A;  2G7S A;  3HTI A;  2YS9 A;  3B6C A;  3QBM A;  1IC8 A;  4M3D A;  3Q0U A;  1W0U A;  2M9H A;  2ME0 A;  4PXI A;  3Q0V A;  4DW6 A;  2LY9 A;  2Y0S N;  2HDD A;  1SAN A;  2VKE A;  4XRS G;  4BY7 J;  2LFB A;  5M5W J;  2ZCM A;  1HDD C;  2PZ9 A;  5FLV A;  3HB9 A;  2WUI A;  4J19 A;  2K40 A;  2EBI A;  4A3E J;  2ID3 A;  1A6I A;  4Y7N J;  4XK4 A;  5K7F A;  2E1O A;  3S1R J;  5EGO A;  1GDT A;  4IHY A;  2HKU A;  4IHV A;  2QF7 A;  3MNL A;  3S14 J;  3IUV A;  3NNR A;  4IEJ A;  2DJN A;  1Y1V J;  3HGG A;  4UUT A;  5JLX A;  1NK3 P;  1MNM C;  3JRI A;  3HE0 A;  2L7M P;  1CQT A;  3KNW A;  1B72 B;  2G7L A;  1ETK A;  2K9Q A;  4CGR A;  3FIS A;  4KWA A;  4GFL A;  5K7Z A;  5IP6 A;  1QVT A;  5IOY A;  2VUM J;  4FCY A;  1XC5 A;  3GEU A;  5K7H A;  4A3M J;  4QSH A;  1TC3 C;  2HOT A;  2DG8 A;  2JWT A;  2D5V A;  1IDZ A;  4GCK A;  3ZQH A;  2MSY A;  5K58 A;  1Z77 A;  1ETX A;  2DA4 A;  1FJL A;  1MBE A;  3GTG J;  3VW0 A;  4DZP A;  1NK2 P;  2HXI A;  3OOU A;  2TCT A;  2UXP A;  3BTJ A;  3QKX A;  5F08 A;  3A03 A;  2B63 J;  4MO7 A;  3BT9 A;  3HOW J;  5FLM J;  1MBF A;  2L7F P;  4A3L J;  2JK3 A;  4YZE A;  1ORK A;  2VPR A;  2RHA A;  5IP9 J;  2DMN A;  2IU5 A;  2DA3 A;  1B72 A;  3KKC A;  1G2H A;  2MG4 A;  1Y1W J;  9ANT A;  1I50 J;  3FRQ A;  1ENH A;  2R5Y B;  2DMQ A;  3BJB A;  3EGQ A;  2DG7 A;  1AKH B;  2CRG A;  4BBS J;  4NN1 A;  1PUF A;  2GM4 A;  3IV5 A;  2KDZ A;  3O8G A;  4XID A;  2E2J J;  5F0H A;  1WH7 A;  1ETO A;  3ZQG A;  4AF5 A;  3HGY A;  1ZR4 A;  2H1K A;  2R92 J;  4S0H B;  2GEN A;  4CYC A;  3S1M J;  2MW8 A;  2ZOZ A;  3BHQ A;  3S16 J;  2OF7 A;  3HOY J;  2Y2Z A;  3ON4 A;  1WH5 A;  3H0G J;  3WHB A;  2ECB A;  4A3F J;  2R7Z J;  4A3C J;  4MLO A;  3QQA A;  4A3D J;  1GT0 C;  2NOG A;  2X9D A;  3VW2 A;  1IGN A;  1H88 C;  2AO9 A;  3JRE A;  1JKP C;  1UI6 A;  1VF9 A;  2L9R A;  2CQQ A;  2NX4 A;  5IYD J;  2M2E A;  4NEL A;  4L62 A;  3GTO J;  5E3L A;  5F27 A;  1DU6 A;  3E7Q A;  3NPI A;  1RKT A;  4QTR A;  1JTY A;  4AC6 A;  2QTQ A;  3G1M A;  2XPV A;  2Y30 A;  2LLK A;  2I10 A;  5GPA A;  1T56 A;  3FK7 A;  5IOZ A;  4JNN A;  3O60 A;  4ACI A;  1BA5 A;  3L1P A;  1U8B A;  5HBU A;  5D19 A;  1X2N A;  2FX0 A;  5EG0 B;  5J1U A;  1IV6 A;  2W53 A;  3HOV J;  4NDL A;  1TWA J;  3A01 A;  5E3O A;  2CUF A;  1WPK A;  3TP3 A;  3JSJ A;  3ZQF A;  2DA2 A;  2XB5 A;  3LSJ A;  4MFD A;  1X58 A;  1W0T A;  5D18 A;  3LSP A;  3O8H A;  3VVX A;  3VVZ A;  1OFC X;  5FKN A;  4BKX A;  3Q3S A;  3FK6 A;  2K9S A;  4JKZ A;  5C3E J;  1H8A C;  2UXO A;  4MFE A;  3E7L A;  3B81 A;  1OCT C;  2AHQ A;  3IH2 A;  1FTT A;  2EZI A;  1YRN B;  4FE4 A;  1X2M A;  3LSG A;  5M5Y J;  1SGM A;  2XGE A;  3BCG A;  2G7G A;  3G7R A;  2ZCN A;  2RAE A;  2HOS A;  3I4M J;  2LD5 A;  1FTZ A;  2GBY A;  1VFC A;  2M0C A;  5EZH A;  4C2M J;  1Z0X A;  3BR3 A;  2RAS A;  1WI3 A;  3RD3 A;  2R0Q C;  1HCR A;  5H9T A;  2IEK A;  4A3I J;  2ID6 A;  2R5Z B;  5M3F J;  4HKU A;  5GPC A;  5BNG A;  3LHQ A;  4M3E A;  1I6H J;  4LOC A;  2IAI A;  2QCO A;  3HBL A;  1GV2 A;  1MH4 A;  4D7M A;  4RDU A;  1T33 A;  3GZI A;  1O4X A;  1MBH A;  4BXX J;  2JA6 J;  4JYK A;  4UDS A;  4AC0 A;  5E3M A;  3S1Q J;  3PAS A;  3BTI A;  1P7J A;  3HDD A;  2W48 A;  4FIS A;  3FKI J;  5IYC J;  4QIW N;  4I6Z A;  1R9T J;  1IRZ A;  3BR5 A;  2DTZ A;  2IBD A;  2LKX A;  3HKZ N;  4IHX A;  4MIM A;  5EZG A;  5E3N A;  1ZKG A;  1VND A;  4JX6 A;  2DA6 A;  1GVD A;  3K2A A;  2GLO A;  4UUS B;  3VPR A;  2ELK A;  3I4N J;  4BY1 J;  5CXG A;  3OIO A;  3WHC A;  2N8G A;  3BQY A;  1JKO C;  4Y52 J;  3COL A;  2NVQ J;  3TW7 A;  5DAJ A;  1IDY A;  2VKV A;  2DA5 A;  2L0K A;  1FIA A;  4W1U A;  3DPJ A;  1D5Y A;  3HM5 A;  4D5C A;  1LFU P;  3HTA A;  5HAW A;  2LVS A;  1BJZ A;  3IH3 A;  1JUM A;  2XB0 X;  1U9O A;  2QWT A;  3HTH A;  2DA1 A;  5FKM A;  3B6A A;  2FD5 A;  5IYB J;  2D6Y A;  3NXC A;  3NRG A;  5F0F A;  1FEX A;  1JJ8 C;  3VOK A;  2LTP A;  2DMP A;  1MSF C;  5FGL A;  2CJJ A;  2HOA A;  3T6N A;  3C2B A;  2NP5 A;  3GBG A;  4GFB A;  3PO3 J;  4A3G J;  4C3H J;  4GCL A;  1QPI A;  3VW1 A;  3BR1 A;  4L5E A;  5HOD A;  2ZB9 A;  5FKK A;  1Q1V A;  2QOP A;  1F36 A;  1JJ6 C;  3CWR A;  3SJM A;  3VVY A;  4A3J J;  4V2F A;  1ITY A;  1RKW A;  4AYB N;  2V57 A;  2GUH A;  2JJ7 A;  4B4C A;  1IUF A;  3C07 A;  2DN0 A;  3JRA A;  4X1E A;  3JRG A;  2NVX J;  1DU0 A;  1RR7 A;  2Y31 A;  5F04 A;  1JKR C;  4C3I J;  2LP0 A;  3EUP A;  1LE8 B;  1F43 A;  3DEW A;  5HSZ A;  2O9L A;  2NVY J;  3P9T A;  4A69 C;  1VI0 A;  1SFO J;  3VOX A;  4DYQ A;  5C4J J;  2UXU A;  2M8G X;  4JP0 A;  4XIC A;  3TED A;  2HYJ A;  1HLV A;  1JGG A;  2NS8 A;  5D1R A;  2R5Y A;  3BG5 A;  2XRL A;  4M3B A;  3RQI A;  4JX5 A;  1B8I B;  1MH3 A;  4RBO A;  1ETW A;  4DYC A;  4GFK A;  1ETQ A;  4HNV A;  3UKG A;  1AKH A;  3GTQ J;  2JMW A;  4ICH A;  1U78 A;  1POG A;  1JUP A;  4G12 A;  2G3B A;  1ZK8 A;  2WB1 N;  2HQ5 A; 
#chains in the Genus database with same CATH topology
 1WGX A;  2DOD A;  1MDM A;  1TW3 A;  3GTM J;  3E5U A;  5ED4 A;  1KZH A;  3BRU A;  3LFK A;  2ZBK A;  2FQ4 A;  4L9N A;  4XM3 A;  2HXO A;  2CO5 A;  2HZD A;  2H6B A;  4PSX A;  3KYL A;  2H8R A;  1PUE E;  2DFF A;  3QYB A;  1H9G A;  4C9Y A;  2JA7 J;  2FNA A;  3BR0 A;  4MK6 A;  4D9J A;  1ZG1 A;  3TW6 A;  1IAW A;  1MSE C;  1WJ5 A;  4ZC3 A;  2IPQ X;  3TBI A;  1X1A A;  1J9I A;  2AS5 F;  2NYX A;  2H1L A;  2GAU A;  2W57 A;  2ZXJ A;  5EJC A;  1VQ9 I;  1H9T A;  3FIW A;  3H3U A;  2Q8K A;  4C3J J;  3F0C A;  1BC7 C;  1Y8Q B;  4Q48 A;  2CU7 A;  1W7P D;  1U5T C;  3ZQL A;  4JK1 X;  3HRS A;  5EG0 A;  1BBY A;  1FP2 A;  1ON1 A;  3HOU J;  2HQN A;  3E0J B;  2WAD A;  5HLG A;  3J7Y J;  1TWH J;  5F64 A;  4UVC A;  3RCO A;  1ETV A;  2OZU A;  3S5R A;  4XQF A;  2CV0 A;  1RRJ A;  1OJL A;  2D2W A;  2OTJ I;  3BR6 A;  4EJO A;  5FKO A;  3L2U A;  1E3O C;  4HQE A;  1U9N A;  3P9I A;  1JUS A;  4AVZ A;  3Q5F A;  3V6G A;  5TGT A;  3I71 A;  5C44 J;  3VP5 A;  3MKL A;  2VB6 A;  2M4K A;  2EZH A;  3REO A;  2VQL A;  2HDW A;  2QZ8 A;  2P81 A;  3NAU A;  4M9S A;  1W5C C;  1IF1 A;  2OER A;  4A6D A;  2O6G E;  3VWB A;  5EDN A;  3R0J A;  3HTS B;  2FEZ A;  2EK5 A;  2OAZ A;  3R60 A;  4JQF A;  5M3M J;  5JLW A;  1IN4 A;  2ME6 A;  2VI6 A;  1V5E A;  1R1T A;  2R5Z A;  2JZY A;  3MN2 A;  3JCU C;  5F1J A;  4N4O B;  2IGN A;  1QPM A;  1Z6R A;  3LWJ A;  3AQS A;  2E19 A;  1MMG A;  4ZZD A;  4FX0 A;  3JRC A;  2W24 A;  1OYY A;  1S7E A;  1QO0 D;  2KJB A;  3HHG A;  2ZME B;  5FO5 A;  2XSD C;  2YU3 A;  3ZOB A;  4CDG A;  3NI7 A;  1C0W A;  3CZ6 A;  3U2R A;  5FMP A;  4BXU A;  2ZOY A;  2IS6 A;  2XF6 A;  1YJN I;  4HST A;  3G1L A;  2UWM A;  5JFR A;  1LDD A;  2VC1 A;  4ETS A;  4WCG A;  4BJT A;  1K61 A;  5BS6 A;  2FML A;  3DTI A;  3NQO A;  2YVH A;  3L00 A;  2A2F X;  3R0A A;  3PFY A;  2WV1 A;  4WXD A;  1AOY A;  2O7T A;  2BE5 F;  4F55 A;  1VQK I;  3JR9 A;  4RGS A;  3BWG A;  2OUM A;  2R7W A;  1TWG J;  4EAT A;  4UUV A;  1TQI A;  1ULY A;  2KRF A;  3WTX C;  4BBR J;  3M07 A;  3LNQ A;  4IOC F;  3SWH A;  3A2K A;  2VIX A;  3ZP5 A;  2L9N A;  3DEE A;  3HEF A;  3W6K B;  1A36 A;  2EIN H;  3ISP A;  3Q0W A;  3DBL B;  2E5Z A;  3CP8 A;  2HPI A;  3H3Z A;  3QP6 A;  1JI8 A;  4PZJ A;  3HJE A;  4LG0 B;  4XKC A;  3FWE A;  3GVA A;  3HSF A;  2XHK A;  5L3E A;  1FZP B;  1ZR2 A;  3K9T A;  3LAP A;  2ESN A;  5LRR A;  1D3Y A;  5FLX K;  4FTH A;  4IQJ A;  3KCC A;  3OYJ A;  3F8F A;  3F8C A;  2K3P A;  2RRE A;  4E7K A;  3RI4 A;  1ZAO A;  3FMR A;  2IT0 A;  3ZPL A;  4A2U A;  2K9L A;  1B1B A;  3FXM A;  5DD8 A;  5LBQ A;  3CUO A;  5EEA A;  4RB3 C;  1R49 A;  4Z2Y A;  3D5R C;  2REK A;  4P5O A;  4LGW A;  4PK4 A;  3ML6 A;  3FXU A;  5DM6 F;  4YRV A;  5B66 C;  1WJD A;  4M74 A;  2DMU A;  4ME9 A;  4I99 C;  4L5J A;  2XGC A;  1QU3 A;  3I4P A;  2G7S A;  2YS9 A;  3B6C A;  3QBM A;  1K78 B;  2M3A A;  3F3X A;  3KZY A;  2HOE A;  3KEY A;  1IC8 A;  2M9H A;  1DPR A;  3TGN A;  4EM0 B;  3I3L A;  1FWZ A;  2E34 A;  4PXI A;  3BPX A;  4EJV A;  5GAH J;  2Y0S N;  1IN8 A;  2PG4 A;  1SAN A;  1HDD C;  1ZH5 A;  2LSO A;  4HSR A;  2ID3 A;  2QYO A;  1GDT A;  4XK4 A;  1RNL A;  2E1O A;  3V42 A;  5EGO A;  3DXJ F;  1WSU A;  5FRN A;  3LA3 A;  4O6J A;  3TOA A;  2CV1 A;  3MNL A;  1AWC A;  3HTU A;  1ZN2 A;  3X2Q H;  1OQY A;  1Y1V J;  1MNM C;  3PIP F;  4MNU A;  4ZYH A;  3FXL A;  3PL8 A;  1S7A A;  3OYK A;  3JRI A;  3KNW A;  2RNJ A;  3F9K A;  3LSH A;  2GZW A;  4OAY A;  3U1D A;  5L3G A;  1B72 B;  2HEO A;  4GYG A;  5GAE J;  1XMA A;  3KPH A;  1HW1 A;  3T1B A;  4ENK A;  2DDB A;  1FOX A;  1G4D A;  1XX5 A;  4GFL A;  1KQ0 A;  3V7C A;  1XC5 A;  3GEU A;  4ASN A;  5K7H A;  2PEX A;  4QSH A;  3JAM Z;  1YYV A;  1TC3 C;  2RV8 A;  5LFA A;  2VE9 A;  2Z16 A;  1LEB A;  2VON A;  1ETX A;  5E1Z B;  2EV5 A;  4Q4Z F;  2DA4 A;  2KIF A;  1T6S A;  2X6W A;  4FAS D;  2XUB A;  4MQ9 F;  4OIN F;  2TCT A;  2XC7 A;  3ZN1 A;  1XGS A;  2F2E A;  2Q0O A;  1DPU A;  4MO7 A;  1R5G A;  3QU6 A;  3KYD B;  5DCF A;  3HXL A;  3K1P A;  3V8K A;  3PIO F;  1IRX A;  2DFE A;  3MFK A;  3ESW B;  3ZGK A;  2DA3 A;  2XRN A;  2Y0S A;  2IA2 A;  3FRQ A;  9ANT A;  5CQG A;  4F7Z A;  2XF5 A;  1ENH A;  2Y75 A;  2MH9 A;  4P1W A;  4LB6 B;  2DMQ A;  5BMZ A;  1BR4 A;  3HL2 A;  2DG7 A;  1UEL B;  3OOP A;  2P0W A;  1WI9 A;  2DO7 A;  1QA6 A;  3AG3 H;  1ZRE A;  1XGN A;  3M1E A;  2HNH A;  2CWE A;  2FBH A;  1ZR4 A;  2H1K A;  5E79 C;  4KIB A;  1ON2 A;  4CYC A;  1V54 H;  1B9N A;  3GFL A;  2FBI A;  4PDK A;  2K4J A;  3QOE A;  1UFM A;  1BM9 A;  2K85 A;  2QUF A;  1UJ8 A;  3WHB A;  4A3F J;  1MJA A;  1WJB A;  2K4B A;  5AIP A;  4L18 B;  3SZT A;  4A3D J;  3HPH A;  2Z5U A;  1JGS A;  1GHC A;  1DP3 A;  4Y17 A;  2QQB A;  4NHJ A;  4UY8 I;  2ZNZ A;  2FSW A;  2NX4 A;  4CCM A;  3P9C A;  3GTO J;  4L62 A;  2OQR A;  1LEA A;  5E3L A;  4WF2 A;  1DU6 A;  2DDA A;  1JTY A;  2K3F A;  2L4A A;  3CTA A;  1QHG A;  2QTQ A;  5GPA A;  2Y30 A;  2LLK A;  3H5N A;  4HLY A;  3AG1 H;  4HRI A;  4JNN A;  1S8N A;  3WTV C;  4ACI A;  4A0X A;  5J8F A;  1R23 A;  1TQM A;  5E8I A;  3GXO A;  5J1U A;  1PP7 U;  2W53 A;  2V9K A;  3HOV J;  4WXC A;  1TWA J;  2IW5 A;  2P7C B;  3CC2 I;  1TLH B;  1XGM A;  4ON0 A;  4I0B A;  3ZQF A;  3LSJ A;  5HS9 A;  1OIS A;  4KIS A;  5FFX A;  3RTR A;  2GXA A;  2MC3 A;  5A2Q Z;  2W25 A;  2ISY A;  4BKX A;  1STZ A;  2ETH A;  3CD6 I;  2X85 A;  1H8A C;  2UXO A;  4MFE A;  4XLH A;  2JUG A;  5L3B A;  1FMV A;  1QZY A;  3LSG A;  5M5Y J;  3KFW X;  2AXT C;  2DK8 A;  3G7R A;  2XDV A;  2RAE A;  3J81 Z;  1VFC A;  2M87 A;  5EZH A;  3EQL F;  5CPR B;  2KQR A;  4DGW B;  1R71 A;  3RPU D;  2IEK A;  2KKO A;  4A3I J;  2YSR A;  1WWX A;  3T0Y A;  3KP3 A;  5E1W A;  5BNG A;  2VJ4 A;  1QZE A;  4G6T B;  3SHF A;  3LHQ A;  4BAC A;  4LOC A;  2R7S A;  2IRF G;  4BE2 A;  2HR3 A;  1OCO H;  4D7M A;  2FE3 A;  3OYG A;  4OIR F;  3DTK A;  1A31 A;  4RAG A;  2FQ3 A;  3RKW A;  5DUI A;  4BXX J;  2LBF B;  5FD5 A;  5DD4 A;  1P7J A;  3ZXS A;  4MTE A;  1LKX A;  3SXY A;  1QGP A;  1HKQ A;  3FKI J;  4F3Q A;  1YO5 C;  1F1Z A;  1R9T J;  3M8J A;  3KEO A;  3IKT A;  3E6M A;  4IHX A;  3HKZ N;  4MIM A;  1VND A;  4JX6 A;  3GWZ A;  1GVD A;  2QEN A;  3OL4 A;  2ZNY A;  1VQN I;  5JVT A;  2BW3 A;  4UUS B;  5CXG A;  2XAU A;  4WIB A;  2EV6 A;  2MYS A;  3CF5 F;  3QWL A;  2H94 A;  2LG4 A;  3EUK L;  5FRM A;  3TW7 A;  4N9H A;  5DAJ A;  4PFO A;  1GVJ A;  4RB0 A;  4DBQ A;  4W1U A;  4KMU X;  3V7S A;  1JE8 A;  3HM5 A;  4D5C A;  4P9U A;  2DQL A;  2LVS A;  2RQQ A;  2VBZ A;  3HHH A;  3FX3 A;  1SVM A;  1XD7 A;  2HYF A;  3K4K A;  4LLG F;  5IYB J;  1FBQ A;  3K10 A;  1F4K A;  1OCR H;  3NRG A;  2MBF A;  2P6S A;  5F0F A;  1WQ2 A;  1JJ8 C;  2LTP A;  2DMP A;  5D5V B;  2FXA A;  3IC7 A;  3GBG A;  4A3G J;  3LFU A;  6PAX A;  1IZ1 A;  2V6C A;  2FOW A;  5FKK A;  1S5L C;  3CCV I;  2W1O A;  3VVY A;  4EGZ A;  4A3J J;  1D0X A;  3SFZ A;  3GFJ A;  4HNU A;  1F5T A;  3ABT A;  2PMH A;  3O3K A;  2W7N A;  1DU0 A;  4OD5 A;  2Y31 A;  1JKR C;  4ZYG A;  2LP0 A;  3MKY B;  1E3H A;  3HSE A;  4PSW A;  3W2W A;  2BEO A;  2JT1 A;  2NVY J;  1LE8 B;  1F43 A;  1U0J A;  4ZYE A;  3OYE A;  4XIC A;  3HUG A;  2I8D A;  2OQG A;  2WTE A;  5D1R A;  3RQI A;  1R6R A;  4MEX F;  4RBO A;  4XSZ F;  1ETW A;  3KP5 A;  5J40 A;  4OAZ A;  1AKH A;  1YX3 A;  1RIO H;  1EV7 A;  3ELK A;  3GTQ J;  5TRD A;  4G12 A;  1J7K A;  3L2V A;  2DU9 A;  2HQ5 A;  3NS4 A;  3J7Z I;  1QVU A;  1IXS B;  3JTH A;  2GA2 A;  3ZR8 X;  2ZJ2 A;  1R36 A;  2WY7 Q;  1Y39 A;  1JKQ C;  4BL0 B;  4CGZ A;  2JVG A;  1X1D A;  3V8L A;  2ZY9 A;  2L7Z A;  1JT6 A;  2P5K A;  1Z1D A;  2EFP A;  4IJA A;  1MBJ A;  2L2O A;  1GUU A;  3CCJ I;  3EYY A;  1FC3 A;  2JA8 J;  3A02 A;  2KIQ A;  3H1C A;  5J4Y A;  1W5S A;  1T38 A;  2PLY A;  4IHS A;  2CV2 A;  1Z67 A;  4RLF A;  4I76 A;  4M6V A;  1E2X A;  2M30 A;  5ICE A;  3I5U A;  2E2H J;  2R4G A;  2NRA C;  1NG6 A;  2BY2 A;  2PQ8 A;  1I3A A;  3LQQ A;  4Q47 A;  4CSW A;  3WU1 B;  1YG2 A;  2CS3 A;  5BPD A;  3DLA A;  5CVR A;  3BOQ A;  2ZXH A;  4LG3 A;  5HLT A;  1FSE A;  2EJR A;  2ZC2 A;  3JRB A;  1N75 A;  2O7O A;  4IRG A;  4L0Z B;  3DWL E;  1ZAR A;  2F4O B;  4XKV A;  1BW6 A;  3DQV C;  3FDY A;  3QOP A;  4P96 A;  4KNY A;  4FE7 A;  2BXZ A;  3G71 I;  1FPQ A;  3GF2 A;  1A6Q A;  3BPV A;  1JTX A;  3LJL A;  4Y3O A;  3MD2 A;  3HOZ J;  2M34 A;  5CLS A;  1R22 A;  2XGD A;  4KDP A;  2R93 J;  1MNE A;  4ZDL A;  4U7D A;  4Y13 A;  1DDN A;  2E2I J;  3JRF A;  1K6O A;  1YRN A;  2LH9 A;  1P6R A;  2Y9Y A;  1IG7 A;  5FKL A;  5IP7 J;  3OMY A;  2MC4 A;  5EYR A;  4AUX A;  5DTD A;  5BOX A;  2J5P A;  4NC7 A;  1IN7 A;  1PUF B;  1L0O C;  4XMY A;  1FYK A;  3RZO J;  2R7X A;  4BDY A;  2O3F A;  3ZQI A;  2TRT A;  4BXF A;  1VQ5 I;  3I59 A;  3UR3 C;  1EA3 A;  3J7A O;  4MEY F;  4O5V A;  2FOK A;  1P2F A;  1LQ1 A;  2O8K A;  1G3T A;  3FHN A;  5TIS C;  2VN2 A;  1ZGW A;  1WKM A;  5EF6 A;  3CCS I;  5BPI A;  4A3K J;  2VXD A;  4NB5 A;  3KLN A;  3K7A J;  3HOX J;  1D8J A;  2HDC A;  4BHB A;  4P9F A;  5IY5 H;  1NG7 A;  2GXG A;  2DPU A;  4XLP F;  1YIO A;  2FA5 A;  4ESB A;  3VUQ A;  3B73 A;  2RQP A;  3CC4 I;  2B7E A;  1MMS A;  1LVK A;  2BVL A;  4LD5 A;  5IPA A;  5ILV A;  3K4M A;  1W1W E;  3S2H J;  5D5W B;  5AQC A;  1HKS A;  4YG2 F;  4OWR B;  3FKJ A;  3QPL A;  3BCB A;  3CJT B;  4II3 A;  4CYD A;  4HF0 A;  3JSP A;  4YFK F;  1VQ4 I;  1UHS A;  2X1E A;  3H5R A;  4E7I A;  2B9S A;  2FF4 A;  5CXI A;  4JL3 A;  2NS0 A;  4IRI A;  3VFZ A;  2DOF A;  4I2O A;  1USS A;  3RSN A;  2VOD A;  3S15 J;  2GFN A;  5D8L B;  2DA7 A;  2ZJR F;  2ZME A;  2KMU A;  3KP2 A;  4A12 A;  2PBX A;  3IRR A;  1RPW A;  3WE2 A;  2OCE A;  3NRV A;  3BR2 A;  2YVE A;  4MXM A;  1MBG A;  4G6Q A;  2WGB A;  3V7R A;  3ON2 A;  1NH3 A;  3IH4 A;  4AVP A;  5FJ8 J;  4CZZ A;  3GTJ J;  3GTP J;  4IRV A;  3J80 K;  5J1R A;  4M72 A;  3ULQ B;  3ZCO A;  4DZJ A;  3V78 A;  4LB5 A;  2IXS A;  1Y6I A;  3ANG A;  4IHT A;  3S2D J;  2VQH A;  3WTS C;  2KIU A;  5J3L A;  2LR8 A;  1BW5 A;  1R58 A;  2GA1 A;  2MD0 A;  4RAZ A;  5K5O A;  3CCY A;  1FNN A;  2BYV E;  2HTJ A;  2QSG X;  4AM3 A;  2IGM A;  3H36 A;  4B1R A;  4ZH4 F;  2HGC A;  5FGM A;  3ZN0 A;  2VPL A;  3EUH A;  1BOB A;  4PJ0 C;  1PVE A;  1TBX A;  2WAE A;  4A6E A;  1MJB A;  3DBH B;  3LSI A;  2LY9 A;  1J59 A;  2BY1 A;  4YFN F;  2LFB A;  1SAU A;  1YW7 A;  2PZ9 A;  1Q1H A;  4HAM A;  2UZK A;  3CES A;  4A3E J;  3F6V A;  4Y7N J;  2HKU A;  5K7F A;  2AQE A;  3KZI C;  4IHV A;  3SZP A;  1LVA A;  2QF7 A;  3IUV A;  4ANJ A;  2A07 F;  3EYI A;  2DJN A;  3PNT A;  3FXR A;  4UUT A;  5JLX A;  3L2Q A;  3DBR B;  4E6K G;  2BVM A;  3AG2 H;  4CGR A;  3OYN A;  1CF7 B;  5D6F A;  3CME I;  3GZ6 A;  2EWN A;  2VUM J;  3CO7 C;  4RAY A;  4UB6 C;  3DLL F;  2Q2E A;  1B9M A;  4A3M J;  4GDF A;  1MJ9 A;  3BY6 A;  3FZV A;  4PFP A;  2F5D A;  2DG8 A;  2JWT A;  3WG9 A;  1IDZ A;  1VQ8 I;  3Q9V A;  2F5E A;  4M6X A;  1X4O A;  4NQW B;  3ZQH A;  1J2X A;  1I6X A;  1Z7U A;  3CF2 A;  2MSY A;  5KK1 A;  5K58 A;  3F6O A;  4C2T A;  1VQM I;  2EFQ A;  3HOT A;  2BGC A;  4G94 A;  3K4B A;  3VW0 A;  1R5I D;  2RC4 A;  1G3W A;  2CSO A;  3OOU A;  1T2K A;  3CCQ I;  1T0F C;  1T39 A;  4HX7 A;  1VQL I;  3BTJ A;  3A03 A;  4CA0 A;  1PDN C;  3AAF A;  2PJR A;  3K6G A;  3N05 A;  1SFU A;  2L7F P;  3SYT A;  1ZGJ A;  2O0Y A;  4A3L J;  2JVH A;  4XKB A;  3CCU I;  4YZE A;  1U5T A;  1R00 A;  2DMN A;  3FF5 A;  3PNY A;  2YPR A;  3TO6 A;  2LRE A;  3GZN B;  1J5Y A;  2XKO A;  5CJ9 A;  1RZ4 A;  1B72 A;  5LHH A;  2PBI A;  1G2H A;  3OYD A;  1KQ8 A;  4R79 A;  2R5Y B;  3S3N A;  2Y0M A;  1ZRD A;  2V7F A;  2Q1Z B;  3VB2 A;  3IV5 A;  3O8G A;  4HV6 A;  2C6Y A;  4PJN A;  3SQN A;  2EB7 A;  1IXC A;  1MDM B;  1X3W B;  4AF5 A;  2F4I A;  2VBY A;  3CDH A;  4ITV A;  2MLG A;  2R92 J;  3GW2 A;  3S1M J;  2K86 A;  3I58 A;  2GWR A;  5ERI A;  2OF7 A;  1OR7 C;  2X4H A;  2Y2Z A;  1F9N A;  3HOY J;  4CCO A;  2V79 A;  4B3X A;  1X3U A;  2ECB A;  2JPC A;  4BHP A;  3LAJ A;  4OD4 A;  4MLO A;  2DPD A;  5IT9 K;  5H6Q A;  3U21 A;  2BY0 A;  4U0V A;  1GT0 C;  2WY8 Q;  1B59 A;  2X9D A;  1IGN A;  3VW2 A;  3CUQ A;  2AO9 A;  1UI6 A;  4FX4 A;  3VSL A;  2VL8 A;  3T8T A;  1YIT I;  4NEL A;  1YFH A;  1BI2 A;  3S2W A;  1SEU A;  3NPI A;  2I5U A;  2XPV A;  2I10 A;  1T56 A;  2PFB A;  1UAA A;  3FK7 A;  4IF4 A;  1IN5 A;  3L1P A;  1T8I A;  5HBU A;  5D19 A;  5EG0 B;  1IV6 A;  3RYR A;  2NAZ A;  3A01 A;  1KYW A;  1TQP A;  4BJ5 C;  5LGN A;  4U88 A;  3A1Y A;  3D5L A;  2M7A A;  5LHG A;  3CCL I;  4L9T A;  4D1Q A;  4MFD A;  1W0T A;  3DU5 A;  3MCZ A;  3H0D A;  3VVX A;  2J5O A;  4H4K C;  2VC0 A;  3V4G A;  2DFH A;  2CMP A;  5CYV A;  1D1A A;  3CLQ A;  3DKW A;  4L9V A;  3Q3S A;  3IWZ A;  5C3E J;  4CZC A;  5DEQ A;  5JHF A;  3B81 A;  2NVU B;  2WC2 A;  3K4L A;  2AHQ A;  3IH2 A;  1W7P A;  4HPQ A;  2XF7 A;  4FE4 A;  1X2M A;  2LC2 A;  3WG7 H;  1WRJ A;  3BCG A;  3HPG A;  2E1N A;  1FYL A;  3VYR B;  3IWF A;  1FOK A;  3F23 A;  4B44 A;  1QQI A;  5LHI A;  2O61 A;  2M0C A;  2Z3Y A;  4UV8 A;  4C2M J;  3MZY A;  1WI3 A;  4ZDO A;  3RD3 A;  2R0Q C;  4XLE A;  1HCR A;  1MGT A;  2ID6 A;  2R5Z B;  1WHU A;  1DQU A;  2ELJ A;  4M3E A;  5FD6 A;  2QCO A;  3LSM A;  2R7F A;  2QQ8 A;  1MH4 A;  2ZJQ F;  1S3J A;  4OMY A;  3FBN B;  3WTU C;  1FLI A;  4GO1 A;  4L5I A;  3GZI A;  1O4X A;  1MBH A;  1ZRF A;  4JYK A;  2IS1 A;  1A04 A;  4LIU A;  3DV8 A;  5FLX Z;  4AIH A;  2W48 A;  3AG4 H;  1YW8 A;  1IRZ A;  4QIW N;  2E71 A;  4BHC A;  2KRH A;  2IBD A;  1KA8 A;  3AFH A;  3CMA I;  4AIJ A;  1AA7 A;  1EH6 A;  2DA6 A;  2IVM A;  2EA2 A;  4TV7 A;  3VPR A;  4FHT A;  4R1H A;  3W2V A;  1HC8 A;  5HLI A;  3WHC A;  3HZJ A;  3HYI A;  3SDB A;  2NVQ J;  5GAG J;  1SD4 A;  3R4K A;  2DA5 A;  2YX4 A;  1SD6 A;  1BR1 A;  4QLC U;  3C18 A;  4BE0 A;  2JQ7 A;  2R7T A;  3JW4 A;  4E4H A;  2QBY A;  1HW2 A;  3GO5 A;  1P92 A;  4DVY P;  4HQM A;  3RYP A;  2ADU A;  5LD2 C;  5KCM A;  4L9J A;  2RN7 A;  3HIF A;  1SMT A;  1X1C A;  2XB0 X;  3MQ0 A;  4WX9 A;  2OA4 A;  3PUB A;  4DBR A;  2QWT A;  3HTH A;  3M8E A;  1P9Q C;  3B6A A;  4MHG A;  2D6Y A;  2LRD A;  4JBA A;  3ABL H;  3UNG C;  1ZG3 A;  1O7L A;  3PQK A;  3QYF A;  2M7B A;  4BH9 A;  3VOK A;  3T6N A;  2NP5 A;  2VBW A;  4GCL A;  3VW1 A;  5KAI C;  4YIR X;  2JSC A;  2UXX A;  3BR1 A;  5HDK A;  1ZLK A;  5HOD A;  4BNC A;  2QGU A;  4KUM A;  4E7J A;  1Q1V A;  3OYM A;  2QOP A;  3WGG A;  3HG9 A;  2R7U A;  1JJ6 C;  4H0E A;  3CWR A;  3RQ4 A;  4J00 A;  4UNO A;  3AL0 C;  1ITY A;  1RKW A;  5D5U B;  4HDV A;  1UZC A;  2NOJ B;  4KJZ A;  1YIJ I;  2DN0 A;  2JUC A;  4X1E A;  2DT7 B;  1L3L A;  4EJU A;  3EUP A;  4C3I J;  3GEZ A;  3OWT A;  4LIT A;  1SFO J;  1VI0 A;  4LK0 F;  3QAH A;  2Z99 A;  4DYQ A;  3CC7 I;  2EFW A;  3VOX A;  3TED A;  2HYJ A;  2NS8 A;  3BG5 A;  4M3B A;  4NC8 A;  3ONQ A;  1B8I B;  2ESH A;  1MH3 A;  4YEJ A;  3H9G A;  4HNV A;  4UV9 A;  3CCM I;  4YEL A;  4BQA A;  1U78 A;  1POG A;  1ZK8 A;  1A35 A;  2WB1 N;  2Z1D A;  2BV6 A;  2HQR A;  1KON A;  3KYC B;  4WXH A;  4LFU A;  1WJE A;  2ZXI A;  3JRH A;  2IA0 A;  1MBK A;  3TDU C;  2YUS A;  3CMY A;  5CVU A;  1VQ6 I;  1G3Y A;  3GTK J;  1X1P A;  1Z3Y A;  1ZYR F;  2K9N A;  3GLX A;  1VQO I;  3BQZ A;  2L4M A;  2DLL A;  2L02 A;  1S72 I;  4HYE A;  3VTI A;  2DW4 A;  2JA5 J;  2IJL A;  3KZZ A;  4ZYA A;  1FT9 A;  2YU9 J;  2QQ9 A;  4DYR A;  3BTC A;  1FBS A;  4MTD A;  4C2U A;  3ZMU A;  2XDN A;  3N4M A;  1P4X A;  3PO2 J;  3G2B A;  5K1Y A;  3HTJ A;  4U9N A;  3HOS A;  2LOO A;  2BHY A;  1HA8 A;  4ESF A;  1RUO A;  4V19 K;  3BG3 A;  3BG9 A;  2KPM A;  4IL6 C;  3ZMD A;  2DYS H;  4GCT A;  1WJC A;  1K79 A;  1WCM J;  1E17 A;  3E5X A;  1X19 A;  2BHZ A;  2EZK A;  2K5C A;  1B4A A;  5LLQ A;  5J6X A;  1P7I A;  4XON A;  2EPF A;  4O3M A;  4BEH A;  1VZ0 A;  1OYI A;  1LB2 A;  3D1N I;  2L54 A;  2EH3 A;  2EZL A;  1Z7L A;  3F22 A;  2E36 A;  3G56 A;  3GZ5 A;  1TNS A;  4BDZ A;  2GQQ A;  4XLC A;  3GUD A;  4D5F A;  2G0E A;  2PMU A;  4CCN A;  1BC8 C;  2CW7 A;  3ABM H;  4HX4 A;  2KRC A;  4YII A;  3M4O J;  2WB1 A;  2UXI A;  5LGU A;  3OSF A;  5TJJ A;  4PCQ A;  1BI3 A;  3PNV A;  1RUN A;  1R4N B;  1T08 B;  3ZMS A;  1WJF A;  5L3D A;  2XAJ A;  4C2M A;  4M71 A;  4KA4 A;  2HI3 A;  3GTL J;  2DT5 A;  5CW8 A;  4I0A A;  1RET A;  2XV4 S;  4EMS A;  3Q9S A;  3G73 A;  1SVL A;  2HVR A;  3ANP A;  3TQN A;  1TL8 A;  2B1E A;  2X6O A;  1YE9 A;  1U8R A;  1QHH D;  2VQG A;  5KAF C;  2V1U A;  4B09 A;  5E8G A;  3OYB A;  4CYC B;  2OCC H;  1IRG A;  1OCC H;  3PPB A;  2A6T A;  2LYC A;  2L5Q A;  3G6E I;  2XPU A;  2HVQ A;  3K1N A;  3TDZ C;  1KGS A;  4Y4R A;  2XIG A;  3ROU A;  2DCE A;  3WE3 A;  4LK1 F;  5ICC A;  2OBP A;  3IL2 A;  3AQT A;  1XG1 A;  2WAQ N;  5FHP A;  3WOD F;  2GIZ A;  3TMO A;  3OS0 A;  3CCE I;  3M3Y J;  2COB A;  2HWV A;  5DCM A;  1KQ9 A;  4X6A J;  5ICG A;  4MQV A;  2H6C A;  1PJR A;  1YHQ I;  4KT5 C;  4KN4 X;  1FIP A;  3ERE D;  2OJE D;  4V2G A;  4ZYD A;  2FRH A;  2DK5 A;  2ISZ A;  2CFX A;  3G3Z A;  1ETY A;  5CVJ A;  2X6X A;  1UMQ A;  2VAS A;  4XOR A;  3KZ9 A;  3OIP A;  3MVP A;  2EIL H;  1LPQ A;  2IP2 A;  4BE1 A;  3BTL A;  1HQC A;  3HKZ A;  3CRJ A;  2VJJ A;  1NTC A;  3C3W A;  1O7F A;  3ZRG A;  2CUZ A;  1EKE A;  1HDP A;  2NS7 A;  4HOB A;  4BQO A;  2EIJ H;  4FT8 A;  1TW2 A;  4EQQ A;  1MZB A;  1X4P A;  3I55 I;  3AL0 B;  1ODD A;  4B8X A;  3CJQ B;  4YFX F;  2ZCW A;  2D1V A;  3IRQ A;  1D5V A;  1O3T A;  1J75 A;  4GRI A;  1YJ9 I;  3BG7 A;  3G1O A;  5LEK A;  3RH2 A;  3F72 A;  1D1C A;  2GOX B;  2DFI A;  5F0C A;  5D4S A;  3W2A A;  1RES A;  1EF4 A;  3ZQC A;  3RZD J;  2R7O A;  1P4W A;  3NAR A;  3NWT A;  4XNF A;  4M3G A;  3OV8 A;  3JRD A;  2CUE A;  1YJW I;  1XB4 A;  2AXL A;  2PI0 A;  4D7N A;  2KL4 A;  1LFP A;  3FHZ A;  2WAQ A;  3H3V K;  5B1B H;  2UV1 A;  4DOZ A;  4ZTF A;  1H89 C;  4AWX B;  2VT3 A;  2F07 A;  1YI2 I;  1AHD P;  4U7B A;  2CH0 A;  3OS1 A;  4BS9 A;  2CFO A;  2ACJ A;  2DMT A;  1XMX A;  2IGO A;  4ZTJ A;  3RKQ A;  3L9F A;  2G7H A;  3HIM A;  2M8E A;  2OZ6 A;  3DF8 A;  3HTI A;  4XRS A;  3S32 A;  4OIO F;  4M3D A;  4X0G A;  3Q0U A;  4XN0 A;  3WTY C;  1H0M A;  1XSX A;  2ME0 A;  2STT A;  4UXN A;  2VBX A;  2P5L C;  1FOY A;  2VJI A;  3RPU A;  4A5N A;  4S05 A;  4BY7 J;  2ZCM A;  3HB9 A;  1LDK B;  1MIJ A;  2K40 A;  4J19 A;  4BGD A;  2EBI A;  1YW9 A;  3FXJ A;  2A69 F;  3WTW C;  3L2W A;  1JXS A;  3S14 J;  4S04 A;  2ZSI B;  1V55 H;  3HGG A;  2A61 A;  1NK3 P;  3H9Q A;  3HE0 A;  1K7A A;  1CQT A;  2W85 A;  1ETK A;  2K9Q A;  3P5J A;  3FIS A;  1N77 A;  1OYW A;  1WZ2 A;  2VLA A;  2BBY A;  2VJ5 A;  1QVT A;  5IOY A;  3KEQ A;  2XVC A;  2OU2 A;  4OIP F;  2DT6 A;  4N0B A;  2KP6 A;  2HOT A;  3IKV A;  4RGR A;  3RIR A;  5JI6 A;  2D5V A;  1XCV A;  4RMN A;  5EEG A;  4GCK A;  2QA4 I;  1E0E A;  3OY9 A;  1LJ9 A;  2FMY A;  2BZT A;  2RKH A;  3TL4 X;  1T98 A;  2LF7 A;  3GTG J;  4HF2 A;  2QKM B;  1OMI A;  1XPX A;  2HXI A;  1GLN A;  2K7L A;  2X1D A;  4U9L A;  3QKX A;  3QPT A;  2B63 J;  4E7S A;  3GCM A;  3BT9 A;  1ZHF A;  4NC6 A;  4LLL A;  1MBF A;  3H92 A;  3LSK A;  4CIC A;  4ESJ A;  1FX7 A;  2A68 F;  1ORK A;  2VPR A;  1OPC A;  1DP7 P;  4XN3 A;  2O5R A;  1W36 D;  3P7N A;  5JR3 A;  3OR1 C;  3RDI A;  1TT5 B;  4BAY A;  3HUG B;  2MG4 A;  1Y1W J;  1RC9 A;  2V6E A;  2E7X A;  3BJB A;  3E3V A;  3EGQ A;  1AKH B;  2CRG A;  4NN1 A;  3BJ6 A;  1MD0 A;  5ILS A;  4OIQ F;  2KDZ A;  2E2J J;  4RLQ A;  2PJP A;  3MMY B;  2V9P A;  2ZXW H;  1HW5 A;  2Y48 A;  1D8K A;  2KZG A;  5D5X B;  3EPZ A;  4BUP A;  2QSH X;  1MMD A;  1PP8 F;  4RM2 A;  5HDG A;  3HGY A;  2HZT A;  2GEN A;  5HLH A;  1FMW A;  4PJL A;  4GYI A;  4E7H A;  2ZOZ A;  4RGU A;  3O6B B;  4ZDP A;  5K5R A;  3S16 J;  3JSO A;  3H0G J;  5DV5 A;  1TT0 A;  2W00 A;  5B3S H;  1WVR A;  3QQA A;  1MW7 A;  2NOG A;  4I98 B;  4Q5S F;  1YOV B;  1I39 A;  1JKP C;  1NHA A;  1R1U A;  2HYG D;  2VKD A;  5CVI A;  2EIK H;  1U3E M;  4ZJZ A;  2M2E A;  4N9I A;  4KIG A;  4A0Y A;  2JA2 A;  5F27 A;  3JTG A;  3E7Q A;  2XRO A;  4QTR A;  2A6E F;  2LF8 A;  3G1M A;  4KIF A;  5H6R A;  3F8M A;  1U8B A;  3DFG A;  3CP2 A;  2GXB A;  3QRF F;  4CHU A;  4NDL A;  5HVQ C;  4UVA A;  5DUK A;  2FU4 A;  2K9M A;  2CUF A;  3OYI A;  1UHM A;  1XCB A;  2FJI 1;  2A05 A;  3JSJ A;  2R3S A;  3G4S I;  2XB5 A;  4G8X A;  1X58 A;  3MAJ A;  5D18 A;  3LSP A;  2M5W A;  3VVZ A;  2M45 A;  5FKN A;  3C2H A;  5B5E C;  4A5M A;  2MAB A;  3W3C A;  4AD9 A;  2K9S A;  2ZSH B;  3COA C;  4LG0 A;  2EZI A;  3ECO A;  4ENJ A;  1ZG5 A;  3PFI A;  1YRN B;  3DPU A;  1W36 C;  2XGE A;  2VXZ A;  1GXQ A;  2ZCN A;  2Z33 A;  1SAX A;  3I4M J;  3LA7 A;  3CCR I;  2GBY A;  5K5Q A;  3L2C A;  3F8N A;  3DPT A;  3BR3 A;  1D1B A;  2CQN A;  3I59 B;  2V1D A;  5GPC A;  2WV0 A;  4M73 A;  4CCK A;  2IAI A;  1GXP A;  3IP4 B;  4EJW A;  2F48 A;  1YS7 A;  1T33 A;  1FP1 D;  4IO9 F;  2P7V B;  4QWQ A;  2JA6 J;  1OLT A;  2L3D A;  1ZGA A;  2A5Y B;  3K1M A;  5E3M A;  3I56 I;  5DM7 F;  3BTI A;  3H5A A;  3F8B A;  1K78 A;  1FOW A;  3WTT C;  5IYC J;  3BCA A;  2KLO A;  3BR5 A;  3E6D A;  2H27 A;  1R1V A;  5E3N A;  1ZKG A;  3J80 Z;  2R7D A;  3K2A A;  2F4M B;  3NEU A;  4WWC A;  2QSF X;  4QPO A;  2BXY A;  2FNP A;  1M1E B;  3OL3 A;  3I4N J;  5KHD A;  4BY1 J;  4B43 A;  3K4C A;  3OIO A;  3BQY A;  2P6T A;  4Y52 J;  1I1G A;  3COL A;  2DYR H;  3WU0 A;  3CUQ C;  2Z9O A;  2XSJ C;  2BOL A;  1VQ7 I;  2OTL I;  2L0K A;  2YVX A;  4HBL A;  2L9S A;  3DPJ A;  2G9W A;  2FBK A;  3BG6 A;  5HAW A;  2FUG 2;  3WGI A;  3IH3 A;  2WBM A;  5AIQ A;  3FM5 A;  1U9O A;  2L01 A;  2DA1 A;  1IRF A;  5FKM A;  2QKL B;  1FSH A;  2FD5 A;  3M8F A;  4KN7 X;  1IO2 A;  3DEU A;  5KNL A;  2XAQ A;  1BI1 A;  1I27 A;  2CJJ A;  2KJC A;  2P5V A;  3C2B A;  2VT2 A;  2YR2 A;  4GFB A;  1ONV A;  4C3H J;  2PN6 A;  3KLO A;  5L3F A;  1IN6 A;  4L5E A;  1G6N A;  1KU2 A;  3K4N A;  2XAS A;  2O03 A;  3S8P A;  2MH2 A;  2H8W A;  3PUF A;  1ZLJ A;  3ABU A;  4U0Y A;  2V57 A;  4AYB N;  3SZG A;  1Z21 A;  2GUH A;  1XN7 A;  2E1M B;  3C07 A;  4FET A;  2QVO A;  3C1D A;  3JRG A;  2F6C A;  4BJ6 C;  5F04 A;  1R5H A;  3K0L A;  3I9V 2;  3P9T A;  5HSZ A;  2V26 A;  1E3P A;  2IGK A;  3MZH A;  1EJ9 A;  2UXU A;  1SC7 A;  3CDI A;  2L7K A;  3CJR B;  3VYS B;  1HLV A;  1BI0 A;  4JX5 A;  2X51 A;  4RGX A;  4DYC A;  2VKH A;  1T0F A;  3UKG A;  2RDP A;  4I7H A;  2G3B A;  1JUP A;  2RGV A;  3LWF A;  4IX7 A;  3C2G A;  3VSK A;  4CXF A;  3HC7 A;  3ASO H;  3L7W A;  3S17 J;  1ERD A;  3BNI A;  4A3B J;  1O3R A;  1YQA A;  2V4J C;  3I53 A;  4HF1 A;  3A0H C;  3M7G A;  3JAM K;  4HG2 A;  1ZQ3 P;  2V1N A;  3CJD A;  1Z3X A;  5B1A H;  3K8P C;  5E18 F;  3OR2 C;  2X6Y A;  3FXK A;  3H9J A;  5DDG A;  3HRU A;  3QU3 A;  3LST A;  2F5C A;  5J47 A;  4GGG A;  1OCZ H;  4XOT A;  2JN6 A;  2TDX A;  1OKR A;  4M3F A;  1A5J A;  5EFY A;  4LMY A;  1XDU A;  1Y8R B;  2DAO A;  1K4S A;  2CG4 A;  3PM1 A;  3QOD A;  4XKW A;  1SFX A;  1Y0U A;  2MD5 A;  4AID A;  4C30 A;  3TO9 A;  2UXH A;  1HST A;  2Q2E B;  3BZK A;  2IS4 A;  4NBQ A;  3M1C A;  2E1C A;  3LOC A;  5M5X J;  1OR7 A;  3A0B C;  4NUB A;  1B8I A;  1HOM A;  5LGT A;  2XAH A;  1FY7 A;  5LRS A;  4EEF G;  2CW8 A;  4IZZ A;  4AYB A;  3KP7 A;  2LK2 A;  1KU3 A;  1YLF A;  2EQR A;  2W84 A;  4I02 A;  5IT9 Z;  3TP0 A;  3ZMT A;  5E17 F;  4A93 J;  2DTR A;  1XS9 A;  2VE8 A;  5ILU A;  1S9H A;  1BIB A;  3SFI A;  1HF0 A;  2O8X A;  3QP5 A;  1O3Q A;  2F5F A;  3I0T A;  3CLO A;  3CQZ J;  2PJR B;  1IUY A;  2KT0 A;  2X0L A;  3EDP A;  1TWF J;  5KVR A;  1IJW C;  2NVT J;  5D6E A;  1GV5 A;  5J1Y A;  4AIK A;  2R7V A;  1APL C;  2QIB A;  3DU6 A;  2D1H A;  3OYC A;  2ICW G;  4XL9 A;  1U5T B;  1SFK A;  4XLF A;  2Q24 A;  4EJT A;  1Z05 A;  1LUJ B;  2EIM H;  2DQR A;  2H09 A;  3K70 D;  2IA1 A;  4IHW A;  2KZV A;  2RVC A;  4XSX F;  2ZJP F;  2LNB A;  3HSR A;  1LDJ A;  1I1S A;  3D0S A;  3GME A;  5C4Y A;  5L3C A;  2QLZ A;  4D0P A;  1SVO A;  4F91 B;  1BR2 A;  4G7Z F;  1WFX A;  3FXO A;  2LDU A;  2PMZ N;  4ABZ A;  2OI8 A;  2HYT A;  2V9V A;  5JVG F;  4CH7 A;  2NXN B;  4EM2 A;  4DQ2 A;  3W6J B;  3T5X A;  1TTY A;  3HRT A;  3QPS A;  3DPL C;  2CQX A;  1IV8 A;  1T95 A;  2EA4 A;  5J4V A;  3W6V A;  2LBF A;  1HXD A;  3NWS A;  3VIB A;  4W97 A;  3LSR A;  2ECC A;  2QKO A;  4JX4 A;  3VDX A;  1K83 J;  3CUQ B;  3KKD A;  5GTH C;  2Y9Z A;  1W5T A;  3TO7 A;  5LEJ A;  3BP8 A;  4CUG A;  3H35 A;  3DTE A;  2A5W A;  3M9A A;  4XLN F;  2CQK A;  5A2Q K;  3MKZ A;  2JSP A;  4KFC A;  3ERM A;  3LMM A;  3CDL A;  4IRH A;  1U6G A;  1VQP I;  4UUS A;  3PJR A;  2COM A;  2FBQ A;  2UXN A;  1LFB A;  2K02 A;  2R7Q A;  3VYU B;  4E7L A;  1K4T A;  1S6L A;  2E7W A;  3MWM A;  1OCP A;  2W4S A;  4BYY A;  2XGX A;  3A01 B;  3N97 A;  4XRM A;  4U0W A;  4B3A A;  3OYF A;  4JOM A;  3J81 K;  4ENM A;  1W4M A;  5DS9 A;  1DUX C;  3SDG A;  4A0Z A;  1G8X A;  1G3S A;  1HSJ A;  1UHW A;  1YS6 A;  1REP C;  2V1X A;  3SEZ A;  3DCF A;  1I3Q J;  2LKP A;  2CW0 F;  2LY1 A;  2M0M A;  1TNT A;  2DI3 A;  4HV5 A;  2R7R A;  2NNY A;  1CGP A;  2EV0 A;  1W7P B;  2A3S A;  2NP3 A;  2HKO A;  2JPB A;  2XPW A;  2VQC A;  3BZC A;  4G9Y A;  2OD5 A;  1ZTR A;  2PMZ A;  2QQA A;  2X48 A;  1XSV A;  3LA2 A;  1JHF A;  4BQQ A;  4CO8 A;  4J01 A;  4KYW A;  1FBU A;  1UI5 A;  3ZMV A;  3K70 C;  4HEA 2;  5EGO B;  1ZEL A;  2MGQ A;  2YX7 A;  3S1N J;  2ZCX A;  3F1B A;  3U1K A;  3E6C C;  1VTN C;  3ZQ7 A;  3FMS A;  2FJ1 A;  2KIS A;  1QRY A;  3PQJ A;  3DKX A;  3P9K A;  2WAF A;  1UG2 A;  2VOP A;  1LE8 A;  2QM3 A;  2OPT A;  5FRO A;  3E1S A;  3EET A;  1ZRC A;  1XDS A;  2E5N A;  4PJM A;  5GP9 A;  1AU7 A;  1TWC J;  3KX2 A;  4UHT A;  5BQT A;  4HNT A;  3OYA A;  3OSG A;  1JT0 A;  1BL0 A;  5C4X J;  2PFV A;  2BY3 A;  2DXI A;  2XAF A;  4IPA A;  4ENN A;  3F21 A;  3ZMZ A;  3O2P E;  1JHH A;  2DBB A;  5E20 A;  1Z9C A;  1W0U A;  2GOM A;  2L9V A;  1Y56 A;  3KP4 A;  1O3S A;  2UUZ A;  3E6B A;  2CGP A;  1V5G A;  3Q0V A;  4HZF A;  4DW6 A;  2OC6 A;  2KHM A;  2HDD A;  2VKE A;  2HKX A;  4XRS G;  2HS5 A;  5M5W J;  5FLV A;  3IAS 2;  3FM3 A;  2WUI A;  4G7H F;  2PX9 A;  1A6I A;  3S1R J;  4UVB A;  3GFM A;  4IHY A;  1LNW A;  5CVV A;  2HPM A;  2KIM A;  2MA3 A;  3NNR A;  4IEJ A;  3GYH X;  2OV7 A;  3U9G A;  3J7A Y;  2QBY B;  2VOO A;  5IT3 A;  2L7M P;  1U2W A;  2K27 A;  5HS8 A;  2G7L A;  2KDO A;  4CCJ A;  1Z6T A;  4KWA A;  2F5V A;  1ACI A;  2ZFW A;  1S7O A;  1UG0 A;  4IQ4 A;  5K7Z A;  5IP6 A;  4FCY A;  3KP6 A;  2RNG A;  3TOB A;  5GTI C;  2EFO A;  3KIO A;  5HDN A;  3WU2 C;  1B6A A;  2CUJ A;  2MLK A;  1BJA A;  4KIC A;  4OMZ A;  3L09 A;  2QEX I;  2XAG A;  4IKF A;  1Z77 A;  2Z2S B;  1DGW Y;  1HBX G;  3GLL A;  3IAM 2;  4Y33 A;  5CKT A;  3BJO A;  1FJL A;  1MBE A;  4F92 B;  4DZP A;  1BOA A;  1NK2 P;  3QPH A;  2UXP A;  3C7J A;  5F08 A;  1PYV A;  4XOP A;  5D4R A;  3HOW J;  5FLM J;  2JK3 A;  4HA8 A;  3OIQ A;  1BIA A;  5IP9 J;  2RHA A;  3ZQQ A;  5CQE A;  3PSF A;  1I5Z A;  1SD5 A;  2IU5 A;  3KKC A;  5FB2 A;  1I50 J;  1X3Z B;  2HU9 A;  2D45 A;  3VYT B;  3GX4 X;  3OYL A;  4HX8 A;  1UCR A;  4BBS J;  1PUF A;  1FYM A;  3FBI B;  2GM4 A;  4XID A;  2P8T A;  2STW A;  5F0H A;  3ABK H;  1WH7 A;  1ETO A;  2IS2 A;  4HDU A;  5HNF A;  1Y0N A;  3ZQG A;  4PJJ A;  4HW0 A;  3VOE A;  4S0H B;  5JHU A;  4ZZL A;  2MW8 A;  1HKT A;  3BHQ A;  3T8R A;  3ON4 A;  1WH5 A;  2LKS A;  4DJA A;  2MFZ A;  2A6H F;  2R7Z J;  4A3C J;  3BDD A;  4YIF A;  3TKY A;  2ZFU A;  4B47 A;  3OYH A;  2HQA A;  1H88 C;  3K2Z A;  1Z91 A;  3JRE A;  1VF9 A;  2L9R A;  2CQQ A;  3K4J A;  5IYD J;  1V3F A;  5HS7 A;  1SMY F;  3DP7 A;  2CQ7 A;  1RKT A;  4XBF A;  4XRF A;  4AC6 A;  5DYM A;  2JRT A;  3ASN H;  4E70 A;  5FFZ A;  3L2R A;  1MMN A;  3IHU A;  2NNN A;  2M4G A;  4NNJ A;  4B48 A;  5GAD J;  5IOZ A;  2DOA A;  3A4C A;  3O60 A;  1BA5 A;  1QNT A;  3WTZ A;  4R8H A;  1G59 A;  1X2N A;  4BEH B;  2FX0 A;  1YX5 A;  3DKY A;  3BJA A;  5AON A;  2CYY A;  5E3O A;  1WPK A;  3KE2 A;  3TP3 A;  3RJP A;  3BZ6 A;  1WJA A;  2DA2 A;  2LMD A;  1TP4 A;  4L0Y B;  1EH7 A;  2GIV A;  3K69 A;  3O8H A;  4OU0 A;  2P4W A;  4FQG A;  3I54 A;  3BLY A;  1OFC X;  4RM3 A;  3R6S A;  1MKM A;  2HVS A;  3FK6 A;  4JKZ A;  4MGR A;  4I09 A;  2XKP A;  3E7L A;  3BRO A;  4II2 A;  1V5F A;  1K6Y A;  1XSD A;  1OCT C;  2E60 A;  3SEQ A;  1IW7 F;  2ZO4 A;  4XR6 A;  1FTT A;  3S3O A;  1XMK A;  4GXO A;  3VEP A;  4RAF A;  2BW3 B;  4PGG A;  1TZL A;  4RB2 C;  1SGM A;  4EV0 A;  4AU7 A;  1R4M B;  5H2F C;  2G7G A;  1BN5 A;  4LLN A;  3KET A;  1KYZ A;  3R61 A;  2HOS A;  1KU7 A;  2KFD A;  3GFI A;  2LD5 A;  4BU2 A;  1FTZ A;  1S29 A;  2JRM A;  4KIT B;  3E5Q A;  1Z0X A;  2RAS A;  2WA0 A;  5H9T A;  4KMF A;  1SFE A;  5M3F J;  4XLA A;  4M9X A;  5EEH A;  3S93 A;  4HKU A;  3IUO A;  3QYE A;  1I6H J;  2LY2 A;  3E97 A;  3HBL A;  1GV2 A;  3B02 A;  1J0R A;  2QWW A;  5F6F A;  4RDU A;  1N78 A;  5HNH A;  4GCV A;  4N4N B;  4UDS A;  4AC0 A;  5HOO A;  4EGY A;  2HTS A;  1EH8 A;  2W82 A;  3S1Q J;  3MKW B;  3PAS A;  3HDD A;  4FIS A;  4PUS A;  4CCL A;  2E35 A;  4M6Y A;  4I6Z A;  4EM1 A;  2DTZ A;  2LKX A;  5DCM B;  1J09 A;  2Y69 H;  3EUA A;  5EZG A;  1UST A;  2GLO A;  3S3M A;  3FMQ A;  5J8C A;  2ELK A;  4G6D A;  4DNC A;  4WK8 F;  2X1C A;  4LJZ F;  4E7Z A;  1JKO C;  2N8G A;  4RB1 A;  2ZME C;  4IVN A;  4BQN A;  2M1B A;  1IDY A;  2VKV A;  1QBJ A;  4Z6Y A;  5ICF A;  3VOD A;  1O57 A;  4QPQ A;  3LL7 A;  1FIA A;  3WGH A;  3V8J A;  2G7U A;  1D5Y A;  1LFU P;  3HTA A;  1BJZ A;  3LQR A;  1CF7 A;  1JUM A;  4RS8 A;  5F1R A;  4M9Z A;  4F93 B;  1MND A;  1IXR C;  2B3W A;  3OS2 A;  2WWY A;  3NXC A;  2E1M C;  1FEX A;  3CO6 C;  1MSF C;  4G7O F;  4EVI A;  1DGR M;  5FGL A;  2HOA A;  3FXQ A;  4NQW A;  2B0L A;  3PO3 J;  1RI7 A;  2ZKZ A;  2EFN A;  1QPI A;  3RPQ A;  3BC8 A;  1N25 A;  5D8K B;  3MEX A;  3AKZ A;  2ZB9 A;  4IXA A;  1QZZ A;  3ECH A;  1F36 A;  2DJI A;  1KU9 A;  2AQF A;  1P4A A;  3EUH C;  3I64 A;  4UB8 C;  3RKX A;  3SJM A;  4V2F A;  1XTA A;  2DOE A;  4U87 A;  2JJ7 A;  4B4C A;  1YTY A;  1R7J A;  1XGO A;  4KT6 A;  1IUF A;  3PSI A;  3JRA A;  4DIQ A;  3RKY A;  3D5S C;  2NVX J;  1RR7 A;  3MZ8 A;  4I01 A;  1D0Z A;  4Y15 A;  3DEW A;  1V4R A;  2ELH A;  2O9L A;  2JTV A;  3CJN A;  4A69 C;  5C4J J;  5H20 A;  2M8G X;  4PGH A;  1X1B A;  4JP0 A;  1JGG A;  3HRM A;  5E1X A;  4K2E A;  1MMA A;  4P55 A;  4RA2 A;  2R5Y A;  1RR8 C;  2XRL A;  4F52 A;  1SD7 A;  1D0Y A;  1ETQ A;  4HLX A;  4OOI A;  4GFK A;  1UB9 A;  2HFH A;  2JMW A;  4IOA F;  4ICH A;  4LIV A;  3CMM A; 
#chains in the Genus database with same CATH homology
 3BNI A;  1WGX A;  3S17 J;  4A3B J;  3JRH A;  1QVU A;  3CMY A;  1MBK A;  2YUS A;  3GTM J;  3GTK J;  1JKQ C;  2K9N A;  3BRU A;  1ZQ3 P;  3BQZ A;  3CJD A;  2FQ4 A;  2HXO A;  2JA5 J;  2L7Z A;  1JT6 A;  4DYR A;  3BTC A;  2H8R A;  2YU9 J;  1MBJ A;  2XDN A;  2JA7 J;  1GUU A;  3BR0 A;  3PO2 J;  4MK6 A;  3HTJ A;  3TW6 A;  1MSE C;  2JN6 A;  4M3F A;  5EFY A;  2JA8 J;  1A5J A;  3A02 A;  3BG3 A;  3PM1 A;  3BG9 A;  4I76 A;  4M6V A;  4GCT A;  2E2H J;  1WCM J;  3FIW A;  2UXH A;  4C3J J;  3F0C A;  3LOC A;  2CU7 A;  5M5X J;  1HOM A;  1B8I A;  2EZK A;  4EEF G;  3ZQL A;  1P7I A;  2LK2 A;  5EG0 A;  2EQR A;  3JRB A;  3TP0 A;  4ME9 A;  2O7O A;  3D1N I;  3HOU J;  2EH3 A;  2EZL A;  4A93 J;  1XS9 A;  3G56 A;  3SFI A;  1HF0 A;  1BW6 A;  1TWH J;  4FE7 A;  1ETV A;  3CQZ J;  3S5R A;  2KT0 A;  4D5F A;  1IJW C;  1TWF J;  2G0E A;  1JTX A;  3LJL A;  1OJL A;  2NVT J;  1GV5 A;  5J1Y A;  3HOZ J;  1APL C;  3BR6 A;  2QIB A;  2M34 A;  2XGD A;  5FKO A;  2R93 J;  1E3O C;  3M4O J;  3V6G A;  1U9N A;  2E2I J;  1JUS A;  3JRF A;  2UXI A;  2Q24 A;  5C44 J;  3VP5 A;  3MKL A;  1YRN A;  3OSF A;  2EZH A;  3NAU A;  2P81 A;  2Y9Y A;  2OER A;  1IG7 A;  4IHW A;  5FKL A;  5IP7 J;  5EYR A;  4AUX A;  5DTD A;  5EDN A;  2HI3 A;  3GTL J;  5CW8 A;  1PUF B;  3RZO J;  1RET A;  5M3M J;  5JLW A;  3ZQI A;  5C4Y A;  3ANP A;  2ME6 A;  2TRT A;  2VI6 A;  2X6O A;  2R5Z A;  2O8K A;  3MN2 A;  2PMZ N;  2OI8 A;  4ABZ A;  2HYT A;  5F1J A;  4CYC B;  1ZGW A;  5EF6 A;  3PPB A;  3QPS A;  2XPU A;  4A3K J;  3LWJ A;  2CQX A;  3AQS A;  2E19 A;  3K7A J;  3HOX J;  3JRC A;  3W6V A;  3VIB A;  4W97 A;  1S7E A;  3LSR A;  3AQT A;  1XG1 A;  2ECC A;  2QKO A;  4JX4 A;  1K83 J;  2WAQ N;  2XSD C;  5FHP A;  3KKD A;  3M3Y J;  3ZOB A;  3VUQ A;  3NI7 A;  2Y9Z A;  2COB A;  4X6A J;  5FMP A;  2ZOY A;  3G1L A;  3CDL A;  1K61 A;  1FIP A;  4UUS A;  5IPA A;  4V2G A;  2YVH A;  2FBQ A;  3S2H J;  1ETY A;  1LFB A;  5AQC A;  1UMQ A;  2WV1 A;  2O7T A;  3QPL A;  1OCP A;  3KZ9 A;  3A01 B;  3MVP A;  3JR9 A;  4XRM A;  4B3A A;  1TWG J;  3BTL A;  3CRJ A;  1UHS A;  5DS9 A;  4BBR J;  3SDG A;  1NTC A;  3LNQ A;  1HDP A;  2NS7 A;  5CXI A;  4JL3 A;  3HEF A;  3DCF A;  3Q0W A;  1I3Q J;  3S15 J;  2GFN A;  2DA7 A;  2PBX A;  2NP3 A;  1ZR2 A;  1RPW A;  2XPW A;  3G1O A;  3RH2 A;  3BR2 A;  1ZTR A;  4FTH A;  2YVE A;  4MXM A;  1MBG A;  2X48 A;  1UI5 A;  5F0C A;  2WGB A;  3ON2 A;  5EGO B;  1EF4 A;  1RES A;  3IH4 A;  2MGQ A;  5FJ8 J;  3ZQC A;  3RZD J;  3NAR A;  3S1N J;  3GTJ J;  3GTP J;  2ZCX A;  3F1B A;  4M3G A;  3JRD A;  2CUE A;  5EEA A;  5J1R A;  4DZJ A;  2FJ1 A;  3V78 A;  4D7N A;  2REK A;  3ANG A;  1QRY A;  3S2D J;  3H3V K;  1H89 C;  1UG2 A;  5J3L A;  2F07 A;  1LE8 A;  2LR8 A;  1AHD P;  2OPT A;  1BW5 A;  2DMT A;  3RKQ A;  3CCY A;  5GP9 A;  1AU7 A;  1TWC J;  2DMU A;  4B1R A;  5C4X J;  3HIM A;  2XGC A;  3OSG A;  1JT0 A;  1BL0 A;  4XRS A;  2G7S A;  3HTI A;  2YS9 A;  3B6C A;  3QBM A;  1IC8 A;  4M3D A;  3Q0U A;  1W0U A;  2M9H A;  2ME0 A;  4PXI A;  3Q0V A;  4DW6 A;  2LY9 A;  2Y0S N;  2HDD A;  1SAN A;  2VKE A;  4XRS G;  4BY7 J;  2LFB A;  5M5W J;  2ZCM A;  1HDD C;  2PZ9 A;  5FLV A;  3HB9 A;  2WUI A;  4J19 A;  2K40 A;  2EBI A;  4A3E J;  2ID3 A;  1A6I A;  4Y7N J;  4XK4 A;  5K7F A;  2E1O A;  3S1R J;  5EGO A;  1GDT A;  4IHY A;  2HKU A;  4IHV A;  2QF7 A;  3MNL A;  3S14 J;  3IUV A;  3NNR A;  4IEJ A;  2DJN A;  1Y1V J;  3HGG A;  4UUT A;  5JLX A;  1NK3 P;  1MNM C;  3JRI A;  3HE0 A;  2L7M P;  1CQT A;  3KNW A;  1B72 B;  2G7L A;  1ETK A;  2K9Q A;  4CGR A;  3FIS A;  4KWA A;  4GFL A;  5K7Z A;  5IP6 A;  1QVT A;  5IOY A;  2VUM J;  4FCY A;  1XC5 A;  3GEU A;  5K7H A;  4A3M J;  4QSH A;  1TC3 C;  2HOT A;  2DG8 A;  2JWT A;  2D5V A;  1IDZ A;  4GCK A;  3ZQH A;  2MSY A;  5K58 A;  1Z77 A;  1ETX A;  2DA4 A;  1FJL A;  1MBE A;  3GTG J;  3VW0 A;  4DZP A;  1NK2 P;  2HXI A;  3OOU A;  2TCT A;  2UXP A;  3BTJ A;  3QKX A;  5F08 A;  3A03 A;  2B63 J;  4MO7 A;  3BT9 A;  3HOW J;  5FLM J;  1MBF A;  2L7F P;  4A3L J;  2JK3 A;  4YZE A;  1ORK A;  2VPR A;  2RHA A;  5IP9 J;  2DMN A;  2IU5 A;  2DA3 A;  1B72 A;  3KKC A;  1G2H A;  2MG4 A;  1Y1W J;  9ANT A;  1I50 J;  3FRQ A;  1ENH A;  2R5Y B;  2DMQ A;  3BJB A;  3EGQ A;  2DG7 A;  1AKH B;  2CRG A;  4BBS J;  4NN1 A;  1PUF A;  2GM4 A;  3IV5 A;  2KDZ A;  3O8G A;  4XID A;  2E2J J;  5F0H A;  1WH7 A;  1ETO A;  3ZQG A;  4AF5 A;  3HGY A;  1ZR4 A;  2H1K A;  2R92 J;  4S0H B;  2GEN A;  4CYC A;  3S1M J;  2MW8 A;  2ZOZ A;  3BHQ A;  3S16 J;  2OF7 A;  3HOY J;  2Y2Z A;  3ON4 A;  1WH5 A;  3H0G J;  3WHB A;  2ECB A;  4A3F J;  2R7Z J;  4A3C J;  4MLO A;  3QQA A;  4A3D J;  1GT0 C;  2NOG A;  2X9D A;  3VW2 A;  1IGN A;  1H88 C;  2AO9 A;  3JRE A;  1JKP C;  1UI6 A;  1VF9 A;  2L9R A;  2CQQ A;  2NX4 A;  5IYD J;  2M2E A;  4NEL A;  4L62 A;  3GTO J;  5E3L A;  5F27 A;  1DU6 A;  3E7Q A;  3NPI A;  1RKT A;  4QTR A;  1JTY A;  4AC6 A;  2QTQ A;  3G1M A;  2XPV A;  2Y30 A;  2LLK A;  2I10 A;  5GPA A;  1T56 A;  3FK7 A;  5IOZ A;  4JNN A;  3O60 A;  4ACI A;  1BA5 A;  3L1P A;  1U8B A;  5HBU A;  5D19 A;  1X2N A;  2FX0 A;  5EG0 B;  5J1U A;  1IV6 A;  2W53 A;  3HOV J;  4NDL A;  1TWA J;  3A01 A;  5E3O A;  2CUF A;  1WPK A;  3TP3 A;  3JSJ A;  3ZQF A;  2DA2 A;  2XB5 A;  3LSJ A;  4MFD A;  1X58 A;  1W0T A;  5D18 A;  3LSP A;  3O8H A;  3VVX A;  3VVZ A;  1OFC X;  5FKN A;  4BKX A;  3Q3S A;  3FK6 A;  2K9S A;  4JKZ A;  5C3E J;  1H8A C;  2UXO A;  4MFE A;  3E7L A;  3B81 A;  1OCT C;  2AHQ A;  3IH2 A;  1FTT A;  2EZI A;  1YRN B;  4FE4 A;  1X2M A;  3LSG A;  5M5Y J;  1SGM A;  2XGE A;  3BCG A;  2G7G A;  3G7R A;  2ZCN A;  2RAE A;  2HOS A;  3I4M J;  2LD5 A;  1FTZ A;  2GBY A;  1VFC A;  2M0C A;  5EZH A;  4C2M J;  1Z0X A;  3BR3 A;  2RAS A;  1WI3 A;  3RD3 A;  2R0Q C;  1HCR A;  5H9T A;  2IEK A;  4A3I J;  2ID6 A;  2R5Z B;  5M3F J;  4HKU A;  5GPC A;  5BNG A;  3LHQ A;  4M3E A;  1I6H J;  4LOC A;  2IAI A;  2QCO A;  3HBL A;  1GV2 A;  1MH4 A;  4D7M A;  4RDU A;  1T33 A;  3GZI A;  1O4X A;  1MBH A;  4BXX J;  2JA6 J;  4JYK A;  4UDS A;  4AC0 A;  5E3M A;  3S1Q J;  3PAS A;  3BTI A;  1P7J A;  3HDD A;  2W48 A;  4FIS A;  3FKI J;  5IYC J;  4QIW N;  4I6Z A;  1R9T J;  1IRZ A;  3BR5 A;  2DTZ A;  2IBD A;  2LKX A;  3HKZ N;  4IHX A;  4MIM A;  5EZG A;  5E3N A;  1ZKG A;  1VND A;  4JX6 A;  2DA6 A;  1GVD A;  3K2A A;  2GLO A;  4UUS B;  3VPR A;  2ELK A;  3I4N J;  4BY1 J;  5CXG A;  3OIO A;  3WHC A;  2N8G A;  3BQY A;  1JKO C;  4Y52 J;  3COL A;  2NVQ J;  3TW7 A;  5DAJ A;  1IDY A;  2VKV A;  2DA5 A;  2L0K A;  1FIA A;  4W1U A;  3DPJ A;  1D5Y A;  3HM5 A;  4D5C A;  1LFU P;  3HTA A;  5HAW A;  2LVS A;  1BJZ A;  3IH3 A;  1JUM A;  2XB0 X;  1U9O A;  2QWT A;  3HTH A;  2DA1 A;  5FKM A;  3B6A A;  2FD5 A;  5IYB J;  2D6Y A;  3NXC A;  3NRG A;  5F0F A;  1FEX A;  1JJ8 C;  3VOK A;  2LTP A;  2DMP A;  1MSF C;  5FGL A;  2CJJ A;  2HOA A;  3T6N A;  3C2B A;  2NP5 A;  3GBG A;  4GFB A;  3PO3 J;  4A3G J;  4C3H J;  4GCL A;  1QPI A;  3VW1 A;  3BR1 A;  4L5E A;  5HOD A;  2ZB9 A;  5FKK A;  1Q1V A;  2QOP A;  1F36 A;  1JJ6 C;  3CWR A;  3SJM A;  3VVY A;  4A3J J;  4V2F A;  1ITY A;  1RKW A;  4AYB N;  2V57 A;  2GUH A;  2JJ7 A;  4B4C A;  1IUF A;  3C07 A;  2DN0 A;  3JRA A;  4X1E A;  3JRG A;  2NVX J;  1DU0 A;  1RR7 A;  2Y31 A;  5F04 A;  1JKR C;  4C3I J;  2LP0 A;  3EUP A;  1LE8 B;  1F43 A;  3DEW A;  5HSZ A;  2O9L A;  2NVY J;  3P9T A;  4A69 C;  1VI0 A;  1SFO J;  3VOX A;  4DYQ A;  5C4J J;  2UXU A;  2M8G X;  4JP0 A;  4XIC A;  3TED A;  2HYJ A;  1HLV A;  1JGG A;  2NS8 A;  5D1R A;  2R5Y A;  3BG5 A;  2XRL A;  4M3B A;  3RQI A;  4JX5 A;  1B8I B;  1MH3 A;  4RBO A;  1ETW A;  4DYC A;  4GFK A;  1ETQ A;  4HNV A;  3UKG A;  1AKH A;  3GTQ J;  2JMW A;  4ICH A;  1U78 A;  1POG A;  1JUP A;  4G12 A;  2G3B A;  1ZK8 A;  2WB1 N;  2HQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...