3B6CA

Crystal structure of the streptomyces coelicolor tetr family protein actr in complex with (s)-dnpa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
214
structure length
202
Chain Sequence
MAPLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEVEVPEPEPGRWAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDELAAYGGDLLSTFVTAEALEQSSRVFADQLHGYLKSLPATSFPNLVHLAGPITSLDSDRRFELGLEIIIAGLLAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Streptomyces coelicolor TetR-like protein ActR alone and in complex with actinorhodin or the actinorhodin biosynthetic precursor (S)-DNPA.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords ActII protein
total genus 79
structure length 202
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3b6cA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3b6cA02
2K9SA 3Q3SA 2X9DA 4G12A 2WV1A 2NOGA 3MVPA 5JLXA 4CGRA 3ZQFA 4DYRA 2QWTA 2CU7A 2QIBA 3LOCA 1X58A 1POGA 1QPIA 4MIMA 4JX4A 2DMNA 3GTPJ 2E1OA 3QQAA 3LNQA 3I4NJ 3CDLA 3PO3J 4PXIA 3HKZN 1QVUA 2NP5A 2D5VA 3HOUJ 5E3LA 4UUSA 1RKTA 4IHWA 3BTCA 1WGXA 2DA7A 1FEXA 4XRSG 1TWGJ 4A3DJ 1MBFA 3VOKA 3JRGA 3S1MJ 4L5EA 2UXUA 3KKCA 1ORKA 3IV5A 3QBMA 1BL0A 3NPIA 4UUTA 4GCTA 3LSPA 2R0QC 1A5JA 4M3BA 1NK2P 2Y31A 1W0UA 1SGMA 3O60A 5EF6A 1I6HJ 3VW1A 1GT0C 2HOAA 2R93J 1ETWA 1JUPA 4NDLA 4YZEA 3UKGA 3LSRA 4L62A 2JN6A 3FRQA 2L0KA 2KDZA 1W0TA 2DMTA 3W6VA 1X2MA 4MO7A 1D5YA 4AF5A 3O8HA 1H89C 3JRHA 2TRTA 4A69C 2R5YA 1UHSA 2LK2A 5IYCJ 3HTIA 5EDNA 2O7TA 5FLMJ 4FCYA 4ACIA 1IG7A 5FJ8J 1MBKA 1FTZA 4B4CA 1BJZA 3BR0A 5FKMA 3ZQGA 1I50J 2DMUA 4C3IJ 1Q1VA 5IP6A 1R9TJ 3V6GA 3M3YJ 2CRGA 3WHCA 3VP5A 1WH7A 1JT0A 1MSFC 2AO9A 2X48A 4JX5A 2DG8A 1TWAJ 3F0CA 4I76A 1HOMA 3PO2J 2R5ZB 5IP7J 5K7FA 1RKWA 3VUQA 2W53A 3RQIA 5DAJA 2FJ1A 3KZ9A 1FTTA 3I4MJ 1F43A 3M4OJ 1PUFB 3LHQA 2V57A 4GFKA 5BNGA 1XG1A 3S1NJ 1QRYA 2XGDA 3OIOA 3VVXA 1JUMA 1RPWA 3PASA 2JMWA 3SDGA 1PUFA 3LSJA 4DZPA 2QCOA 2X6OA 2RHAA 1OFCX 2M34A 2LTPA 1MBEA 4IHYA 3GEUA 1MBHA 1MBJA 2DA5A 1JJ8C 1ZK8A 5EYRA 5HODA 3CJDA 1WH5A 1DU6A 2NVQJ 4GFBA 2OF7A 1JKQC 2G7LA 1JTYA 1RESA 5C44J 1JTXA 2G7SA 2QF7A 1MSEC 1HCRA 2DA6A 2ZCNA 5EEAA 4Y52J 3HEFA 3HM5A 3BQYA 1ZR2A 3TEDA 4J19A 5EZGA 2NS7A 1VI0A 2ECBA 2EQRA 3HBLA 1G2HA 2PBXA 2MGQA 3ZQHA 2AHQA 2FQ4A 2D6YA 4JKZA 2L7MP 5H9TA 3COLA 4EEFG 3FKIJ 1JKOC 2ELKA 5E3MA 3VVYA 3GTJJ 1TC3C 2XB5A 4QTRA 3JRDA 3JRIA 1ZQ3P 1U9OA 5EFYA 2ZCXA 3G7RA 2DJNA 4GFLA 3ZQIA 4BKXA 3RZOJ 4JX6A 3BR5A 2CUEA 1LFBA 3RD3A 4V2GA 2GLOA 1LFUP 2XSDC 2E2IJ 5FGLA 2HXOA 1RETA 3HIMA 1JUSA 3NXCA 2GUHA 3S2HJ 3BTLA 4UDSA 3DCFA 2O9LA 1WI3A 1DU0A 3IH4A 1T56A 2PZ9A 3JSJA 3FISA 2OI8A 3H0GJ 1SFOJ 2M9HA 3E7LA 3FK7A 2H8RA 2FBQA 2ZOZA 5HAWA 2KT0A 4DW6A 1AHDP 2HOTA 2WUIA 1GDTA 2JA8J 5CW8A 1TWHJ 4HKUA 1IV6A 2XPUA 2LLKA 5M5WJ 2HXIA 3HE0A 5CXIA 3S5RA 3BQZA 2DTZA 4GCLA 4M3EA 4B3AA 3TW6A 2K9QA 2OERA 2QKOA 3ON2A 4IHXA 4ME9A 5D1RA 3VW0A 3OOUA 1Z77A 3BR6A 1MNMC 2DG7A 3S1QJ 5J1RA 5F08A 2UXOA 1H88C 1APLC 2FX0A 2WB1N 3BR2A 5K7HA 1OJLA 4A3FJ 1U8BA 2LY9A 5IOYA 2DN0A 3ANGA 4BXXJ 2Y0SN 4D7MA 2ID6A 3NRGA 1X2NA 2L7FP 2O8KA 4IHVA 2PMZN 5D18A 2JJ7A 1S7EA 3HTJA 3T6NA 2XDNA 2GFNA 3BJBA 2EZHA 3QPLA 4D5CA 2ECCA 3B81A 4LOCA 3HOVJ 3S2DJ 1BW5A 1EF4A 3IUVA 4KWAA 1OCTC 1IC8A 1HLVA 1U78A 1ZR4A 3KNWA 2W48A 2EH3A 5J1UA 1BA5A 1YRNA 3G56A 4A3CJ 3BHQA 2XRLA 1FIAA 2VPRA 3HOYJ 4RBOA 2R92J 3EUPA 4RDUA 2HYJA 1IDYA 1H8AC 1YRNB 4FE4A 1Z0XA 1TWFJ 3VW2A 2COBA 1VFCA 2JA5J 2DA4A 2REKA 2M8GX 3WHBA 1I3QJ 3QPSA 2G3BA 1F36A 2ZB9A 4AYBN 2CQXA 4FISA 1U9NA 5IOZA 3BNIA 1ETYA 3O8GA 2EZLA 4A3IJ 5F04A 4FTHA 2R5ZA 1BW6A 5M3MJ 5J3LA 3BTJA 4C3JJ 4D5FA 5EG0A 3S14J 4A93J 3JRAA 5D19A 2IEKA 5C4XJ 4W1UA 4A3MJ 5EG0B 2UXPA 2L7ZA 3ON4A 5FKKA 1MH3A 5JLWA 4BY1J 5FKOA 2K40A 2HDDA 5F0FA 1P7IA 3BT9A 3Q0UA 2B63J 3GZIA 3B6AA 2M0CA 3GTQJ 2N8GA 2LFBA 5FHPA 3S1RJ 4MK6A 4XRSA 1ENHA 3OSGA 4DZJA 2VKVA 2NVXJ 4X6AJ 2LR8A 2IAIA 3AQTA 1E3OC 2HI3A 3SJMA 1FJLA 1IUFA 2QTQA 4MLOA 1GUUA 2L9RA 5GPAA 4D7NA 1ZGWA 2YVEA 3HB9A 3A01B 2HQ5A 3LSGA 4HNVA 3D1NI 2JWTA 3RKQA 2RAEA 3HTHA 4CYCA 1AKHA 3PM1A 2YU9J 2MW8A 1B8IB 1T33A 1O4XA 3PPBA 1ZTRA 2Y2ZA 3JRFA 3JRCA 4CYCB 1B72A 1A6IA 3NAUA 2E19A 4XK4A 1B8IA 2DMQA 4QIWN 4W97A 4B1RA 1HF0A 2WAQN 3A03A 1QVTA 2XPVA 2Y9YA 3S15J 3Q0WA 1OCPA 2WGBA 3JREA 5E3OA 1GV5A 3S16J 1HDPA 2LVSA 5IYBJ 1Y1WJ 2ZCMA 3P9TA 2FD5A 2GBYA 2TCTA 5FKLA 3CCYA 3ANPA 1RR7A 3TP0A 5F27A 2R5YB 1WCMJ 3MN2A 2LD5A 3HGGA 2NS8A 9ANTA 2CJJA 2CQQA 3BCGA 3IH2A 2XGCA 4JP0A 3CMYA 3NI7A 3ZOBA 2DA3A 4A3LJ 5IP9J 3A01A 2NX4A 3G1MA 3C07A 3QKXA 4A3EJ 3CRJA 3E7QA 1JJ6C 1AU7A 3CQZJ 4M3DA 3GTMJ 4IEJA 5K58A 2F07A 2XB0X 1K61A 2HKUA 5HSZA 3G1OA 4NELA 5GPCA 3S17J 5FLVA 1UG2A 2VKEA 3BTIA 1JGGA 1ITYA 1UI6A 3G1LA 2NVTJ 5C4JJ 2VI6A 3OSFA 1JKRC 2P81A 1FIPA 1IRZA 3GBGA 2NP3A 4ICHA 2ID3A 3GTGJ 4C2MJ 3BG3A 3F1BA 4AUXA 2GENA 5F1JA 1TWCJ 5C4YA 2MG4A 3GTLJ 3HTAA 2YS9A 2XGEA 4FE7A 5DTDA 2HYTA 4QSHA 3LWJA 2YUSA 2Y9ZA 5F0HA 2I10A 2UXIA 1IJWC 4Y7NJ 3BRUA 2LP0A 3BR3A 5E3NA 3JRBA 1XS9A 3FK6A 5GP9A 2JA6J 1IDZA 2O7OA 1ETXA 1XC5A 3JR9A 4MXMA 3HOZJ 3HGYA 3BG9A 1VNDA 2IU5A 2M2EA 3Q0VA 5M3FJ 2EBIA 4A3BJ 1MH4A 2XPWA 3IH3A 2QOPA 4MFDA 4JYKA 2JK3A 2E2HJ 3BR1A 3DPJA 5F0CA 2HOSA 3DEWA 3RZDJ 2K9NA 2R7ZJ 4BBRJ 1LE8B 3TP3A 3HDDA 3ZQCA 1ETKA 4M6VA 4DYQA 2Q24A 3C2BA 1K83J 5EZHA 1LE8A 3LJLA 3MKLA 2ME0A 4XIDA 1Y1VJ 1P7JA 2EZIA 2NVYJ 3FIWA 2G7GA 3NNRA 5AQCA 1ZKGA 2E2JJ 1JT6A 2ME6A 5FMPA 3V78A 3NARA 1UMQA 1VF9A 1MBGA 1ETQA 4M3GA 4V2FA 4JNNA 4XICA 3K7AJ 2LKXA 5EGOA 2VUMJ 3RH2A 4A3KJ 5DS9A 1CQTA 5K7ZA 4DYCA 1NK3P 4AC6A 2EZKA 1B72B 2DMPA 2CUFA 2RASA 3L1PA 5EGOB 1GV2A 3HOXJ 5FKNA 3CWRA 2G0EA 4BY7J 2H1KA 3AQSA 2UXHA 1UI5A 3K2AA 4X1EA 3HOWJ 4A3GJ 4ABZA 3GTOJ 3GTKJ 3EGQA 5IYDJ 1SANA 4C3HJ 1IGNA 1ETOA 4S0HB 3ZQLA 4UUSB 3A02A 5M5XJ 4XRMA 3B6CA 4BBSJ 3SFIA 5M5YJ 4NN1A 2GM4A 4M3FA 4GCKA 2IBDA 5CXGA 4A3JJ 4JL3A 4MFEA 1JKPC 3H3VK 2YVHA 2Y30A 3VIBA 3KKDA 5J1YA 1ETVA 4I6ZA 2MSYA 5HBUA 1WPKA 4AC0A 3BG5A 1HDDC 1AKHB 5C3EJ 3VVZA 1NTCA 2DA2A 3MNLA 2JA7J 1GVDA 2DA1A 2OPTA 3VOXA 2ZOYA 5IPAA 3VPRA 3TW7A
chains in the Genus database with same CATH superfamily
2K9SA 2YX4A 3PUBA 4D9JA 4RGUA 3ZQFA 5K1YA 2Z2SB 2BGCA 3KPHA 2WV0A 1IN6A 3LOCA 1POGA 4PJJA 2E1MC 3S3NA 2F5DA 3MWMA 4Q48A 3FMRA 4P9UA 2DMNA 2VJ5A 2V1NA 3ZMDA 3CDLA 3BY6A 4IXAA 3T8RA 1QVUA 1R71A 2D5VA 1IF1A 4KN7X 3HXLA 3H3ZA 3LSKA 4ZZLA 3QU6A 4XL9A 2NNNA 2BXZA 5JR3A 1FEXA 3BZ6A 2W25A 3HSFA 3CCVI 2K5CA 2UXUA 3G4SI 2HQNA 2K7LA 5TRDA 4WXHA 2X85A 5BS6A 2XGXA 2IA1A 1OQYA 1B4AA 1GT0C 2CO5A 3RJPA 2FA5A 4L62A 2JN6A 2L0KA 3OYCA 3W6VA 1J2XA 2L9NA 1DQUA 1IXCA 5B5EC 2MC4A 3ISPA 4AF5A 2OTLI 3M07A 2DODA 4NHJA 5B66C 3AKZA 4FCYA 2FMLA 2L2OA 5LRSA 3WTVC 4C30A 2NXNB 1RC9A 1ULYA 2M7BA 1FTZA 3K6GA 3K4JA 2EILH 1MIJA 1BJZA 3BR0A 4UNOA 2P0WA 3DU6A 1YX5A 1T6SA 2BHZA 3LA3A 2DMUA 4PUSA 4UUVA 2JUCA 5IP6A 4PSXA 3K1MA 1R1VA 1EH7A 4X0GA 1VQMI 3QP6A 4ZTFA 3KLOA 2X48A 4JX5A 2A05A 2DG8A 4RM3A 3F0CA 3OIQA 3S8PA 3PO2J 2R5ZB 2XAGA 3E5QA 1STZA 3DLLF 3CJRB 1DPUA 1BC8C 4B43A 5FRMA 1W1WE 3K4LA 3KZ9A 2OD5A 3I4MJ 2ZMEC 3C2GA 5DUIA 2F5CA 3LHQA 3MD2A 2R7XA 4BJ5C 4C9YA 5D6EA 2V79A 1WJCA 1QRYA 1Z6RA 2XGDA 2EFNA 4XLNF 3EUHA 1ODDA 2Z16A 4AIHA 2M5WA 3SDGA 4AWXB 3PASA 2XV4S 1CF7A 3F9KA 2QCOA 2A5WA 2M34A 2W1OA 2XHKA 4KIFA 2BY3A 1V5FA 4Q47A 4RB3C 2HTJA 2DA5A 4M72A 3HKZA 5EYRA 3CJDA 1WH5A 3CJQB 2RQPA 4H0EA 2IP2A 4GFBA 4U9NA 2G7LA 6PAXA 2W85A 3WTUC 4LIVA 4ZZDA 1HCRA 1TL8A 4F3QA 4ENKA 1JHFA 4J19A 2ECBA 1B1BA 3BZKA 2M4GA 5A2QZ 2R7UA 1MNDA 3VYSB 3CDIA 2AHQA 4BE0A 4NC7A 1G4DA 3L2RA 1SFKA 1S5LC 5H9TA 4XORA 4IQJA 3A1YA 3COLA 1O3SA 1ZN2A 1YO5C 4BNCA 3N05A 2ELKA 1EH8A 2IGNA 3VVYA 3EQLF 4CO8A 3OYGA 3GTJJ 1F9NA 3OWTA 2X51A 2XB5A 1IZ1A 1F1ZA 3DPLC 3JRIA 4A0YA 2M1BA 5DYMA 3JTHA 3LWFA 2QLZA 4KIBA 1NH3A 3A4CA 2QSGX 2DJNA 4RGSA 3ZQIA 3WGGA 2Z99A 3RZOJ 4JX6A 3BR5A 1LFBA 2DK5A 4G6DA 4V2GA 4M9XA 4LB6B 2HXOA 2QGUA 4HNTA 2EV6A 1YJ9I 4UDSA 2O9LA 3CCLI 1DU0A 3FX3A 2CV1A 3H0GJ 4DBRA 2M9HA 3E7LA 2H8RA 3TBIA 1Y8QB 1AHDP 2WUIA 2DFFA 2LYCA 1ZLKA 1TWHJ 4EJOA 2L01A 2X4HA 3H36A 2XPUA 5M5WJ 2HXIA 3ABKH 2M7AA 3LQQA 2K9QA 2ZY9A 1P4XA 3WTYC 4ME9A 3VW0A 3BR6A 4IO9F 1S29A 1IXSB 3T1BA 3CDHA 5EEGA 3GFLA 2QZ8A 1H88C 2WB1N 5K7HA 3FXQA 3K1NA 4PJLA 1V5GA 1LVKA 2Y0SN 3VEPA 2ID6A 3W2WA 1X2NA 4Y33A 5LHGA 1BI3A 4E7ZA 2QBYA 2KLOA 5LHHA 4PGHA 1BIBA 1UJ8A 2G9WA 2PG4A 2HNHA 4XNFA 1LPQA 3B81A 1EF4A 3IUVA 1QZYA 4BJ6C 1HLVA 1HW5A 2UV1A 1U78A 3WU1B 3HSRA 5J1UA 3NQOA 2GIZA 3BHQA 4HF1A 2D1VA 1FIAA 2VPRA 1MJAA 3MCZA 1RUNA 3BOQA 5HNHA 1IDYA 4Z6YA 1YRNB 1JE8A 4FE4A 1Z0XA 1Z3YA 4EJVA 1VFCA 3RI4A 4IF4A 3IKVA 4ZDPA 1MDMB 2CW0F 3LL7A 4B44A 2KISA 3RIRA 4R79A 1F36A 4IOCF 4KIGA 4Z2YA 5D4RA 4A3IJ 4A0XA 1GXQA 1ZELA 5LRRA 3G3ZA 3G6EI 1Y56A 2ACJA 5J3LA 4C3JJ 3P9CA 4D5FA 2MC3A 3UNGC 3S14J 3J80Z 3QODA 1S9HA 2MLKA 4UB8C 5C4XJ 4W1UA 2KRHA 1PJRA 2UXPA 1UHMA 4Y4RA 4HOBA 4OINF 5FKKA 4BY1J 2HWVA 4DGWB 2BVLA 2HDDA 2QBYB 2E60A 1P7IA 3AG4H 4ZYHA 2PJRB 2M0CA 1K4SA 2N8GA 3ULQB 2JVHA 5CVJA 3S1RJ 1O3TA 4LLGF 4KN4X 3R0AA 4UV9A 1ENHA 4IKFA 2HZDA 4X6AJ 2XAFA 2F5FA 3C18A 2L9SA 3AQTA 3BZCA 2DYRH 2HI3A 3T0YA 2QTQA 2EJRA 1R5GA 3BCBA 2IRFG 3VYUB 5GPAA 4ANJA 2EFWA 3A01B 3LSGA 1BBYA 4CYCA 3FXUA 1P92A 1O4XA 1KQ9A 2DT7B 1ZTRA 3IUOA 4R1HA 2DOFA 3JRCA 4U9LA 1A6IA 3NAUA 2GXGA 1B8IA 4BQQA 2UWMA 2FNPA 3ZN0A 4YRVA 2WAQN 5LLQA 2BYVE 2XPVA 1UFMA 2Y9YA 4G7ZF 3JREA 1UCRA 5E8GA 3S16J 2ZC2A 2GBYA 2XSJC 1SD4A 2VT2A 3FBNB 2VQCA 3QYBA 5BQTA 2M3AA 1XX5A 1YG2A 2JA2A 2JPCA 2D45A 9ANTA 3BCGA 3ESWB 4FETA 1R5ID 2OQRA 4JP0A 2JQ7A 3R60A 3C07A 2B7EA 1ONVA 3CUQC 4A3EJ 2OZUA 1OLTA 2I5UA 4EV0A 1JJ6C 3CQZJ 1HKTA 4M3DA 1X3UA 4P1WA 2XB0X 1K61A 2E1NA 1XGMA 2GQQA 3LQRA 3S3OA 2VKEA 2XF5A 1EKEA 2FOWA 2EV5A 4PSWA 1D5VA 1UI6A 1WJAA 2ZXWH 2HQAA 1JKRC 2P81A 1FP1D 1FIPA 1R58A 1RZ4A 5LGNA 4CHUA 3FBIB 1ZGJA 2FNAA 3B02A 1D1AA 4Y13A 4ICHA 3F1BA 1YIOA 3OYHA 5F1JA 1TWCJ 3HC7A 5C4YA 5EJCA 2YS9A 4FE7A 4CUGA 2HYTA 5HS9A 2X6XA 4JOMA 2PEXA 2CGPA 1IJWC 5BMZA 1XS9A 2HGCA 4ESBA 2JA6J 1IDZA 3EDPA 2O7OA 3J7AO 5D5XB 3HGYA 3BG9A 3KYLA 4XM3A 3ZQ7A 2E71A 2Y48A 3LAPA 3HL2A 1GLNA 1YFHA 2LH9A 4A3BJ 2XPWA 3DBRB 4MFDA 2W7NA 3DPJA 4G6TB 3CP2A 3KZYA 1I39A 3RKWA 3SZGA 2EIJH 4RB2C 3FHZA 2ZKZA 1WSUA 2AS5F 5ILVA 4XQFA 1ETKA 1R5HA 3C2BA 1FOYA 3AAFA 3J7ZI 3KZZA 3FMSA 5IT9K 3KETA 1G3WA 4OOIA 2G7GA 2EZIA 3NNRA 1OYIA 5AQCA 1JT6A 2ME6A 4DNCA 3NARA 3H5RA 4E7KA 2RDPA 3GUDA 3SDBA 2PBIA 2VQLA 4A3KJ 1NK3P 5DCFA 4OMYA 4EJUA 2CV2A 4KUMA 3NS4A 1GV2A 4HF0A 3CMMA 4PDKA 5E20A 4NQWA 3HUGB 4BY7J 2H1KA 4UY8I 2VBXA 3H5AA 5DEQA 4A3GJ 4ABZA 1P2FA 1B6AA 2EIKH 4LG3A 3F22A 2Q0OA 2FUG2 2PJPA 2BY0A 4QWQA 4GCVA 1PDNC 4BBSJ 5M5YJ 1IW7F 1R6RA 4N9HA 1UAAA 4NN1A 5B3SH 2YX7A 2VKDA 4GCKA 2IBDA 3LA2A 2ESHA 4E7JA 5CXGA 1D0YA 2ISYA 4WF2A 2DQLA 1L0OC 2FMYA 4MFEA 1JKPC 4HLYA 3SZPA 3H3VK 4G9YA 2Y30A 3VIBA 1UZCA 3OR1C 4ASNA 3KKDA 5HBUA 2MSYA 1WPKA 2XKOA 2P4WA 4AC0A 2DXIA 2Z9OA 3BG5A 4CCNA 4EQQA 3ZMZA 1N25A 5HLIA 4BDZA 4LB5A 3CCQI 1NTCA 1E17A 2GXBA 2QWWA 1GVDA 2ZBKA 1QNTA 2DA1A 3F23A 3VOXA 4KNYA 1FPQA 1XDSA 2W24A 2NRAC 3Q3SA 2X9DA 3GO5A 4G12A 4AU7A 1YJNI 1M1EB 2V9KA 2NOGA 3FKJA 4S05A 4CGRA 1VTNC 2MYSA 5CKTA 2XROA 3DBLB 3OOPA 2VXDA 4L18B 1X4PA 2EA2A 2JZYA 3I58A 2K4JA 4PK4A 3WODF 4CDGA 4BQOA 1YHQI 1YQAA 5CVIA 1ZH5A 2E1OA 3LNQA 3DKYA 4PFPA 1IUYA 4PXIA 3HG9A 2NP5A 3PSIA 2DDBA 4YFXF 4OD5A 2KIMA 3F8CA 1RKTA 1TQMA 4M71A 4A2UA 3ONQA 1MJBA 4CCKA 4XRSG 3B73A 2XASA 3GF2A 3HRMA 3F72A 4L0ZB 1U3EM 1BL0A 4UUTA 1YS7A 2CG4A 2LDUA 3PL8A 3VDXA 1NK2P 1GHCA 1ERDA 2UXXA 3KP4A 2Y31A 4RAYA 3O60A 5EF6A 3E0JB 3V42A 2Q8KA 2HOAA 2R93J 1ETWA 1SD5A 2X1EA 3FRQA 5FD5A 1R4NB 2WAEA 2BZTA 4XKCA 3O8HA 1HSJA 3TMOA 2A61A 2ZXIA 4ZDLA 5JVGF 5DCMA 2RN7A 1Y8RB 3HTIA 3WG7H 2O7TA 4QPQA 3GFJA 1G8XA 4XLHA 2P5KA 4E7LA 4ENJA 3U2RA 3FXJA 3MZYA 2Y0SA 4II3A 1U2WA 3ZRGA 1I50J 2C6YA 3AG1H 3MZ8A 3M3YJ 3WHCA 4N4NB 3VP5A 1WH7A 1MSFC 2AO9A 2O0YA 1TWAJ 1T8IA 2K3PA 1DP3A 2V4JC 3GLXA 1HOMA 3RKYA 3HHHA 4OIQF 5K7FA 5D4SA 4NQWB 2W53A 2DT5A 5DAJA 1K78A 1HSTA 4ZH4F 1V3FA 4XBFA 1JI8A 1F43A 2A6EF 2R7WA 2BXYA 3TOBA 1R23A 4ZYAA 2MD0A 5IY5H 1D0ZA 4MHGA 5L3CA 1OFCX 1T2KA 2VQGA 2XC7A 2R7VA 1CF7B 1MMNA 3O2PE 5GAHJ 1S3JA 3GEUA 1MBHA 1SVOA 1HQCA 1K79A 3W6KB 3OS0A 2VOPA 4BHCA 1ZK8A 5HODA 1JJ8C 4JBAA 3CO6C 5F64A 1BI1A 1OMIA 1J5YA 2V9PA 1XTAA 1JKQC 4LK0F 4HEA2 4ZC3A 2EB7A 2G7SA 2HOEA 1X1BA 5E1WA 3E97A 3DWLE 1A35A 2HVSA 4KMFA 2WY7Q 4KITB 2OZ6A 2NS7A 2XRNA 2V6CA 4XOPA 1G2HA 3DLAA 3Q9SA 2MGQA 1OCOH 3ZQHA 2YR2A 5D5UB 3GFMA 2FQ4A 1ZRFA 2XAHA 4XLAA 2D6YA 1IRGA 3ML6A 5DD4A 3W2VA 2LBFB 2K4BA 4R8HA 4WK8F 3GXOA 3J80K 3LSIA 3CMEI 4BYYA 4F93B 4XKVA 4EJTA 2QQBA 1R7JA 3L2UA 2A5YB 2K3FA 4A5NA 4DQ2A 4CZCA 3PIOF 1OR7C 3HHGA 2K9LA 5J6XA 3FXOA 2HYGD 3F6OA 4BKXA 1LFUP 2XSDC 3M8EA 1QGPA 5FGLA 3TOAA 5TJJA 4NBQA 5CYVA 2GUHA 1I5ZA 3DCFA 1WI3A 3KP7A 3HTSB 4RAGA 3IH4A 1YOVB 4KDPA 3JSJA 3FISA 2OI8A 4LITA 3TO6A 3WTSC 1SFOJ 3F3XA 2FBQA 3W2AA 2ZOZA 5HAWA 1EV7A 2KT0A 4YFNF 1XSVA 2PN6A 5DDGA 2JA8J 5CW8A 2VLAA 2BEOA 3D5RC 1G3TA 2CMPA 3V7SA 2DTZA 2VBYA 3TW6A 4P96A 3V7RA 1KYZA 5LGTA 3ON2A 3FXRA 4IHXA 3KP2A 5E17F 1TTYA 1Z77A 3EUHC 4HLXA 3JSPA 1LEAA 5J1RA 5F08A 3DU5A 4ZDOA 2NYXA 4OMZA 3EYYA 3D5LA 4A3FJ 1U8BA 2LY9A 3ANGA 4BXXJ 4D7MA 2L02A 3K4BA 1KQ8A 5D18A 4IQ4A 1S7EA 3T6NA 4GGGA 2XDNA 5H2FC 5A2QK 4AM3A 1I1GA 2EZHA 3QPLA 5BOXA 4KWAA 1BW5A 3GX4X 1OCTC 1FT9A 4HPQA 1ZR4A 2W48A 2EH3A 3OYAA 3FWEA 5KAFC 2XRLA 4I02A 2R92J 3JCUC 3WTZA 3HJEA 1G59A 3E5UA 4RDUA 2KMUA 4WWCA 1H8AC 3EUKL 3CF2A 1TWFJ 3VW2A 4A6DA 2JA5J 3HRUA 3J81Z 3CF5F 1I3QJ 3QYFA 3QPSA 1XGOA 3V8LA 5LEKA 1KU3A 1ZYRF 3VTIA 4AYBN 4IVNA 5EEHA 3U21A 3RDIA 2RREA 3ABMH 3DTKA 3JAMK 1WKMA 3WG9A 2HDCA 4A93J 2IS2A 2VJIA 5D19A 2OJED 5L3EA 4HX8A 3K70C 1J0RA 2CWEA 1ZRDA 1MH3A 5AIQA 2NS0A 4RM2A 2FEZA 2H6BA 5F0FA 1PVEA 3BT9A 3Q0UA 4KISA 1T0FA 2KKOA 3B6AA 2BE5F 3GEZA 1LDKB 2W4SA 2LFBA 4O3MA 4XN3A 2CYYA 5L3GA 4KICA 2B9SA 4MK6A 3S2WA 2OU2A 4QLCU 3MZHA 1PUEE 4ZYGA 2X6YA 5HS8A 3ZN1A 1X1AA 1BM9A 3SJMA 1IUFA 2LY2A 3CD6I 1V54H 2L9RA 2YVEA 1K6OA 2LF8A 3RKQA 2JWTA 3RQ4A 2RAEA 2CQKA 5HS7A 2ICWG 3I71A 5HDGA 2YU9J 2MW8A 1FYLA 1T33A 3FZVA 4HDUA 3VSLA 1GVJA 2OC6A 2ZNZA 4AD9A 3RSNA 2QQ8A 1BC7C 1TQIA 3I56I 4A12A 4CYCB 2H1LA 4EJWA 2E19A 4XK4A 1AWCA 1XSDA 3ERMA 4W97A 1MNEA 4LG0B 1USSA 1QVTA 2QM3A 2E36A 1OCPA 2VT3A 2XAJA 1GV5A 5E3OA 3P9TA 2ZCMA 3QAHA 2Q2EA 3ANPA 3MMYB 1LJ9A 4HG2A 3G73A 4EVIA 1FOKA 1SFEA 1I27A 4OAZA 3HGGA 3IC7A 2CJJA 3KFWX 2ETHA 3F21A 3CMYA 1X19A 3LMMA 2QQAA 4Y3OA 2LSOA 2WA0A 2R7SA 2QQ9A 2NX4A 2Y0MA 2EV0A 1A31A 4CCMA 3M8JA 1AU7A 3GTMJ 5K58A 1T98A 1R00A 2MABA 3HPHA 4XKWA 4GYIA 4HA8A 5HSZA 5ICFA 1S8NA 5GPCA 1K4TA 4IRGA 4EMSA 3FF5A 1ZAOA 4P9FA 2K86A 3BC8A 3BP8A 1HKSA 2VI6A 2B3WA 3OSFA 1KA8A 2DJIA 2F4MB 2V9VA 3V4GA 3QPHA 5K5RA 1C0WA 4I0BA 1IRZA 2E35A 2QVOA 3K69A 1FBQA 2ID3A 3BG3A 2F4IA 3OL3A 3I59B 3K4NA 2WAFA 2MG4A 1RI7A 3GTLJ 4DIQA 4H4KC 2KP6A 2KDOA 2RKHA 1TNTA 3M1EA 1Z7UA 2BVMA 1RNLA 1SC7A 3LWJA 2V1XA 2Y9ZA 5CLSA 2FU4A 3OYKA 2UXIA 3BRUA 4Y7NJ 3ZMVA 1ETXA 4J01A 1PP7U 1BJAA 5CVRA 1W36D 4D1QA 1IO2A 2MH2A 1QHGA 5F1RA 3WGHA 3CCUI 3IH3A 5CQGA 1YI2I 2E2HJ 3LA7A 1NHAA 4ESFA 3WU0A 2CSOA 3PNTA 3IRRA 1K78B 1Z7LA 4BBRJ 3LSHA 4Q5SF 2DLLA 3HDDA 1Y0UA 4BE2A 3E1SA 5HNFA 1YYVA 4DYQA 1YW9A 4LMYA 2Q24A 3TO9A 1P4AA 3CUQB 1K83J 3LJLA 3MKLA 3AL0B 1FY7A 1J75A 3RTRA 3HIFA 3C3WA 2ME0A 3M8FA 4BH9A 4BE1A 1P7JA 4U88A 3RPUA 4WX9A 3NEUA 1D8KA 3V78A 3KE2A 3I4PA 4JNNA 1ETQA 4XICA 3K7AJ 2LKXA 4HYEA 5EGOA 3CLOA 3KYDB 2A6TA 3GZNB 4B48A 5BPDA 5DS9A 2MH9A 1CQTA 2EPFA 5K7ZA 2CUFA 3LFUA 4EATA 3MQ0A 5HOOA 3PUFA 3QU3A 4OIOF 2A6HF 4JQFA 4F52A 2UXNA 4BXUA 1W36C 1SMTA 5BPIA 1FYMA 2BBYA 2YSRA 3GZ6A 3MKYB 3DPTA 3L7WA 4C3HJ 1ETOA 5B1BH 4S0HB 4BGDA 5ICCA 4UUSB 4Q4ZF 2GIVA 3SFIA 5JI6A 3KP3A 2HR3A 1IRXA 3EPZA 2HS5A 2CUJA 2Q1ZB 2RC4A 1CGPA 5KAIC 3X2QH 3I53A 2WADA 2E34A 1W7PB 4LFUA 1MW7A 2XIGA 5FGMA 1H0MA 4WCGA 1AKHB 5C3EJ 2DA2A 2QKLB 4RAFA 5DV5A 1NG7A 2KZGA 1AA7A 4ZYEA 5IPAA 3VPRA 3TW7A 4B47A 3ABLH 1BR1A 3T8TA 1U5TB 4BU2A 3BG6A 2WV1A 2J5PA 4IRHA 3MVPA 3ZPLA 2FE3A 2F5VA 4DYRA 2FRHA 2PMZA 2QWTA 3SWHA 2QIBA 5B1AH 2GA2A 4F92B 1QPIA 1R1UA 4K2EA 3KZIC 2EFQA 4LJZF 4YEJA 3CCMI 4C2UA 1N75A 1W5SA 3Q9VA 3A2KA 2OBPA 2XAQA 4JX4A 3QQAA 5E8IA 2LF7A 3HKZN 2ZJQF 2LKSA 2XVCA 1DP7P 4KJZA 4UUSA 1N77A 3G2BA 4XONA 1P6RA 2ZXHA 1BOBA 3WTTC 1RIOH 1TWGJ 2M45A 3H35A 3J81K 4XLEA 1VQ4I 4A3DJ 1KQ0A 3MAJA 4L5EA 4NC8A 2V7FA 3DEUA 1ORKA 1OKRA 3QBMA 2ZXJA 5DUKA 1A5JA 1E3HA 2FOKA 4TV7A 4BQAA 2ZFWA 2A2FX 3MKZA 5CVUA 1YJWI 4YZEA 1JUPA 2QUFA 4NDLA 3UKGA 4UVAA 2AXLA 2DMTA 5JFRA 1X2MA 4MO7A 1D5YA 2NNYA 2ESNA 3JRHA 2JPBA 3KCCA 4A69C 3DPUA 2ZCWA 2R5YA 1ZARA 4G94A 4F55A 1LNWA 4I01A 5FLMJ 3BJOA 4ACIA 1VQ7I 2VQHA 5FJ8J 3C1DA 1MZBA 2R7OA 1MBKA 3LSTA 3QOPA 2ZO4A 5FKMA 2IPQX 3ZQGA 3OYEA 1H9TA 4MNUA 1Q1VA 1R9TJ 2WBMA 3RPUD 3ZR8X 3V6GA 3O6BB 2CRGA 4IHTA 1JT0A 3S32A 3OV8A 2P8TA 2M30A 3DTEA 3I9V2 3REOA 3VUQA 5H20A 1FTTA 4G8XA 2TDXA 2F4OB 4M9SA 1HW2A 3M4OJ 1PUFB 2V57A 1IRFA 3VVXA 3OIOA 2F5EA 1JUMA 1RPWA 2PQ8A 2JMWA 2KZVA 3L2WA 3LSJA 1R4MB 3F6VA 4DZPA 2VL8A 4P5OA 1MJ9A 5HVQC 2LTPA 3ECOA 4EGZA 3IWFA 4IHYA 1YW7A 3VWBA 1R1TA 3CJTB 2H09A 1E0EA 1MMGA 1Z05A 3TGNA 2VKHA 1F4KA 1JTYA 1JTXA 3P7NA 3C7JA 4PCQA 4YIRX 2QF7A 1HXDA 1MSEC 3GVAA 3HEFA 4ZYDA 2IGKA 3BQYA 5E1XA 3IKTA 2KFDA 3KLNA 1E3PA 2XUBA 3JAMZ 5EZGA 4RB0A 2EQRA 3QWLA 2ISZA 2NOJB 3ZCOA 2PBXA 3DEEA 3K4MA 2K02A 2HTSA 2HZTA 1FC3A 3FXMA 4JKZA 3GYHX 2G7HA 1Z21A 2JTVA 2CFOA 1Z67A 5D5WB 3L2QA 3SEQA 3ROUA 1FMVA 1QU3A 2YVXA 3DF8A 3K8PC 1LUJB 1MKMA 1SFXA 1XMAA 5CJ9A 2JRMA 3OMYA 1LKXA 3DKWA 5L3FA 4QTRA 2ZMEA 3JRDA 3T5XA 1IAWA 1U8RA 1ZQ3P 4HDVA 1D3YA 1U9OA 2PMHA 2LMDA 2OUMA 3DP7A 2GA1A 4IRIA 3KIOA 5EFYA 4KYWA 3PFIA 2ZCXA 1IXRC 2VC0A 3G7RA 4GFLA 3GCMA 2COMA 3TKYA 3GZ5A 4N9IA 4O6JA 2EK5A 1QZZA 4HBLA 1S7OA 2CUEA 4RB1A 1EA3A 1S72I 2E2IJ 3ELKA 4O5VA 2Z3YA 1JUSA 2R7FA 3HIMA 1WRJA 2E5NA 2LREA 3R6SA 3S2HJ 4HX7A 3WTWC 2HKOA 2WB1A 2PZ9A 2DYSH 5FFZA 5FD6A 2E5ZA 3HOTA 3FK7A 3K4CA 4M9ZA 1XMKA 2WAQA 4DW6A 1GDTA 2VE8A 3JW4A 2BV6A 3RCOA 4IJAA 2LLKA 4GCLA 3HE0A 3BQZA 1MMAA 2J5OA 3F8MA 4OIRF 2I8DA 2OERA 2QKOA 2RV8A 1AOYA 3OIPA 3CC4I 3DQVC 4GDFA 3OOUA 5D1RA 1X4OA 2R7DA 3SYTA 3S1QJ 2L5QA 4BQNA 4XN0A 1O3RA 4L0YB 1MDMA 2X0LA 1APLC 2WWYA 2FX0A 3HZJA 3BR2A 3OR2C 4OU0A 2DFIA 3DKXA 5IOYA 4PJNA 2L9VA 5FROA 3NRGA 4IHVA 2O8KA 5FRNA 5ERIA 2DI3A 1SVMA 2Y69H 4IL6C 3SFZA 3WU2C 3HTJA 4D5CA 5HLHA 4CH7A 1I6XA 4LOCA 3GFIA 3HOVJ 3S2DJ 4CCOA 1IC8A 2IXSA 2DCEA 3VFZA 1Z91A 4I98B 1G3SA 3CUQA 3D0SA 2HEOA 2V1DA 3HOYJ 3E6CC 4YG2F 2HYJA 1IN4A 1V55H 3I5UA 2COBA 1VQ5I 2M8GX 3K4KA 4MTEA 3QYEA 3K9TA 2G3BA 4N4OB 2E1MB 3K2ZA 1FSEA 4MEYF 2CQXA 1Y6IA 2DTRA 1U9NA 4FISA 4HQMA 2H27A 2RGVA 3U9GA 3O8GA 3VB2A 1O3QA 2HPIA 2KJCA 5M3MJ 1BR4A 5EG0A 3EUAA 3HRTA 5J8FA 3GMEA 4CZZA 3JRAA 2IEKA 2QSHX 1RUOA 2VJJA 4XKBA 4A3MJ 1USTA 2ZSHB 2OCCH 4HW0A 2L7ZA 3U1DA 4IPAA 2E1CA 4CSWA 3ON4A 1P9QC 1SMYF 4U7DA 4QPOA 1UHWA 3ZP5A 2B63J 3GZIA 1YE9A 3I55I 3GTQJ 2KPMA 2NVUB 3TQNA 3SHFA 1FZPB 4XRSA 4BUPA 1LFPA 4DZJA 3FXLA 3OSGA 3F8BA 4XLPF 1LEBA 2LR8A 2IAIA 3M7GA 2ZJPF 1V4RA 4CICA 3EETA 2Z1DA 1VQLI 4MLOA 1GUUA 3BWGA 2PFVA 2JVGA 2GZWA 2PI0A 3HB9A 4HNUA 3HTHA 5L3DA 3DV8A 3PM1A 1AKHA 2MLGA 3SEZA 3CCRI 3PPBA 3DTIA 4I09A 2Y2ZA 3O3KA 3R4KA 4RS8A 4UVBA 3JRFA 1B72A 2DFHA 1U5TA 3H92A 4QIWN 1ZG5A 1HF0A 1XDUA 3A03A 2IT0A 3BJAA 4RA2A 3S15J 2WGBA 3GW2A 4AVZA 1OISA 1DPRA 1UB9A 4UVCA 5F6FA 5GADJ 1Y1WJ 2A07F 2TCTA 2EWNA 4LG0A 3CCYA 4FQGA 1QA6A 3TP0A 2R3SA 5F27A 1LDJA 1WCMJ 4AYBA 3CESA 2P6SA 2LD5A 3PNYA 2NS8A 1B9MA 4G6QA 3IH2A 1YTYA 3NI7A 3ZOBA 1K7AA 3FDYA 5IP9J 3LSMA 3A01A 4A3LJ 3G1MA 2BW3B 3L2CA 1D8JA 1HA8A 3QKXA 2R7QA 2XAUA 5GAEJ 1X1CA 1Y39A 3CRJA 2B0LA 2Z33A 3OYLA 3OYJA 1KU9A 4IEJA 2F07A 1SD6A 2HYFA 2HKUA 2L3DA 2ZJRF 3CCJI 3S17J 5FLVA 5ICEA 3BTIA 2KHMA 1JGGA 5J4VA 4IRVA 1O7LA 3G1LA 5AONA 2W57A 3HOSA 1ZGAA 4AIJA 3H9QA 4DOZA 1QO0D 5LEJA 2CS3A 3GBGA 1Y0NA 3H9JA 2NP3A 1X1PA 5LBQA 4IOAF 3GTGJ 1UG0A 3CMAI 3FM3A 4AUXA 1DDNA 2RNJA 3U1KA 2HPMA 4M6XA 1FBSA 2XGEA 1OPCA 2KIQA 5DTDA 1WFXA 4QSHA 1U6GA 2EINH 2B1EA 1OCZH 2YUSA 5DM6F 2DQRA 4E6KG 5F0HA 2I10A 1RR8C 2K85A 1D1CA 2LP0A 5E3NA 3JRBA 1HW1A 3FK6A 2W84A 4RAZA 2RVCA 2FBHA 1XCBA 2AQFA 2QYOA 3JR9A 3COAC 4MXMA 2CW7A 4AVPA 2IU5A 2M2EA 3PNVA 1TW2A 1IN8A 5M3FJ 4XLCA 3E6BA 1LVAA 4GXOA 3TDZC 5K5QA 2QOPA 2JK3A 2MBFA 3BR1A 2FXAA 5F0CA 5CVVA 2K9NA 3RZDJ 2R7ZJ 2H6CA 2Q2EB 4MEXF 1LE8B 1OR7A 2M0MA 4XR6A 3TP3A 1NG6A 2STWA 3H1CA 2KIUA 1N78A 1Z6TA 4LK1F 4HAMA 1R22A 4CYDA 2FSWA 3WE3A 2KRFA 3WTXC 1TT5B 4ENNA 1DUXC 3S3MA 1FWZA 1OYWA 1VQKI 1Y1VJ 4I2OA 3LFKA 2LOOA 4U0VA 2OV7A 5HDNA 1TW3A 1VZ0A 3KP6A 5H6RA 2E2JJ 1TQPA 3Q5FA 4CXFA 4BEHA 5FMPA 1UMQA 4E70A 2OAZA 3PIPF 5FB2A 1MBGA 4M3GA 4XSXF 5ED4A 5IT3A 3BLYA 4ON0A 1MD0A 2ZFUA 3EYIA 2IGOA 5H6QA 2VUMJ 4IZZA 2VN2A 4MQ9F 4AC6A 2EZKA 1B72B 2DMPA 2V6EA 2YU3A 4V19K 2RASA 3L1PA 5EGOB 3W3CA 3BPXA 1FBUA 3QRFF 3CWRA 2G0EA 2ZNYA 3I54A 3AQSA 4BHBA 2UXHA 3K2AA 1XMXA 3TO7A 3GTOJ 3GTKJ 3EGQA 2BHYA 4F91B 4Y17A 5LD2C 1XD7A 2L54A 3KX2A 2W00A 1HBXG 2QSFX 3ECHA 3MKWB 2GM4A 4M3FA 1KU2A 1V5EA 4KMUX 2IS1A 2JSPA 2IW5A 4A3JJ 5IT9Z 5JHUA 1VQ8I 4JL3A 2VB6A 4A0ZA 4DJAA 2YVHA 2A3SA 4U0YA 4GO1A 5E18F 1ETVA 4I6ZA 2Z5UA 4PGGA 1KZHA 3G71I 1WZ2A 2O03A 3VYRB 3VVZA 2NAZA 4E7SA 1R36A 2R7RA 2DPDA 2JA7J 2ZOYA 2LNBA 2DBBA 4J00A 1J09A 1FMWA 2E7XA 4E7HA 1LB2A 3HUGA 4WIBA 4HSRA 4UHTA 4FX0A 1U5TC 5JLXA 4M73A 2EFOA 2CU7A 2GAUA 3TDUC 1X58A 4HSTA 3I64A 1D1BA 2DU9A 4YELA 4YIFA 2DO7A 2DW4A 4MIMA 3IWZA 3GTPJ 2IS4A 1YS6A 2Y75A 3E3VA 1ZRCA 3I4NJ 1FLIA 3PO3J 2JSCA 2KL4A 2DPUA 3HOUJ 2OTJI 1FOXA 5E3LA 2R4GA 3IAM2 3ABTA 3HSEA 4IHWA 3BTCA 1WGXA 1YLFA 2DA7A 2HKXA 3VYTB 3DBHB 1TBXA 1MBFA 4DBQA 1JXSA 3VOKA 3JRGA 3S1MJ 3KKCA 3IV5A 3IAS2 3DXJF 3OL4A 1W5CC 2O5RA 2CV0A 3NPIA 3LSPA 2R0QC 4GCTA 4M3BA 1W0UA 4PZJA 1SGMA 3NRVA 1I6HJ 2VE9A 3VW1A 2X1CA 1LQ1A 3L00A 3LSRA 1Z1DA 1WJ5A 3KP5A 2KDZA 1W0TA 2VC1A 4RGXA 3CZ6A 3ABUA 4PJMA 1IN5A 5L3BA 1FX7A 1MGTA 2IJLA 1H89C 2HVRA 4G7HF 2TRTA 2DDAA 2X6WA 4UV8A 1UHSA 2LK2A 3F8NA 5IYCJ 4G7OF 5EDNA 2F48A 5FO5A 3OY9A 2K9MA 5D6FA 1Q1HA 1IG7A 1QBJA 2LRDA 3AG3H 3CUOA 4B4CA 3FM5A 4RMNA 2HQRA 3E6MA 3PSFA 4BEHB 1XSXA 4M74A 2VPLA 4B09A 4II2A 3CLQA 3IHUA 3OS2A 4IHSA 2IA0A 5ICGA 3I0TA 4C3IJ 3P9KA 3OYFA 2L4AA 4IX7A 2VBWA 1SAUA 5K5OA 2KIFA 3CJNA 4LIUA 1FP2A 1QZEA 4UB6C 5KCMA 4L9TA 2EFPA 2O8XA 4I76A 3P9IA 5IP7J 5HLTA 1MMSA 1VQOI 1RKWA 1J9IA 2HFHA 3RQIA 5J47A 1OCRH 2FJ1A 2JRTA 4OAYA 1I3AA 2IS6A 3PQJA 4GFKA 5J40A 5BNGA 1XG1A 4NUBA 1SEUA 3S1NJ 3ASOH 1JGSA 3BG7A 1PUFA 3IL2A 1UELB 2ELJA 2XF6A 4U7BA 4MGRA 2X6OA 2VOOA 2RHAA 1MBEA 2VXZA 4YIIA 1GXPA 3K1PA 1JHHA 2UUZA 1VQ6I 5FFXA 3ERED 1E2XA 1MBJA 4LGWA 5FLXZ 1DU6A 2NVQJ 1BOAA 2OF7A 4LD5A 1ON1A 1X1DA 2BOLA 4BS9A 1RESA 5C44J 5FLXK 2VIXA 2P7CB 1WQ2A 2EIMH 3RPQA 2M87A 2ZCNA 2DA6A 4WXDA 2D1HA 5EEAA 4Y52J 3HM5A 2KRCA 3VODA 1ZR2A 3TEDA 3W6JB 3IRQA 1T39A 3PFYA 1O7FA 5KVRA 1VI0A 5D8KB 3HBLA 2VJ4A 2M8EA 3NWTA 4XMYA 4N0BA 3E6DA 3ASNH 1BI2A 3RKXA 2FQ3A 4KA4A 1X3WB 2L7MP 3I59A 1TNSA 4HRIA 2K27A 4EEFG 2VBZA 3FKIJ 1JKOC 5E3MA 3L09A 1KYWA 1TC3C 1L3LA 1FSHA 2PLYA 2XF7A 4YFKF 2F2EA 2G7UA 1Z3XA 1S6LA 5J8CA 3WE2A 1PYVA 1A36A 2ZMEB 3FHNA 4HV5A 4LLNA 3BDDA 1WJBA 4U0WA 4A6EA 4D0PA 1WJFA 3JTGA 2IVMA 3KEQA 4FX4A 2GLOA 3RD3A 3BPVA 4WXCA 1RETA 4L9JA 1OYYA 5KNLA 3N4MA 3NXCA 3BTLA 3JSOA 3ZXSA 2HDWA 3P5JA 1T56A 5CQEA 5CPRB 1D0XA 2DK8A 2QKMB 1B59A 3L2VA 4GRIA 2VASA 3V7CA 4B8XA 3ZGKA 2HOTA 4ZJZA 2PJRA 1T0FC 4HKUA 1IV6A 3S5RA 2JUGA 4BACA 5CXIA 1YW8A 3L9FA 4M3EA 4B3AA 3S93A 5ILUA 5DM7F 1I1SA 1G3YA 3RYPA 2DG7A 1MNMC 3KYCB 5KK1A 5J4YA 3V8JA 2UXOA 1IV8A 4U87A 2JT1A 1OJLA 2O6GE 3OYDA 1WI9A 4I99C 2DN0A 5DD8A 1XB4A 1PP8F 2L7FP 2PMZN 1ZG1A 2JJ7A 4BDYA 4GYGA 1W4MA 1VQNI 2GFNA 2PX9A 4P55A 3BJBA 3OYMA 2ECCA 1XGNA 3A0HC 5KHDA 3OYNA 3HRSA 3VOEA 2P5VA 3KEOA 2A69F 2GOMA 4RLQA 2DT6A 3V8KA 1W5TA 1XPXA 1FYKA 3KNWA 1HKQA 2DAOA 4XRFA 2BW3A 1YRNA 1VQPI 2A68F 3GLLA 4A3CJ 1BA5A 3G56A 2STTA 4RBOA 4I0AA 1QPMA 3EUPA 1ACIA 4L5JA 3KEYA 5D5VB 4NC6A 1XCVA 4BHPA 1J59A 4CA0A 5LHIA 3RYRA 2FBKA 3H9GA 2DA4A 2REKA 3WHBA 5TISC 5JVTA 4MTDA 1BR2A 4E4HA 1W7PA 2ZB9A 3OYBA 5IOZA 3QPTA 1ETYA 3BNIA 2EZLA 5F04A 3CO7C 4FTHA 2R5ZA 2ZJ2A 1BW6A 4HV6A 3CCSI 1WWXA 3BTJA 3LAJA 3ZMSA 4CCJA 3R61A 1DGWY 1W7PD 4L9VA 3BROA 2UZKA 2KJBA 5EG0B 3D5SC 2IGMA 3IP4B 4FT8A 4RLFA 2AQEA 5JLWA 5FKOA 4C2MA 2K40A 3OS1A 4OWRB 5DCMB 3OYIA 1ZHFA 4BAYA 2WY8Q 4AIKA 1T08B 4E7IA 5FHPA 4L5IA 4BJTA 3H5NA 4HZFA 1QHHD 1ZLJA 2E7WA 2VKVA 4FASD 5HDKA 2CW8A 2LC2A 2NVXJ 2RNGA 2RQQA 5E79C 2MA3A 3M9AA 1KU7A 2H8WA 1E3OC 2QEXI 2DOAA 2P7VB 1FJLA 3CCEI 4C2TA 3H0DA 4JK1X 1TLHB 3NWSA 4D7NA 1ZGWA 4F7ZA 2HQ5A 4HNVA 2L4MA 3D1NI 1T95A 3J7AY 2H94A 2P6TA 3BCAA 5E1ZB 1B8IB 3ZMTA 1XGSA 3K0LA 1RRJA 2MD5A 4KFCA 4RGRA 2DMQA 5GTHC 4B1RA 1DGRM 4M6YA 2GXAA 1J7KA 4ITVA 3Q0WA 2ADUA 4NB5A 1HDPA 3BJ6A 2LVSA 5IYBJ 2FD5A 1REPC 5D8LB 5FKLA 1RR7A 2BY2A 1WHUA 2R5YB 3H3UA 3MN2A 2O61A 4UXNA 2CQQA 3QP5A 2LKPA 5HLGA 4ESJA 1YX3A 1QQIA 2XGCA 3HTUA 1K6YA 2DA3A 5JHFA 2LG4A 2HU9A 2PFBA 2ELHA 2V26A 3E7QA 2OQGA 3PJRA 1G6NA 5GTIC 4CGZA 3G1OA 4NELA 2OA4A 3AG2H 1YITI 1UG2A 2WTEA 3C2HA 1ITYA 4BXFA 2NVTJ 4KT6A 5C4JJ 2YPRA 2GWRA 2D2WA 3HPGA 4EM1A 1EJ9A 1ON2A 3VSKA 2QENA 1T38A 2MFZA 2KQRA 1F5TA 1A6QA 3K10A 2XKPA 1FNNA 4C2MJ 2F6CA 3CP8A 1WVRA 1H9GA 2LBFA 2FBIA 3TL4X 4ETSA 2GENA 2FF4A 3ZQQA 3HTAA 1A04A 1ZREA 1TT0A 4OIPF 4Y15A 2CQ7A 3ZMUA 2FJI1 2BY1A 4EM2A 2O3FA 1OCCH 1LDDA 3QOEA 1TP4A 4A5MA 3MFKA 4HF2A 2LY1A 2PMUA 3WGIA 3BR3A 4PFOA 5AIPA 5GP9A 2XDVA 4PJ0C 4HQEA 3CC2I 4AIDA 1XC5A 1SVLA 1P4WA 3PQKA 3HOZJ 1VNDA 4XLFA 3Q0VA 2HVQA 1IN7A 1X3ZB 2EBIA 2CFXA 1MH4A 1MMDA 4DVYP 3SXYA 3R0JA 4JYKA 5GAGJ 3M1CA 2EA4A 1BIAA 1ZG3A 3DEWA 4I7HA 2X1DA 2HOSA 4EGYA 4S04A 3FMQA 3MEXA 4XOTA 2WC2A 1U0JA 3A0BC 3ZQCA 2DFEA 2IA2A 1S7AA 4M6VA 2CQNA 4EM0B 4FHTA 1B9NA 1VQ9I 4NNJA 5EZHA 5TGTA 1SFUA 1LE8A 2L7KA 3K70D 1SD7A 3F8FA 4XIDA 3AFHA 4L9NA 2NVYJ 3FIWA 5LFAA 4ENMA 1ZKGA 3SZTA 5ILSA 2R7TA 2DOEA 2VODA 4BL0B 1SAXA 3HYIA 1VF9A 2P5LC 4V2FA 2GOXB 1Z9CA 1BN5A 1XN7A 3N97A 3SQNA 3RH2A 3DFGA 1YIJI 4XSZF 2CH0A 4DYCA 1WJEA 4HX4A 3HOXJ 2CUZA 5FKNA 2V1UA 3I3LA 2ZSIB 2AXTC 4ZTJA 1FOWA 2OCEA 1R49A 4LLLA 3AL0C 3GWZA 1UI5A 4X1EA 3HOWJ 5IYDJ 1HC8A 1SANA 2W82A 1IGNA 3ZQLA 3CC7I 3A02A 1KGSA 5M5XJ 1O57A 4XRMA 1EH6A 3B6CA 2QA4I 1TZLA 5LGUA 3FXKA 3CTAA 1WJDA 1KONA 3UR3C 4OD4A 2M4KA 2VONA 4B3XA 4MQVA 5J1YA 1BI0A 1HDDC 3J7YJ 4KT5C 3E5XA 3MNLA 4CCLA 2OPTA
chains in the Genus database with same CATH topology
2K9SA 3Q3SA 2X9DA 4G12A 2WV1A 2NOGA 3MVPA 5JLXA 4CGRA 3ZQFA 4DYRA 2QWTA 2CU7A 2QIBA 3LOCA 1X58A 1POGA 1QPIA 4MIMA 4JX4A 2DMNA 3GTPJ 2E1OA 3QQAA 3LNQA 3I4NJ 3CDLA 3PO3J 4PXIA 3HKZN 1QVUA 2NP5A 2D5VA 3HOUJ 5E3LA 4UUSA 1RKTA 4IHWA 3BTCA 1WGXA 2DA7A 1FEXA 4XRSG 1TWGJ 4A3DJ 1MBFA 3VOKA 3JRGA 3S1MJ 4L5EA 2UXUA 3KKCA 1ORKA 3IV5A 3QBMA 1BL0A 3NPIA 4UUTA 4GCTA 3LSPA 2R0QC 1A5JA 4M3BA 1NK2P 2Y31A 1W0UA 1SGMA 3O60A 5EF6A 1I6HJ 3VW1A 1GT0C 2HOAA 2R93J 1ETWA 1JUPA 4NDLA 4YZEA 3UKGA 3LSRA 4L62A 2JN6A 3FRQA 2L0KA 2KDZA 1W0TA 2DMTA 3W6VA 1X2MA 4MO7A 1D5YA 4AF5A 3O8HA 1H89C 3JRHA 2TRTA 4A69C 2R5YA 1UHSA 2LK2A 5IYCJ 3HTIA 5EDNA 2O7TA 5FLMJ 4FCYA 4ACIA 1IG7A 5FJ8J 1MBKA 1FTZA 4B4CA 1BJZA 3BR0A 5FKMA 3ZQGA 1I50J 2DMUA 4C3IJ 1Q1VA 5IP6A 1R9TJ 3V6GA 3M3YJ 2CRGA 3WHCA 3VP5A 1WH7A 1JT0A 1MSFC 2AO9A 2X48A 4JX5A 2DG8A 1TWAJ 3F0CA 4I76A 1HOMA 3PO2J 2R5ZB 5IP7J 5K7FA 1RKWA 3VUQA 2W53A 3RQIA 5DAJA 2FJ1A 3KZ9A 1FTTA 3I4MJ 1F43A 3M4OJ 1PUFB 3LHQA 2V57A 4GFKA 5BNGA 1XG1A 3S1NJ 1QRYA 2XGDA 3OIOA 3VVXA 1JUMA 1RPWA 3PASA 2JMWA 3SDGA 1PUFA 3LSJA 4DZPA 2QCOA 2X6OA 2RHAA 1OFCX 2M34A 2LTPA 1MBEA 4IHYA 3GEUA 1MBHA 1MBJA 2DA5A 1JJ8C 1ZK8A 5EYRA 5HODA 3CJDA 1WH5A 1DU6A 2NVQJ 4GFBA 2OF7A 1JKQC 2G7LA 1JTYA 1RESA 5C44J 1JTXA 2G7SA 2QF7A 1MSEC 1HCRA 2DA6A 2ZCNA 5EEAA 4Y52J 3HEFA 3HM5A 3BQYA 1ZR2A 3TEDA 4J19A 5EZGA 2NS7A 1VI0A 2ECBA 2EQRA 3HBLA 1G2HA 2PBXA 2MGQA 3ZQHA 2AHQA 2FQ4A 2D6YA 4JKZA 2L7MP 5H9TA 3COLA 4EEFG 3FKIJ 1JKOC 2ELKA 5E3MA 3VVYA 3GTJJ 1TC3C 2XB5A 4QTRA 3JRDA 3JRIA 1ZQ3P 1U9OA 5EFYA 2ZCXA 3G7RA 2DJNA 4GFLA 3ZQIA 4BKXA 3RZOJ 4JX6A 3BR5A 2CUEA 1LFBA 3RD3A 4V2GA 2GLOA 1LFUP 2XSDC 2E2IJ 5FGLA 2HXOA 1RETA 3HIMA 1JUSA 3NXCA 2GUHA 3S2HJ 3BTLA 4UDSA 3DCFA 2O9LA 1WI3A 1DU0A 3IH4A 1T56A 2PZ9A 3JSJA 3FISA 2OI8A 3H0GJ 1SFOJ 2M9HA 3E7LA 3FK7A 2H8RA 2FBQA 2ZOZA 5HAWA 2KT0A 4DW6A 1AHDP 2HOTA 2WUIA 1GDTA 2JA8J 5CW8A 1TWHJ 4HKUA 1IV6A 2XPUA 2LLKA 5M5WJ 2HXIA 3HE0A 5CXIA 3S5RA 3BQZA 2DTZA 4GCLA 4M3EA 4B3AA 3TW6A 2K9QA 2OERA 2QKOA 3ON2A 4IHXA 4ME9A 5D1RA 3VW0A 3OOUA 1Z77A 3BR6A 1MNMC 2DG7A 3S1QJ 5J1RA 5F08A 2UXOA 1H88C 1APLC 2FX0A 2WB1N 3BR2A 5K7HA 1OJLA 4A3FJ 1U8BA 2LY9A 5IOYA 2DN0A 3ANGA 4BXXJ 2Y0SN 4D7MA 2ID6A 3NRGA 1X2NA 2L7FP 2O8KA 4IHVA 2PMZN 5D18A 2JJ7A 1S7EA 3HTJA 3T6NA 2XDNA 2GFNA 3BJBA 2EZHA 3QPLA 4D5CA 2ECCA 3B81A 4LOCA 3HOVJ 3S2DJ 1BW5A 1EF4A 3IUVA 4KWAA 1OCTC 1IC8A 1HLVA 1U78A 1ZR4A 3KNWA 2W48A 2EH3A 5J1UA 1BA5A 1YRNA 3G56A 4A3CJ 3BHQA 2XRLA 1FIAA 2VPRA 3HOYJ 4RBOA 2R92J 3EUPA 4RDUA 2HYJA 1IDYA 1H8AC 1YRNB 4FE4A 1Z0XA 1TWFJ 3VW2A 2COBA 1VFCA 2JA5J 2DA4A 2REKA 2M8GX 3WHBA 1I3QJ 3QPSA 2G3BA 1F36A 2ZB9A 4AYBN 2CQXA 4FISA 1U9NA 5IOZA 3BNIA 1ETYA 3O8GA 2EZLA 4A3IJ 5F04A 4FTHA 2R5ZA 1BW6A 5M3MJ 5J3LA 3BTJA 4C3JJ 4D5FA 5EG0A 3S14J 4A93J 3JRAA 5D19A 2IEKA 5C4XJ 4W1UA 4A3MJ 5EG0B 2UXPA 2L7ZA 3ON4A 5FKKA 1MH3A 5JLWA 4BY1J 5FKOA 2K40A 2HDDA 5F0FA 1P7IA 3BT9A 3Q0UA 2B63J 3GZIA 3B6AA 2M0CA 3GTQJ 2N8GA 2LFBA 5FHPA 3S1RJ 4MK6A 4XRSA 1ENHA 3OSGA 4DZJA 2VKVA 2NVXJ 4X6AJ 2LR8A 2IAIA 3AQTA 1E3OC 2HI3A 3SJMA 1FJLA 1IUFA 2QTQA 4MLOA 1GUUA 2L9RA 5GPAA 4D7NA 1ZGWA 2YVEA 3HB9A 3A01B 2HQ5A 3LSGA 4HNVA 3D1NI 2JWTA 3RKQA 2RAEA 3HTHA 4CYCA 1AKHA 3PM1A 2YU9J 2MW8A 1B8IB 1T33A 1O4XA 3PPBA 1ZTRA 2Y2ZA 3JRFA 3JRCA 4CYCB 1B72A 1A6IA 3NAUA 2E19A 4XK4A 1B8IA 2DMQA 4QIWN 4W97A 4B1RA 1HF0A 2WAQN 3A03A 1QVTA 2XPVA 2Y9YA 3S15J 3Q0WA 1OCPA 2WGBA 3JREA 5E3OA 1GV5A 3S16J 1HDPA 2LVSA 5IYBJ 1Y1WJ 2ZCMA 3P9TA 2FD5A 2GBYA 2TCTA 5FKLA 3CCYA 3ANPA 1RR7A 3TP0A 5F27A 2R5YB 1WCMJ 3MN2A 2LD5A 3HGGA 2NS8A 9ANTA 2CJJA 2CQQA 3BCGA 3IH2A 2XGCA 4JP0A 3CMYA 3NI7A 3ZOBA 2DA3A 4A3LJ 5IP9J 3A01A 2NX4A 3G1MA 3C07A 3QKXA 4A3EJ 3CRJA 3E7QA 1JJ6C 1AU7A 3CQZJ 4M3DA 3GTMJ 4IEJA 5K58A 2F07A 2XB0X 1K61A 2HKUA 5HSZA 3G1OA 4NELA 5GPCA 3S17J 5FLVA 1UG2A 2VKEA 3BTIA 1JGGA 1ITYA 1UI6A 3G1LA 2NVTJ 5C4JJ 2VI6A 3OSFA 1JKRC 2P81A 1FIPA 1IRZA 3GBGA 2NP3A 4ICHA 2ID3A 3GTGJ 4C2MJ 3BG3A 3F1BA 4AUXA 2GENA 5F1JA 1TWCJ 5C4YA 2MG4A 3GTLJ 3HTAA 2YS9A 2XGEA 4FE7A 5DTDA 2HYTA 4QSHA 3LWJA 2YUSA 2Y9ZA 5F0HA 2I10A 2UXIA 1IJWC 4Y7NJ 3BRUA 2LP0A 3BR3A 5E3NA 3JRBA 1XS9A 3FK6A 5GP9A 2JA6J 1IDZA 2O7OA 1ETXA 1XC5A 3JR9A 4MXMA 3HOZJ 3HGYA 3BG9A 1VNDA 2IU5A 2M2EA 3Q0VA 5M3FJ 2EBIA 4A3BJ 1MH4A 2XPWA 3IH3A 2QOPA 4MFDA 4JYKA 2JK3A 2E2HJ 3BR1A 3DPJA 5F0CA 2HOSA 3DEWA 3RZDJ 2K9NA 2R7ZJ 4BBRJ 1LE8B 3TP3A 3HDDA 3ZQCA 1ETKA 4M6VA 4DYQA 2Q24A 3C2BA 1K83J 5EZHA 1LE8A 3LJLA 3MKLA 2ME0A 4XIDA 1Y1VJ 1P7JA 2EZIA 2NVYJ 3FIWA 2G7GA 3NNRA 5AQCA 1ZKGA 2E2JJ 1JT6A 2ME6A 5FMPA 3V78A 3NARA 1UMQA 1VF9A 1MBGA 1ETQA 4M3GA 4V2FA 4JNNA 4XICA 3K7AJ 2LKXA 5EGOA 2VUMJ 3RH2A 4A3KJ 5DS9A 1CQTA 5K7ZA 4DYCA 1NK3P 4AC6A 2EZKA 1B72B 2DMPA 2CUFA 2RASA 3L1PA 5EGOB 1GV2A 3HOXJ 5FKNA 3CWRA 2G0EA 4BY7J 2H1KA 3AQSA 2UXHA 1UI5A 3K2AA 4X1EA 3HOWJ 4A3GJ 4ABZA 3GTOJ 3GTKJ 3EGQA 5IYDJ 1SANA 4C3HJ 1IGNA 1ETOA 4S0HB 3ZQLA 4UUSB 3A02A 5M5XJ 4XRMA 3B6CA 4BBSJ 3SFIA 5M5YJ 4NN1A 2GM4A 4M3FA 4GCKA 2IBDA 5CXGA 4A3JJ 4JL3A 4MFEA 1JKPC 3H3VK 2YVHA 2Y30A 3VIBA 3KKDA 5J1YA 1ETVA 4I6ZA 2MSYA 5HBUA 1WPKA 4AC0A 3BG5A 1HDDC 1AKHB 5C3EJ 3VVZA 1NTCA 2DA2A 3MNLA 2JA7J 1GVDA 2DA1A 2OPTA 3VOXA 2ZOYA 5IPAA 3VPRA 3TW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9S A;  3Q3S A;  2X9D A;  4G12 A;  2WV1 A;  2NOG A;  3MVP A;  5JLX A;  4CGR A;  3ZQF A;  4DYR A;  2QWT A;  2CU7 A;  2QIB A;  3LOC A;  1X58 A;  1POG A;  1QPI A;  4MIM A;  4JX4 A;  2DMN A;  3GTP J;  2E1O A;  3QQA A;  3LNQ A;  3I4N J;  3CDL A;  3PO3 J;  4PXI A;  3HKZ N;  1QVU A;  2NP5 A;  2D5V A;  3HOU J;  5E3L A;  4UUS A;  1RKT A;  4IHW A;  3BTC A;  1WGX A;  2DA7 A;  1FEX A;  4XRS G;  1TWG J;  4A3D J;  1MBF A;  3VOK A;  3JRG A;  3S1M J;  4L5E A;  2UXU A;  3KKC A;  1ORK A;  3IV5 A;  3QBM A;  1BL0 A;  3NPI A;  4UUT A;  4GCT A;  3LSP A;  2R0Q C;  1A5J A;  4M3B A;  1NK2 P;  2Y31 A;  1W0U A;  1SGM A;  3O60 A;  5EF6 A;  1I6H J;  3VW1 A;  1GT0 C;  2HOA A;  2R93 J;  1ETW A;  1JUP A;  4NDL A;  4YZE A;  3UKG A;  3LSR A;  4L62 A;  2JN6 A;  3FRQ A;  2L0K A;  2KDZ A;  1W0T A;  2DMT A;  3W6V A;  1X2M A;  4MO7 A;  1D5Y A;  4AF5 A;  3O8H A;  1H89 C;  3JRH A;  2TRT A;  4A69 C;  2R5Y A;  1UHS A;  2LK2 A;  5IYC J;  3HTI A;  5EDN A;  2O7T A;  5FLM J;  4FCY A;  4ACI A;  1IG7 A;  5FJ8 J;  1MBK A;  1FTZ A;  4B4C A;  1BJZ A;  3BR0 A;  5FKM A;  3ZQG A;  1I50 J;  2DMU A;  4C3I J;  1Q1V A;  5IP6 A;  1R9T J;  3V6G A;  3M3Y J;  2CRG A;  3WHC A;  3VP5 A;  1WH7 A;  1JT0 A;  1MSF C;  2AO9 A;  2X48 A;  4JX5 A;  2DG8 A;  1TWA J;  3F0C A;  4I76 A;  1HOM A;  3PO2 J;  2R5Z B;  5IP7 J;  5K7F A;  1RKW A;  3VUQ A;  2W53 A;  3RQI A;  5DAJ A;  2FJ1 A;  3KZ9 A;  1FTT A;  3I4M J;  1F43 A;  3M4O J;  1PUF B;  3LHQ A;  2V57 A;  4GFK A;  5BNG A;  1XG1 A;  3S1N J;  1QRY A;  2XGD A;  3OIO A;  3VVX A;  1JUM A;  1RPW A;  3PAS A;  2JMW A;  3SDG A;  1PUF A;  3LSJ A;  4DZP A;  2QCO A;  2X6O A;  2RHA A;  1OFC X;  2M34 A;  2LTP A;  1MBE A;  4IHY A;  3GEU A;  1MBH A;  1MBJ A;  2DA5 A;  1JJ8 C;  1ZK8 A;  5EYR A;  5HOD A;  3CJD A;  1WH5 A;  1DU6 A;  2NVQ J;  4GFB A;  2OF7 A;  1JKQ C;  2G7L A;  1JTY A;  1RES A;  5C44 J;  1JTX A;  2G7S A;  2QF7 A;  1MSE C;  1HCR A;  2DA6 A;  2ZCN A;  5EEA A;  4Y52 J;  3HEF A;  3HM5 A;  3BQY A;  1ZR2 A;  3TED A;  4J19 A;  5EZG A;  2NS7 A;  1VI0 A;  2ECB A;  2EQR A;  3HBL A;  1G2H A;  2PBX A;  2MGQ A;  3ZQH A;  2AHQ A;  2FQ4 A;  2D6Y A;  4JKZ A;  2L7M P;  5H9T A;  3COL A;  4EEF G;  3FKI J;  1JKO C;  2ELK A;  5E3M A;  3VVY A;  3GTJ J;  1TC3 C;  2XB5 A;  4QTR A;  3JRD A;  3JRI A;  1ZQ3 P;  1U9O A;  5EFY A;  2ZCX A;  3G7R A;  2DJN A;  4GFL A;  3ZQI A;  4BKX A;  3RZO J;  4JX6 A;  3BR5 A;  2CUE A;  1LFB A;  3RD3 A;  4V2G A;  2GLO A;  1LFU P;  2XSD C;  2E2I J;  5FGL A;  2HXO A;  1RET A;  3HIM A;  1JUS A;  3NXC A;  2GUH A;  3S2H J;  3BTL A;  4UDS A;  3DCF A;  2O9L A;  1WI3 A;  1DU0 A;  3IH4 A;  1T56 A;  2PZ9 A;  3JSJ A;  3FIS A;  2OI8 A;  3H0G J;  1SFO J;  2M9H A;  3E7L A;  3FK7 A;  2H8R A;  2FBQ A;  2ZOZ A;  5HAW A;  2KT0 A;  4DW6 A;  1AHD P;  2HOT A;  2WUI A;  1GDT A;  2JA8 J;  5CW8 A;  1TWH J;  4HKU A;  1IV6 A;  2XPU A;  2LLK A;  5M5W J;  2HXI A;  3HE0 A;  5CXI A;  3S5R A;  3BQZ A;  2DTZ A;  4GCL A;  4M3E A;  4B3A A;  3TW6 A;  2K9Q A;  2OER A;  2QKO A;  3ON2 A;  4IHX A;  4ME9 A;  5D1R A;  3VW0 A;  3OOU A;  1Z77 A;  3BR6 A;  1MNM C;  2DG7 A;  3S1Q J;  5J1R A;  5F08 A;  2UXO A;  1H88 C;  1APL C;  2FX0 A;  2WB1 N;  3BR2 A;  5K7H A;  1OJL A;  4A3F J;  1U8B A;  2LY9 A;  5IOY A;  2DN0 A;  3ANG A;  4BXX J;  2Y0S N;  4D7M A;  2ID6 A;  3NRG A;  1X2N A;  2L7F P;  2O8K A;  4IHV A;  2PMZ N;  5D18 A;  2JJ7 A;  1S7E A;  3HTJ A;  3T6N A;  2XDN A;  2GFN A;  3BJB A;  2EZH A;  3QPL A;  4D5C A;  2ECC A;  3B81 A;  4LOC A;  3HOV J;  3S2D J;  1BW5 A;  1EF4 A;  3IUV A;  4KWA A;  1OCT C;  1IC8 A;  1HLV A;  1U78 A;  1ZR4 A;  3KNW A;  2W48 A;  2EH3 A;  5J1U A;  1BA5 A;  1YRN A;  3G56 A;  4A3C J;  3BHQ A;  2XRL A;  1FIA A;  2VPR A;  3HOY J;  4RBO A;  2R92 J;  3EUP A;  4RDU A;  2HYJ A;  1IDY A;  1H8A C;  1YRN B;  4FE4 A;  1Z0X A;  1TWF J;  3VW2 A;  2COB A;  1VFC A;  2JA5 J;  2DA4 A;  2REK A;  2M8G X;  3WHB A;  1I3Q J;  3QPS A;  2G3B A;  1F36 A;  2ZB9 A;  4AYB N;  2CQX A;  4FIS A;  1U9N A;  5IOZ A;  3BNI A;  1ETY A;  3O8G A;  2EZL A;  4A3I J;  5F04 A;  4FTH A;  2R5Z A;  1BW6 A;  5M3M J;  5J3L A;  3BTJ A;  4C3J J;  4D5F A;  5EG0 A;  3S14 J;  4A93 J;  3JRA A;  5D19 A;  2IEK A;  5C4X J;  4W1U A;  4A3M J;  5EG0 B;  2UXP A;  2L7Z A;  3ON4 A;  5FKK A;  1MH3 A;  5JLW A;  4BY1 J;  5FKO A;  2K40 A;  2HDD A;  5F0F A;  1P7I A;  3BT9 A;  3Q0U A;  2B63 J;  3GZI A;  3B6A A;  2M0C A;  3GTQ J;  2N8G A;  2LFB A;  5FHP A;  3S1R J;  4MK6 A;  4XRS A;  1ENH A;  3OSG A;  4DZJ A;  2VKV A;  2NVX J;  4X6A J;  2LR8 A;  2IAI A;  3AQT A;  1E3O C;  2HI3 A;  3SJM A;  1FJL A;  1IUF A;  2QTQ A;  4MLO A;  1GUU A;  2L9R A;  5GPA A;  4D7N A;  1ZGW A;  2YVE A;  3HB9 A;  3A01 B;  2HQ5 A;  3LSG A;  4HNV A;  3D1N I;  2JWT A;  3RKQ A;  2RAE A;  3HTH A;  4CYC A;  1AKH A;  3PM1 A;  2YU9 J;  2MW8 A;  1B8I B;  1T33 A;  1O4X A;  3PPB A;  1ZTR A;  2Y2Z A;  3JRF A;  3JRC A;  4CYC B;  1B72 A;  1A6I A;  3NAU A;  2E19 A;  4XK4 A;  1B8I A;  2DMQ A;  4QIW N;  4W97 A;  4B1R A;  1HF0 A;  2WAQ N;  3A03 A;  1QVT A;  2XPV A;  2Y9Y A;  3S15 J;  3Q0W A;  1OCP A;  2WGB A;  3JRE A;  5E3O A;  1GV5 A;  3S16 J;  1HDP A;  2LVS A;  5IYB J;  1Y1W J;  2ZCM A;  3P9T A;  2FD5 A;  2GBY A;  2TCT A;  5FKL A;  3CCY A;  3ANP A;  1RR7 A;  3TP0 A;  5F27 A;  2R5Y B;  1WCM J;  3MN2 A;  2LD5 A;  3HGG A;  2NS8 A;  9ANT A;  2CJJ A;  2CQQ A;  3BCG A;  3IH2 A;  2XGC A;  4JP0 A;  3CMY A;  3NI7 A;  3ZOB A;  2DA3 A;  4A3L J;  5IP9 J;  3A01 A;  2NX4 A;  3G1M A;  3C07 A;  3QKX A;  4A3E J;  3CRJ A;  3E7Q A;  1JJ6 C;  1AU7 A;  3CQZ J;  4M3D A;  3GTM J;  4IEJ A;  5K58 A;  2F07 A;  2XB0 X;  1K61 A;  2HKU A;  5HSZ A;  3G1O A;  4NEL A;  5GPC A;  3S17 J;  5FLV A;  1UG2 A;  2VKE A;  3BTI A;  1JGG A;  1ITY A;  1UI6 A;  3G1L A;  2NVT J;  5C4J J;  2VI6 A;  3OSF A;  1JKR C;  2P81 A;  1FIP A;  1IRZ A;  3GBG A;  2NP3 A;  4ICH A;  2ID3 A;  3GTG J;  4C2M J;  3BG3 A;  3F1B A;  4AUX A;  2GEN A;  5F1J A;  1TWC J;  5C4Y A;  2MG4 A;  3GTL J;  3HTA A;  2YS9 A;  2XGE A;  4FE7 A;  5DTD A;  2HYT A;  4QSH A;  3LWJ A;  2YUS A;  2Y9Z A;  5F0H A;  2I10 A;  2UXI A;  1IJW C;  4Y7N J;  3BRU A;  2LP0 A;  3BR3 A;  5E3N A;  3JRB A;  1XS9 A;  3FK6 A;  5GP9 A;  2JA6 J;  1IDZ A;  2O7O A;  1ETX A;  1XC5 A;  3JR9 A;  4MXM A;  3HOZ J;  3HGY A;  3BG9 A;  1VND A;  2IU5 A;  2M2E A;  3Q0V A;  5M3F J;  2EBI A;  4A3B J;  1MH4 A;  2XPW A;  3IH3 A;  2QOP A;  4MFD A;  4JYK A;  2JK3 A;  2E2H J;  3BR1 A;  3DPJ A;  5F0C A;  2HOS A;  3DEW A;  3RZD J;  2K9N A;  2R7Z J;  4BBR J;  1LE8 B;  3TP3 A;  3HDD A;  3ZQC A;  1ETK A;  4M6V A;  4DYQ A;  2Q24 A;  3C2B A;  1K83 J;  5EZH A;  1LE8 A;  3LJL A;  3MKL A;  2ME0 A;  4XID A;  1Y1V J;  1P7J A;  2EZI A;  2NVY J;  3FIW A;  2G7G A;  3NNR A;  5AQC A;  1ZKG A;  2E2J J;  1JT6 A;  2ME6 A;  5FMP A;  3V78 A;  3NAR A;  1UMQ A;  1VF9 A;  1MBG A;  1ETQ A;  4M3G A;  4V2F A;  4JNN A;  4XIC A;  3K7A J;  2LKX A;  5EGO A;  2VUM J;  3RH2 A;  4A3K J;  5DS9 A;  1CQT A;  5K7Z A;  4DYC A;  1NK3 P;  4AC6 A;  2EZK A;  1B72 B;  2DMP A;  2CUF A;  2RAS A;  3L1P A;  5EGO B;  1GV2 A;  3HOX J;  5FKN A;  3CWR A;  2G0E A;  4BY7 J;  2H1K A;  3AQS A;  2UXH A;  1UI5 A;  3K2A A;  4X1E A;  3HOW J;  4A3G J;  4ABZ A;  3GTO J;  3GTK J;  3EGQ A;  5IYD J;  1SAN A;  4C3H J;  1IGN A;  1ETO A;  4S0H B;  3ZQL A;  4UUS B;  3A02 A;  5M5X J;  4XRM A;  3B6C A;  4BBS J;  3SFI A;  5M5Y J;  4NN1 A;  2GM4 A;  4M3F A;  4GCK A;  2IBD A;  5CXG A;  4A3J J;  4JL3 A;  4MFE A;  1JKP C;  3H3V K;  2YVH A;  2Y30 A;  3VIB A;  3KKD A;  5J1Y A;  1ETV A;  4I6Z A;  2MSY A;  5HBU A;  1WPK A;  4AC0 A;  3BG5 A;  1HDD C;  1AKH B;  5C3E J;  3VVZ A;  1NTC A;  2DA2 A;  3MNL A;  2JA7 J;  1GVD A;  2DA1 A;  2OPT A;  3VOX A;  2ZOY A;  5IPA A;  3VPR A;  3TW7 A; 
#chains in the Genus database with same CATH topology
 2K9S A;  2YX4 A;  3PUB A;  4D9J A;  4RGU A;  3ZQF A;  5K1Y A;  2Z2S B;  2BGC A;  3KPH A;  2WV0 A;  1IN6 A;  3LOC A;  1POG A;  4PJJ A;  2E1M C;  3S3N A;  2F5D A;  3MWM A;  4Q48 A;  3FMR A;  4P9U A;  2DMN A;  2VJ5 A;  2V1N A;  3ZMD A;  3CDL A;  3BY6 A;  4IXA A;  3T8R A;  1QVU A;  1R71 A;  2D5V A;  1IF1 A;  4KN7 X;  3HXL A;  3H3Z A;  3LSK A;  4ZZL A;  3QU6 A;  4XL9 A;  2NNN A;  2BXZ A;  5JR3 A;  1FEX A;  3BZ6 A;  2W25 A;  3HSF A;  3CCV I;  2K5C A;  2UXU A;  3G4S I;  2HQN A;  2K7L A;  5TRD A;  4WXH A;  2X85 A;  5BS6 A;  2XGX A;  2IA1 A;  1OQY A;  1B4A A;  1GT0 C;  2CO5 A;  3RJP A;  2FA5 A;  4L62 A;  2JN6 A;  2L0K A;  3OYC A;  3W6V A;  1J2X A;  2L9N A;  1DQU A;  1IXC A;  5B5E C;  2MC4 A;  3ISP A;  4AF5 A;  2OTL I;  3M07 A;  2DOD A;  4NHJ A;  5B66 C;  3AKZ A;  4FCY A;  2FML A;  2L2O A;  5LRS A;  3WTV C;  4C30 A;  2NXN B;  1RC9 A;  1ULY A;  2M7B A;  1FTZ A;  3K6G A;  3K4J A;  2EIL H;  1MIJ A;  1BJZ A;  3BR0 A;  4UNO A;  2P0W A;  3DU6 A;  1YX5 A;  1T6S A;  2BHZ A;  3LA3 A;  2DMU A;  4PUS A;  4UUV A;  2JUC A;  5IP6 A;  4PSX A;  3K1M A;  1R1V A;  1EH7 A;  4X0G A;  1VQM I;  3QP6 A;  4ZTF A;  3KLO A;  2X48 A;  4JX5 A;  2A05 A;  2DG8 A;  4RM3 A;  3F0C A;  3OIQ A;  3S8P A;  3PO2 J;  2R5Z B;  2XAG A;  3E5Q A;  1STZ A;  3DLL F;  3CJR B;  1DPU A;  1BC8 C;  4B43 A;  5FRM A;  1W1W E;  3K4L A;  3KZ9 A;  2OD5 A;  3I4M J;  2ZME C;  3C2G A;  5DUI A;  2F5C A;  3LHQ A;  3MD2 A;  2R7X A;  4BJ5 C;  4C9Y A;  5D6E A;  2V79 A;  1WJC A;  1QRY A;  1Z6R A;  2XGD A;  2EFN A;  4XLN F;  3EUH A;  1ODD A;  2Z16 A;  4AIH A;  2M5W A;  3SDG A;  4AWX B;  3PAS A;  2XV4 S;  1CF7 A;  3F9K A;  2QCO A;  2A5W A;  2M34 A;  2W1O A;  2XHK A;  4KIF A;  2BY3 A;  1V5F A;  4Q47 A;  4RB3 C;  2HTJ A;  2DA5 A;  4M72 A;  3HKZ A;  5EYR A;  3CJD A;  1WH5 A;  3CJQ B;  2RQP A;  4H0E A;  2IP2 A;  4GFB A;  4U9N A;  2G7L A;  6PAX A;  2W85 A;  3WTU C;  4LIV A;  4ZZD A;  1HCR A;  1TL8 A;  4F3Q A;  4ENK A;  1JHF A;  4J19 A;  2ECB A;  1B1B A;  3BZK A;  2M4G A;  5A2Q Z;  2R7U A;  1MND A;  3VYS B;  3CDI A;  2AHQ A;  4BE0 A;  4NC7 A;  1G4D A;  3L2R A;  1SFK A;  1S5L C;  5H9T A;  4XOR A;  4IQJ A;  3A1Y A;  3COL A;  1O3S A;  1ZN2 A;  1YO5 C;  4BNC A;  3N05 A;  2ELK A;  1EH8 A;  2IGN A;  3VVY A;  3EQL F;  4CO8 A;  3OYG A;  3GTJ J;  1F9N A;  3OWT A;  2X51 A;  2XB5 A;  1IZ1 A;  1F1Z A;  3DPL C;  3JRI A;  4A0Y A;  2M1B A;  5DYM A;  3JTH A;  3LWF A;  2QLZ A;  4KIB A;  1NH3 A;  3A4C A;  2QSG X;  2DJN A;  4RGS A;  3ZQI A;  3WGG A;  2Z99 A;  3RZO J;  4JX6 A;  3BR5 A;  1LFB A;  2DK5 A;  4G6D A;  4V2G A;  4M9X A;  4LB6 B;  2HXO A;  2QGU A;  4HNT A;  2EV6 A;  1YJ9 I;  4UDS A;  2O9L A;  3CCL I;  1DU0 A;  3FX3 A;  2CV1 A;  3H0G J;  4DBR A;  2M9H A;  3E7L A;  2H8R A;  3TBI A;  1Y8Q B;  1AHD P;  2WUI A;  2DFF A;  2LYC A;  1ZLK A;  1TWH J;  4EJO A;  2L01 A;  2X4H A;  3H36 A;  2XPU A;  5M5W J;  2HXI A;  3ABK H;  2M7A A;  3LQQ A;  2K9Q A;  2ZY9 A;  1P4X A;  3WTY C;  4ME9 A;  3VW0 A;  3BR6 A;  4IO9 F;  1S29 A;  1IXS B;  3T1B A;  3CDH A;  5EEG A;  3GFL A;  2QZ8 A;  1H88 C;  2WB1 N;  5K7H A;  3FXQ A;  3K1N A;  4PJL A;  1V5G A;  1LVK A;  2Y0S N;  3VEP A;  2ID6 A;  3W2W A;  1X2N A;  4Y33 A;  5LHG A;  1BI3 A;  4E7Z A;  2QBY A;  2KLO A;  5LHH A;  4PGH A;  1BIB A;  1UJ8 A;  2G9W A;  2PG4 A;  2HNH A;  4XNF A;  1LPQ A;  3B81 A;  1EF4 A;  3IUV A;  1QZY A;  4BJ6 C;  1HLV A;  1HW5 A;  2UV1 A;  1U78 A;  3WU1 B;  3HSR A;  5J1U A;  3NQO A;  2GIZ A;  3BHQ A;  4HF1 A;  2D1V A;  1FIA A;  2VPR A;  1MJA A;  3MCZ A;  1RUN A;  3BOQ A;  5HNH A;  1IDY A;  4Z6Y A;  1YRN B;  1JE8 A;  4FE4 A;  1Z0X A;  1Z3Y A;  4EJV A;  1VFC A;  3RI4 A;  4IF4 A;  3IKV A;  4ZDP A;  1MDM B;  2CW0 F;  3LL7 A;  4B44 A;  2KIS A;  3RIR A;  4R79 A;  1F36 A;  4IOC F;  4KIG A;  4Z2Y A;  5D4R A;  4A3I J;  4A0X A;  1GXQ A;  1ZEL A;  5LRR A;  3G3Z A;  3G6E I;  1Y56 A;  2ACJ A;  5J3L A;  4C3J J;  3P9C A;  4D5F A;  2MC3 A;  3UNG C;  3S14 J;  3J80 Z;  3QOD A;  1S9H A;  2MLK A;  4UB8 C;  5C4X J;  4W1U A;  2KRH A;  1PJR A;  2UXP A;  1UHM A;  4Y4R A;  4HOB A;  4OIN F;  5FKK A;  4BY1 J;  2HWV A;  4DGW B;  2BVL A;  2HDD A;  2QBY B;  2E60 A;  1P7I A;  3AG4 H;  4ZYH A;  2PJR B;  2M0C A;  1K4S A;  2N8G A;  3ULQ B;  2JVH A;  5CVJ A;  3S1R J;  1O3T A;  4LLG F;  4KN4 X;  3R0A A;  4UV9 A;  1ENH A;  4IKF A;  2HZD A;  4X6A J;  2XAF A;  2F5F A;  3C18 A;  2L9S A;  3AQT A;  3BZC A;  2DYR H;  2HI3 A;  3T0Y A;  2QTQ A;  2EJR A;  1R5G A;  3BCB A;  2IRF G;  3VYU B;  5GPA A;  4ANJ A;  2EFW A;  3A01 B;  3LSG A;  1BBY A;  4CYC A;  3FXU A;  1P92 A;  1O4X A;  1KQ9 A;  2DT7 B;  1ZTR A;  3IUO A;  4R1H A;  2DOF A;  3JRC A;  4U9L A;  1A6I A;  3NAU A;  2GXG A;  1B8I A;  4BQQ A;  2UWM A;  2FNP A;  3ZN0 A;  4YRV A;  2WAQ N;  5LLQ A;  2BYV E;  2XPV A;  1UFM A;  2Y9Y A;  4G7Z F;  3JRE A;  1UCR A;  5E8G A;  3S16 J;  2ZC2 A;  2GBY A;  2XSJ C;  1SD4 A;  2VT2 A;  3FBN B;  2VQC A;  3QYB A;  5BQT A;  2M3A A;  1XX5 A;  1YG2 A;  2JA2 A;  2JPC A;  2D45 A;  9ANT A;  3BCG A;  3ESW B;  4FET A;  1R5I D;  2OQR A;  4JP0 A;  2JQ7 A;  3R60 A;  3C07 A;  2B7E A;  1ONV A;  3CUQ C;  4A3E J;  2OZU A;  1OLT A;  2I5U A;  4EV0 A;  1JJ6 C;  3CQZ J;  1HKT A;  4M3D A;  1X3U A;  4P1W A;  2XB0 X;  1K61 A;  2E1N A;  1XGM A;  2GQQ A;  3LQR A;  3S3O A;  2VKE A;  2XF5 A;  1EKE A;  2FOW A;  2EV5 A;  4PSW A;  1D5V A;  1UI6 A;  1WJA A;  2ZXW H;  2HQA A;  1JKR C;  2P81 A;  1FP1 D;  1FIP A;  1R58 A;  1RZ4 A;  5LGN A;  4CHU A;  3FBI B;  1ZGJ A;  2FNA A;  3B02 A;  1D1A A;  4Y13 A;  4ICH A;  3F1B A;  1YIO A;  3OYH A;  5F1J A;  1TWC J;  3HC7 A;  5C4Y A;  5EJC A;  2YS9 A;  4FE7 A;  4CUG A;  2HYT A;  5HS9 A;  2X6X A;  4JOM A;  2PEX A;  2CGP A;  1IJW C;  5BMZ A;  1XS9 A;  2HGC A;  4ESB A;  2JA6 J;  1IDZ A;  3EDP A;  2O7O A;  3J7A O;  5D5X B;  3HGY A;  3BG9 A;  3KYL A;  4XM3 A;  3ZQ7 A;  2E71 A;  2Y48 A;  3LAP A;  3HL2 A;  1GLN A;  1YFH A;  2LH9 A;  4A3B J;  2XPW A;  3DBR B;  4MFD A;  2W7N A;  3DPJ A;  4G6T B;  3CP2 A;  3KZY A;  1I39 A;  3RKW A;  3SZG A;  2EIJ H;  4RB2 C;  3FHZ A;  2ZKZ A;  1WSU A;  2AS5 F;  5ILV A;  4XQF A;  1ETK A;  1R5H A;  3C2B A;  1FOY A;  3AAF A;  3J7Z I;  3KZZ A;  3FMS A;  5IT9 K;  3KET A;  1G3W A;  4OOI A;  2G7G A;  2EZI A;  3NNR A;  1OYI A;  5AQC A;  1JT6 A;  2ME6 A;  4DNC A;  3NAR A;  3H5R A;  4E7K A;  2RDP A;  3GUD A;  3SDB A;  2PBI A;  2VQL A;  4A3K J;  1NK3 P;  5DCF A;  4OMY A;  4EJU A;  2CV2 A;  4KUM A;  3NS4 A;  1GV2 A;  4HF0 A;  3CMM A;  4PDK A;  5E20 A;  4NQW A;  3HUG B;  4BY7 J;  2H1K A;  4UY8 I;  2VBX A;  3H5A A;  5DEQ A;  4A3G J;  4ABZ A;  1P2F A;  1B6A A;  2EIK H;  4LG3 A;  3F22 A;  2Q0O A;  2FUG 2;  2PJP A;  2BY0 A;  4QWQ A;  4GCV A;  1PDN C;  4BBS J;  5M5Y J;  1IW7 F;  1R6R A;  4N9H A;  1UAA A;  4NN1 A;  5B3S H;  2YX7 A;  2VKD A;  4GCK A;  2IBD A;  3LA2 A;  2ESH A;  4E7J A;  5CXG A;  1D0Y A;  2ISY A;  4WF2 A;  2DQL A;  1L0O C;  2FMY A;  4MFE A;  1JKP C;  4HLY A;  3SZP A;  3H3V K;  4G9Y A;  2Y30 A;  3VIB A;  1UZC A;  3OR1 C;  4ASN A;  3KKD A;  5HBU A;  2MSY A;  1WPK A;  2XKO A;  2P4W A;  4AC0 A;  2DXI A;  2Z9O A;  3BG5 A;  4CCN A;  4EQQ A;  3ZMZ A;  1N25 A;  5HLI A;  4BDZ A;  4LB5 A;  3CCQ I;  1NTC A;  1E17 A;  2GXB A;  2QWW A;  1GVD A;  2ZBK A;  1QNT A;  2DA1 A;  3F23 A;  3VOX A;  4KNY A;  1FPQ A;  1XDS A;  2W24 A;  2NRA C;  3Q3S A;  2X9D A;  3GO5 A;  4G12 A;  4AU7 A;  1YJN I;  1M1E B;  2V9K A;  2NOG A;  3FKJ A;  4S05 A;  4CGR A;  1VTN C;  2MYS A;  5CKT A;  2XRO A;  3DBL B;  3OOP A;  2VXD A;  4L18 B;  1X4P A;  2EA2 A;  2JZY A;  3I58 A;  2K4J A;  4PK4 A;  3WOD F;  4CDG A;  4BQO A;  1YHQ I;  1YQA A;  5CVI A;  1ZH5 A;  2E1O A;  3LNQ A;  3DKY A;  4PFP A;  1IUY A;  4PXI A;  3HG9 A;  2NP5 A;  3PSI A;  2DDB A;  4YFX F;  4OD5 A;  2KIM A;  3F8C A;  1RKT A;  1TQM A;  4M71 A;  4A2U A;  3ONQ A;  1MJB A;  4CCK A;  4XRS G;  3B73 A;  2XAS A;  3GF2 A;  3HRM A;  3F72 A;  4L0Z B;  1U3E M;  1BL0 A;  4UUT A;  1YS7 A;  2CG4 A;  2LDU A;  3PL8 A;  3VDX A;  1NK2 P;  1GHC A;  1ERD A;  2UXX A;  3KP4 A;  2Y31 A;  4RAY A;  3O60 A;  5EF6 A;  3E0J B;  3V42 A;  2Q8K A;  2HOA A;  2R93 J;  1ETW A;  1SD5 A;  2X1E A;  3FRQ A;  5FD5 A;  1R4N B;  2WAE A;  2BZT A;  4XKC A;  3O8H A;  1HSJ A;  3TMO A;  2A61 A;  2ZXI A;  4ZDL A;  5JVG F;  5DCM A;  2RN7 A;  1Y8R B;  3HTI A;  3WG7 H;  2O7T A;  4QPQ A;  3GFJ A;  1G8X A;  4XLH A;  2P5K A;  4E7L A;  4ENJ A;  3U2R A;  3FXJ A;  3MZY A;  2Y0S A;  4II3 A;  1U2W A;  3ZRG A;  1I50 J;  2C6Y A;  3AG1 H;  3MZ8 A;  3M3Y J;  3WHC A;  4N4N B;  3VP5 A;  1WH7 A;  1MSF C;  2AO9 A;  2O0Y A;  1TWA J;  1T8I A;  2K3P A;  1DP3 A;  2V4J C;  3GLX A;  1HOM A;  3RKY A;  3HHH A;  4OIQ F;  5K7F A;  5D4S A;  4NQW B;  2W53 A;  2DT5 A;  5DAJ A;  1K78 A;  1HST A;  4ZH4 F;  1V3F A;  4XBF A;  1JI8 A;  1F43 A;  2A6E F;  2R7W A;  2BXY A;  3TOB A;  1R23 A;  4ZYA A;  2MD0 A;  5IY5 H;  1D0Z A;  4MHG A;  5L3C A;  1OFC X;  1T2K A;  2VQG A;  2XC7 A;  2R7V A;  1CF7 B;  1MMN A;  3O2P E;  5GAH J;  1S3J A;  3GEU A;  1MBH A;  1SVO A;  1HQC A;  1K79 A;  3W6K B;  3OS0 A;  2VOP A;  4BHC A;  1ZK8 A;  5HOD A;  1JJ8 C;  4JBA A;  3CO6 C;  5F64 A;  1BI1 A;  1OMI A;  1J5Y A;  2V9P A;  1XTA A;  1JKQ C;  4LK0 F;  4HEA 2;  4ZC3 A;  2EB7 A;  2G7S A;  2HOE A;  1X1B A;  5E1W A;  3E97 A;  3DWL E;  1A35 A;  2HVS A;  4KMF A;  2WY7 Q;  4KIT B;  2OZ6 A;  2NS7 A;  2XRN A;  2V6C A;  4XOP A;  1G2H A;  3DLA A;  3Q9S A;  2MGQ A;  1OCO H;  3ZQH A;  2YR2 A;  5D5U B;  3GFM A;  2FQ4 A;  1ZRF A;  2XAH A;  4XLA A;  2D6Y A;  1IRG A;  3ML6 A;  5DD4 A;  3W2V A;  2LBF B;  2K4B A;  4R8H A;  4WK8 F;  3GXO A;  3J80 K;  3LSI A;  3CME I;  4BYY A;  4F93 B;  4XKV A;  4EJT A;  2QQB A;  1R7J A;  3L2U A;  2A5Y B;  2K3F A;  4A5N A;  4DQ2 A;  4CZC A;  3PIO F;  1OR7 C;  3HHG A;  2K9L A;  5J6X A;  3FXO A;  2HYG D;  3F6O A;  4BKX A;  1LFU P;  2XSD C;  3M8E A;  1QGP A;  5FGL A;  3TOA A;  5TJJ A;  4NBQ A;  5CYV A;  2GUH A;  1I5Z A;  3DCF A;  1WI3 A;  3KP7 A;  3HTS B;  4RAG A;  3IH4 A;  1YOV B;  4KDP A;  3JSJ A;  3FIS A;  2OI8 A;  4LIT A;  3TO6 A;  3WTS C;  1SFO J;  3F3X A;  2FBQ A;  3W2A A;  2ZOZ A;  5HAW A;  1EV7 A;  2KT0 A;  4YFN F;  1XSV A;  2PN6 A;  5DDG A;  2JA8 J;  5CW8 A;  2VLA A;  2BEO A;  3D5R C;  1G3T A;  2CMP A;  3V7S A;  2DTZ A;  2VBY A;  3TW6 A;  4P96 A;  3V7R A;  1KYZ A;  5LGT A;  3ON2 A;  3FXR A;  4IHX A;  3KP2 A;  5E17 F;  1TTY A;  1Z77 A;  3EUH C;  4HLX A;  3JSP A;  1LEA A;  5J1R A;  5F08 A;  3DU5 A;  4ZDO A;  2NYX A;  4OMZ A;  3EYY A;  3D5L A;  4A3F J;  1U8B A;  2LY9 A;  3ANG A;  4BXX J;  4D7M A;  2L02 A;  3K4B A;  1KQ8 A;  5D18 A;  4IQ4 A;  1S7E A;  3T6N A;  4GGG A;  2XDN A;  5H2F C;  5A2Q K;  4AM3 A;  1I1G A;  2EZH A;  3QPL A;  5BOX A;  4KWA A;  1BW5 A;  3GX4 X;  1OCT C;  1FT9 A;  4HPQ A;  1ZR4 A;  2W48 A;  2EH3 A;  3OYA A;  3FWE A;  5KAF C;  2XRL A;  4I02 A;  2R92 J;  3JCU C;  3WTZ A;  3HJE A;  1G59 A;  3E5U A;  4RDU A;  2KMU A;  4WWC A;  1H8A C;  3EUK L;  3CF2 A;  1TWF J;  3VW2 A;  4A6D A;  2JA5 J;  3HRU A;  3J81 Z;  3CF5 F;  1I3Q J;  3QYF A;  3QPS A;  1XGO A;  3V8L A;  5LEK A;  1KU3 A;  1ZYR F;  3VTI A;  4AYB N;  4IVN A;  5EEH A;  3U21 A;  3RDI A;  2RRE A;  3ABM H;  3DTK A;  3JAM K;  1WKM A;  3WG9 A;  2HDC A;  4A93 J;  2IS2 A;  2VJI A;  5D19 A;  2OJE D;  5L3E A;  4HX8 A;  3K70 C;  1J0R A;  2CWE A;  1ZRD A;  1MH3 A;  5AIQ A;  2NS0 A;  4RM2 A;  2FEZ A;  2H6B A;  5F0F A;  1PVE A;  3BT9 A;  3Q0U A;  4KIS A;  1T0F A;  2KKO A;  3B6A A;  2BE5 F;  3GEZ A;  1LDK B;  2W4S A;  2LFB A;  4O3M A;  4XN3 A;  2CYY A;  5L3G A;  4KIC A;  2B9S A;  4MK6 A;  3S2W A;  2OU2 A;  4QLC U;  3MZH A;  1PUE E;  4ZYG A;  2X6Y A;  5HS8 A;  3ZN1 A;  1X1A A;  1BM9 A;  3SJM A;  1IUF A;  2LY2 A;  3CD6 I;  1V54 H;  2L9R A;  2YVE A;  1K6O A;  2LF8 A;  3RKQ A;  2JWT A;  3RQ4 A;  2RAE A;  2CQK A;  5HS7 A;  2ICW G;  3I71 A;  5HDG A;  2YU9 J;  2MW8 A;  1FYL A;  1T33 A;  3FZV A;  4HDU A;  3VSL A;  1GVJ A;  2OC6 A;  2ZNZ A;  4AD9 A;  3RSN A;  2QQ8 A;  1BC7 C;  1TQI A;  3I56 I;  4A12 A;  4CYC B;  2H1L A;  4EJW A;  2E19 A;  4XK4 A;  1AWC A;  1XSD A;  3ERM A;  4W97 A;  1MNE A;  4LG0 B;  1USS A;  1QVT A;  2QM3 A;  2E36 A;  1OCP A;  2VT3 A;  2XAJ A;  1GV5 A;  5E3O A;  3P9T A;  2ZCM A;  3QAH A;  2Q2E A;  3ANP A;  3MMY B;  1LJ9 A;  4HG2 A;  3G73 A;  4EVI A;  1FOK A;  1SFE A;  1I27 A;  4OAZ A;  3HGG A;  3IC7 A;  2CJJ A;  3KFW X;  2ETH A;  3F21 A;  3CMY A;  1X19 A;  3LMM A;  2QQA A;  4Y3O A;  2LSO A;  2WA0 A;  2R7S A;  2QQ9 A;  2NX4 A;  2Y0M A;  2EV0 A;  1A31 A;  4CCM A;  3M8J A;  1AU7 A;  3GTM J;  5K58 A;  1T98 A;  1R00 A;  2MAB A;  3HPH A;  4XKW A;  4GYI A;  4HA8 A;  5HSZ A;  5ICF A;  1S8N A;  5GPC A;  1K4T A;  4IRG A;  4EMS A;  3FF5 A;  1ZAO A;  4P9F A;  2K86 A;  3BC8 A;  3BP8 A;  1HKS A;  2VI6 A;  2B3W A;  3OSF A;  1KA8 A;  2DJI A;  2F4M B;  2V9V A;  3V4G A;  3QPH A;  5K5R A;  1C0W A;  4I0B A;  1IRZ A;  2E35 A;  2QVO A;  3K69 A;  1FBQ A;  2ID3 A;  3BG3 A;  2F4I A;  3OL3 A;  3I59 B;  3K4N A;  2WAF A;  2MG4 A;  1RI7 A;  3GTL J;  4DIQ A;  4H4K C;  2KP6 A;  2KDO A;  2RKH A;  1TNT A;  3M1E A;  1Z7U A;  2BVM A;  1RNL A;  1SC7 A;  3LWJ A;  2V1X A;  2Y9Z A;  5CLS A;  2FU4 A;  3OYK A;  2UXI A;  3BRU A;  4Y7N J;  3ZMV A;  1ETX A;  4J01 A;  1PP7 U;  1BJA A;  5CVR A;  1W36 D;  4D1Q A;  1IO2 A;  2MH2 A;  1QHG A;  5F1R A;  3WGH A;  3CCU I;  3IH3 A;  5CQG A;  1YI2 I;  2E2H J;  3LA7 A;  1NHA A;  4ESF A;  3WU0 A;  2CSO A;  3PNT A;  3IRR A;  1K78 B;  1Z7L A;  4BBR J;  3LSH A;  4Q5S F;  2DLL A;  3HDD A;  1Y0U A;  4BE2 A;  3E1S A;  5HNF A;  1YYV A;  4DYQ A;  1YW9 A;  4LMY A;  2Q24 A;  3TO9 A;  1P4A A;  3CUQ B;  1K83 J;  3LJL A;  3MKL A;  3AL0 B;  1FY7 A;  1J75 A;  3RTR A;  3HIF A;  3C3W A;  2ME0 A;  3M8F A;  4BH9 A;  4BE1 A;  1P7J A;  4U88 A;  3RPU A;  4WX9 A;  3NEU A;  1D8K A;  3V78 A;  3KE2 A;  3I4P A;  4JNN A;  1ETQ A;  4XIC A;  3K7A J;  2LKX A;  4HYE A;  5EGO A;  3CLO A;  3KYD B;  2A6T A;  3GZN B;  4B48 A;  5BPD A;  5DS9 A;  2MH9 A;  1CQT A;  2EPF A;  5K7Z A;  2CUF A;  3LFU A;  4EAT A;  3MQ0 A;  5HOO A;  3PUF A;  3QU3 A;  4OIO F;  2A6H F;  4JQF A;  4F52 A;  2UXN A;  4BXU A;  1W36 C;  1SMT A;  5BPI A;  1FYM A;  2BBY A;  2YSR A;  3GZ6 A;  3MKY B;  3DPT A;  3L7W A;  4C3H J;  1ETO A;  5B1B H;  4S0H B;  4BGD A;  5ICC A;  4UUS B;  4Q4Z F;  2GIV A;  3SFI A;  5JI6 A;  3KP3 A;  2HR3 A;  1IRX A;  3EPZ A;  2HS5 A;  2CUJ A;  2Q1Z B;  2RC4 A;  1CGP A;  5KAI C;  3X2Q H;  3I53 A;  2WAD A;  2E34 A;  1W7P B;  4LFU A;  1MW7 A;  2XIG A;  5FGM A;  1H0M A;  4WCG A;  1AKH B;  5C3E J;  2DA2 A;  2QKL B;  4RAF A;  5DV5 A;  1NG7 A;  2KZG A;  1AA7 A;  4ZYE A;  5IPA A;  3VPR A;  3TW7 A;  4B47 A;  3ABL H;  1BR1 A;  3T8T A;  1U5T B;  4BU2 A;  3BG6 A;  2WV1 A;  2J5P A;  4IRH A;  3MVP A;  3ZPL A;  2FE3 A;  2F5V A;  4DYR A;  2FRH A;  2PMZ A;  2QWT A;  3SWH A;  2QIB A;  5B1A H;  2GA2 A;  4F92 B;  1QPI A;  1R1U A;  4K2E A;  3KZI C;  2EFQ A;  4LJZ F;  4YEJ A;  3CCM I;  4C2U A;  1N75 A;  1W5S A;  3Q9V A;  3A2K A;  2OBP A;  2XAQ A;  4JX4 A;  3QQA A;  5E8I A;  2LF7 A;  3HKZ N;  2ZJQ F;  2LKS A;  2XVC A;  1DP7 P;  4KJZ A;  4UUS A;  1N77 A;  3G2B A;  4XON A;  1P6R A;  2ZXH A;  1BOB A;  3WTT C;  1RIO H;  1TWG J;  2M45 A;  3H35 A;  3J81 K;  4XLE A;  1VQ4 I;  4A3D J;  1KQ0 A;  3MAJ A;  4L5E A;  4NC8 A;  2V7F A;  3DEU A;  1ORK A;  1OKR A;  3QBM A;  2ZXJ A;  5DUK A;  1A5J A;  1E3H A;  2FOK A;  4TV7 A;  4BQA A;  2ZFW A;  2A2F X;  3MKZ A;  5CVU A;  1YJW I;  4YZE A;  1JUP A;  2QUF A;  4NDL A;  3UKG A;  4UVA A;  2AXL A;  2DMT A;  5JFR A;  1X2M A;  4MO7 A;  1D5Y A;  2NNY A;  2ESN A;  3JRH A;  2JPB A;  3KCC A;  4A69 C;  3DPU A;  2ZCW A;  2R5Y A;  1ZAR A;  4G94 A;  4F55 A;  1LNW A;  4I01 A;  5FLM J;  3BJO A;  4ACI A;  1VQ7 I;  2VQH A;  5FJ8 J;  3C1D A;  1MZB A;  2R7O A;  1MBK A;  3LST A;  3QOP A;  2ZO4 A;  5FKM A;  2IPQ X;  3ZQG A;  3OYE A;  1H9T A;  4MNU A;  1Q1V A;  1R9T J;  2WBM A;  3RPU D;  3ZR8 X;  3V6G A;  3O6B B;  2CRG A;  4IHT A;  1JT0 A;  3S32 A;  3OV8 A;  2P8T A;  2M30 A;  3DTE A;  3I9V 2;  3REO A;  3VUQ A;  5H20 A;  1FTT A;  4G8X A;  2TDX A;  2F4O B;  4M9S A;  1HW2 A;  3M4O J;  1PUF B;  2V57 A;  1IRF A;  3VVX A;  3OIO A;  2F5E A;  1JUM A;  1RPW A;  2PQ8 A;  2JMW A;  2KZV A;  3L2W A;  3LSJ A;  1R4M B;  3F6V A;  4DZP A;  2VL8 A;  4P5O A;  1MJ9 A;  5HVQ C;  2LTP A;  3ECO A;  4EGZ A;  3IWF A;  4IHY A;  1YW7 A;  3VWB A;  1R1T A;  3CJT B;  2H09 A;  1E0E A;  1MMG A;  1Z05 A;  3TGN A;  2VKH A;  1F4K A;  1JTY A;  1JTX A;  3P7N A;  3C7J A;  4PCQ A;  4YIR X;  2QF7 A;  1HXD A;  1MSE C;  3GVA A;  3HEF A;  4ZYD A;  2IGK A;  3BQY A;  5E1X A;  3IKT A;  2KFD A;  3KLN A;  1E3P A;  2XUB A;  3JAM Z;  5EZG A;  4RB0 A;  2EQR A;  3QWL A;  2ISZ A;  2NOJ B;  3ZCO A;  2PBX A;  3DEE A;  3K4M A;  2K02 A;  2HTS A;  2HZT A;  1FC3 A;  3FXM A;  4JKZ A;  3GYH X;  2G7H A;  1Z21 A;  2JTV A;  2CFO A;  1Z67 A;  5D5W B;  3L2Q A;  3SEQ A;  3ROU A;  1FMV A;  1QU3 A;  2YVX A;  3DF8 A;  3K8P C;  1LUJ B;  1MKM A;  1SFX A;  1XMA A;  5CJ9 A;  2JRM A;  3OMY A;  1LKX A;  3DKW A;  5L3F A;  4QTR A;  2ZME A;  3JRD A;  3T5X A;  1IAW A;  1U8R A;  1ZQ3 P;  4HDV A;  1D3Y A;  1U9O A;  2PMH A;  2LMD A;  2OUM A;  3DP7 A;  2GA1 A;  4IRI A;  3KIO A;  5EFY A;  4KYW A;  3PFI A;  2ZCX A;  1IXR C;  2VC0 A;  3G7R A;  4GFL A;  3GCM A;  2COM A;  3TKY A;  3GZ5 A;  4N9I A;  4O6J A;  2EK5 A;  1QZZ A;  4HBL A;  1S7O A;  2CUE A;  4RB1 A;  1EA3 A;  1S72 I;  2E2I J;  3ELK A;  4O5V A;  2Z3Y A;  1JUS A;  2R7F A;  3HIM A;  1WRJ A;  2E5N A;  2LRE A;  3R6S A;  3S2H J;  4HX7 A;  3WTW C;  2HKO A;  2WB1 A;  2PZ9 A;  2DYS H;  5FFZ A;  5FD6 A;  2E5Z A;  3HOT A;  3FK7 A;  3K4C A;  4M9Z A;  1XMK A;  2WAQ A;  4DW6 A;  1GDT A;  2VE8 A;  3JW4 A;  2BV6 A;  3RCO A;  4IJA A;  2LLK A;  4GCL A;  3HE0 A;  3BQZ A;  1MMA A;  2J5O A;  3F8M A;  4OIR F;  2I8D A;  2OER A;  2QKO A;  2RV8 A;  1AOY A;  3OIP A;  3CC4 I;  3DQV C;  4GDF A;  3OOU A;  5D1R A;  1X4O A;  2R7D A;  3SYT A;  3S1Q J;  2L5Q A;  4BQN A;  4XN0 A;  1O3R A;  4L0Y B;  1MDM A;  2X0L A;  1APL C;  2WWY A;  2FX0 A;  3HZJ A;  3BR2 A;  3OR2 C;  4OU0 A;  2DFI A;  3DKX A;  5IOY A;  4PJN A;  2L9V A;  5FRO A;  3NRG A;  4IHV A;  2O8K A;  5FRN A;  5ERI A;  2DI3 A;  1SVM A;  2Y69 H;  4IL6 C;  3SFZ A;  3WU2 C;  3HTJ A;  4D5C A;  5HLH A;  4CH7 A;  1I6X A;  4LOC A;  3GFI A;  3HOV J;  3S2D J;  4CCO A;  1IC8 A;  2IXS A;  2DCE A;  3VFZ A;  1Z91 A;  4I98 B;  1G3S A;  3CUQ A;  3D0S A;  2HEO A;  2V1D A;  3HOY J;  3E6C C;  4YG2 F;  2HYJ A;  1IN4 A;  1V55 H;  3I5U A;  2COB A;  1VQ5 I;  2M8G X;  3K4K A;  4MTE A;  3QYE A;  3K9T A;  2G3B A;  4N4O B;  2E1M B;  3K2Z A;  1FSE A;  4MEY F;  2CQX A;  1Y6I A;  2DTR A;  1U9N A;  4FIS A;  4HQM A;  2H27 A;  2RGV A;  3U9G A;  3O8G A;  3VB2 A;  1O3Q A;  2HPI A;  2KJC A;  5M3M J;  1BR4 A;  5EG0 A;  3EUA A;  3HRT A;  5J8F A;  3GME A;  4CZZ A;  3JRA A;  2IEK A;  2QSH X;  1RUO A;  2VJJ A;  4XKB A;  4A3M J;  1UST A;  2ZSH B;  2OCC H;  4HW0 A;  2L7Z A;  3U1D A;  4IPA A;  2E1C A;  4CSW A;  3ON4 A;  1P9Q C;  1SMY F;  4U7D A;  4QPO A;  1UHW A;  3ZP5 A;  2B63 J;  3GZI A;  1YE9 A;  3I55 I;  3GTQ J;  2KPM A;  2NVU B;  3TQN A;  3SHF A;  1FZP B;  4XRS A;  4BUP A;  1LFP A;  4DZJ A;  3FXL A;  3OSG A;  3F8B A;  4XLP F;  1LEB A;  2LR8 A;  2IAI A;  3M7G A;  2ZJP F;  1V4R A;  4CIC A;  3EET A;  2Z1D A;  1VQL I;  4MLO A;  1GUU A;  3BWG A;  2PFV A;  2JVG A;  2GZW A;  2PI0 A;  3HB9 A;  4HNU A;  3HTH A;  5L3D A;  3DV8 A;  3PM1 A;  1AKH A;  2MLG A;  3SEZ A;  3CCR I;  3PPB A;  3DTI A;  4I09 A;  2Y2Z A;  3O3K A;  3R4K A;  4RS8 A;  4UVB A;  3JRF A;  1B72 A;  2DFH A;  1U5T A;  3H92 A;  4QIW N;  1ZG5 A;  1HF0 A;  1XDU A;  3A03 A;  2IT0 A;  3BJA A;  4RA2 A;  3S15 J;  2WGB A;  3GW2 A;  4AVZ A;  1OIS A;  1DPR A;  1UB9 A;  4UVC A;  5F6F A;  5GAD J;  1Y1W J;  2A07 F;  2TCT A;  2EWN A;  4LG0 A;  3CCY A;  4FQG A;  1QA6 A;  3TP0 A;  2R3S A;  5F27 A;  1LDJ A;  1WCM J;  4AYB A;  3CES A;  2P6S A;  2LD5 A;  3PNY A;  2NS8 A;  1B9M A;  4G6Q A;  3IH2 A;  1YTY A;  3NI7 A;  3ZOB A;  1K7A A;  3FDY A;  5IP9 J;  3LSM A;  3A01 A;  4A3L J;  3G1M A;  2BW3 B;  3L2C A;  1D8J A;  1HA8 A;  3QKX A;  2R7Q A;  2XAU A;  5GAE J;  1X1C A;  1Y39 A;  3CRJ A;  2B0L A;  2Z33 A;  3OYL A;  3OYJ A;  1KU9 A;  4IEJ A;  2F07 A;  1SD6 A;  2HYF A;  2HKU A;  2L3D A;  2ZJR F;  3CCJ I;  3S17 J;  5FLV A;  5ICE A;  3BTI A;  2KHM A;  1JGG A;  5J4V A;  4IRV A;  1O7L A;  3G1L A;  5AON A;  2W57 A;  3HOS A;  1ZGA A;  4AIJ A;  3H9Q A;  4DOZ A;  1QO0 D;  5LEJ A;  2CS3 A;  3GBG A;  1Y0N A;  3H9J A;  2NP3 A;  1X1P A;  5LBQ A;  4IOA F;  3GTG J;  1UG0 A;  3CMA I;  3FM3 A;  4AUX A;  1DDN A;  2RNJ A;  3U1K A;  2HPM A;  4M6X A;  1FBS A;  2XGE A;  1OPC A;  2KIQ A;  5DTD A;  1WFX A;  4QSH A;  1U6G A;  2EIN H;  2B1E A;  1OCZ H;  2YUS A;  5DM6 F;  2DQR A;  4E6K G;  5F0H A;  2I10 A;  1RR8 C;  2K85 A;  1D1C A;  2LP0 A;  5E3N A;  3JRB A;  1HW1 A;  3FK6 A;  2W84 A;  4RAZ A;  2RVC A;  2FBH A;  1XCB A;  2AQF A;  2QYO A;  3JR9 A;  3COA C;  4MXM A;  2CW7 A;  4AVP A;  2IU5 A;  2M2E A;  3PNV A;  1TW2 A;  1IN8 A;  5M3F J;  4XLC A;  3E6B A;  1LVA A;  4GXO A;  3TDZ C;  5K5Q A;  2QOP A;  2JK3 A;  2MBF A;  3BR1 A;  2FXA A;  5F0C A;  5CVV A;  2K9N A;  3RZD J;  2R7Z J;  2H6C A;  2Q2E B;  4MEX F;  1LE8 B;  1OR7 A;  2M0M A;  4XR6 A;  3TP3 A;  1NG6 A;  2STW A;  3H1C A;  2KIU A;  1N78 A;  1Z6T A;  4LK1 F;  4HAM A;  1R22 A;  4CYD A;  2FSW A;  3WE3 A;  2KRF A;  3WTX C;  1TT5 B;  4ENN A;  1DUX C;  3S3M A;  1FWZ A;  1OYW A;  1VQK I;  1Y1V J;  4I2O A;  3LFK A;  2LOO A;  4U0V A;  2OV7 A;  5HDN A;  1TW3 A;  1VZ0 A;  3KP6 A;  5H6R A;  2E2J J;  1TQP A;  3Q5F A;  4CXF A;  4BEH A;  5FMP A;  1UMQ A;  4E70 A;  2OAZ A;  3PIP F;  5FB2 A;  1MBG A;  4M3G A;  4XSX F;  5ED4 A;  5IT3 A;  3BLY A;  4ON0 A;  1MD0 A;  2ZFU A;  3EYI A;  2IGO A;  5H6Q A;  2VUM J;  4IZZ A;  2VN2 A;  4MQ9 F;  4AC6 A;  2EZK A;  1B72 B;  2DMP A;  2V6E A;  2YU3 A;  4V19 K;  2RAS A;  3L1P A;  5EGO B;  3W3C A;  3BPX A;  1FBU A;  3QRF F;  3CWR A;  2G0E A;  2ZNY A;  3I54 A;  3AQS A;  4BHB A;  2UXH A;  3K2A A;  1XMX A;  3TO7 A;  3GTO J;  3GTK J;  3EGQ A;  2BHY A;  4F91 B;  4Y17 A;  5LD2 C;  1XD7 A;  2L54 A;  3KX2 A;  2W00 A;  1HBX G;  2QSF X;  3ECH A;  3MKW B;  2GM4 A;  4M3F A;  1KU2 A;  1V5E A;  4KMU X;  2IS1 A;  2JSP A;  2IW5 A;  4A3J J;  5IT9 Z;  5JHU A;  1VQ8 I;  4JL3 A;  2VB6 A;  4A0Z A;  4DJA A;  2YVH A;  2A3S A;  4U0Y A;  4GO1 A;  5E18 F;  1ETV A;  4I6Z A;  2Z5U A;  4PGG A;  1KZH A;  3G71 I;  1WZ2 A;  2O03 A;  3VYR B;  3VVZ A;  2NAZ A;  4E7S A;  1R36 A;  2R7R A;  2DPD A;  2JA7 J;  2ZOY A;  2LNB A;  2DBB A;  4J00 A;  1J09 A;  1FMW A;  2E7X A;  4E7H A;  1LB2 A;  3HUG A;  4WIB A;  4HSR A;  4UHT A;  4FX0 A;  1U5T C;  5JLX A;  4M73 A;  2EFO A;  2CU7 A;  2GAU A;  3TDU C;  1X58 A;  4HST A;  3I64 A;  1D1B A;  2DU9 A;  4YEL A;  4YIF A;  2DO7 A;  2DW4 A;  4MIM A;  3IWZ A;  3GTP J;  2IS4 A;  1YS6 A;  2Y75 A;  3E3V A;  1ZRC A;  3I4N J;  1FLI A;  3PO3 J;  2JSC A;  2KL4 A;  2DPU A;  3HOU J;  2OTJ I;  1FOX A;  5E3L A;  2R4G A;  3IAM 2;  3ABT A;  3HSE A;  4IHW A;  3BTC A;  1WGX A;  1YLF A;  2DA7 A;  2HKX A;  3VYT B;  3DBH B;  1TBX A;  1MBF A;  4DBQ A;  1JXS A;  3VOK A;  3JRG A;  3S1M J;  3KKC A;  3IV5 A;  3IAS 2;  3DXJ F;  3OL4 A;  1W5C C;  2O5R A;  2CV0 A;  3NPI A;  3LSP A;  2R0Q C;  4GCT A;  4M3B A;  1W0U A;  4PZJ A;  1SGM A;  3NRV A;  1I6H J;  2VE9 A;  3VW1 A;  2X1C A;  1LQ1 A;  3L00 A;  3LSR A;  1Z1D A;  1WJ5 A;  3KP5 A;  2KDZ A;  1W0T A;  2VC1 A;  4RGX A;  3CZ6 A;  3ABU A;  4PJM A;  1IN5 A;  5L3B A;  1FX7 A;  1MGT A;  2IJL A;  1H89 C;  2HVR A;  4G7H F;  2TRT A;  2DDA A;  2X6W A;  4UV8 A;  1UHS A;  2LK2 A;  3F8N A;  5IYC J;  4G7O F;  5EDN A;  2F48 A;  5FO5 A;  3OY9 A;  2K9M A;  5D6F A;  1Q1H A;  1IG7 A;  1QBJ A;  2LRD A;  3AG3 H;  3CUO A;  4B4C A;  3FM5 A;  4RMN A;  2HQR A;  3E6M A;  3PSF A;  4BEH B;  1XSX A;  4M74 A;  2VPL A;  4B09 A;  4II2 A;  3CLQ A;  3IHU A;  3OS2 A;  4IHS A;  2IA0 A;  5ICG A;  3I0T A;  4C3I J;  3P9K A;  3OYF A;  2L4A A;  4IX7 A;  2VBW A;  1SAU A;  5K5O A;  2KIF A;  3CJN A;  4LIU A;  1FP2 A;  1QZE A;  4UB6 C;  5KCM A;  4L9T A;  2EFP A;  2O8X A;  4I76 A;  3P9I A;  5IP7 J;  5HLT A;  1MMS A;  1VQO I;  1RKW A;  1J9I A;  2HFH A;  3RQI A;  5J47 A;  1OCR H;  2FJ1 A;  2JRT A;  4OAY A;  1I3A A;  2IS6 A;  3PQJ A;  4GFK A;  5J40 A;  5BNG A;  1XG1 A;  4NUB A;  1SEU A;  3S1N J;  3ASO H;  1JGS A;  3BG7 A;  1PUF A;  3IL2 A;  1UEL B;  2ELJ A;  2XF6 A;  4U7B A;  4MGR A;  2X6O A;  2VOO A;  2RHA A;  1MBE A;  2VXZ A;  4YII A;  1GXP A;  3K1P A;  1JHH A;  2UUZ A;  1VQ6 I;  5FFX A;  3ERE D;  1E2X A;  1MBJ A;  4LGW A;  5FLX Z;  1DU6 A;  2NVQ J;  1BOA A;  2OF7 A;  4LD5 A;  1ON1 A;  1X1D A;  2BOL A;  4BS9 A;  1RES A;  5C44 J;  5FLX K;  2VIX A;  2P7C B;  1WQ2 A;  2EIM H;  3RPQ A;  2M87 A;  2ZCN A;  2DA6 A;  4WXD A;  2D1H A;  5EEA A;  4Y52 J;  3HM5 A;  2KRC A;  3VOD A;  1ZR2 A;  3TED A;  3W6J B;  3IRQ A;  1T39 A;  3PFY A;  1O7F A;  5KVR A;  1VI0 A;  5D8K B;  3HBL A;  2VJ4 A;  2M8E A;  3NWT A;  4XMY A;  4N0B A;  3E6D A;  3ASN H;  1BI2 A;  3RKX A;  2FQ3 A;  4KA4 A;  1X3W B;  2L7M P;  3I59 A;  1TNS A;  4HRI A;  2K27 A;  4EEF G;  2VBZ A;  3FKI J;  1JKO C;  5E3M A;  3L09 A;  1KYW A;  1TC3 C;  1L3L A;  1FSH A;  2PLY A;  2XF7 A;  4YFK F;  2F2E A;  2G7U A;  1Z3X A;  1S6L A;  5J8C A;  3WE2 A;  1PYV A;  1A36 A;  2ZME B;  3FHN A;  4HV5 A;  4LLN A;  3BDD A;  1WJB A;  4U0W A;  4A6E A;  4D0P A;  1WJF A;  3JTG A;  2IVM A;  3KEQ A;  4FX4 A;  2GLO A;  3RD3 A;  3BPV A;  4WXC A;  1RET A;  4L9J A;  1OYY A;  5KNL A;  3N4M A;  3NXC A;  3BTL A;  3JSO A;  3ZXS A;  2HDW A;  3P5J A;  1T56 A;  5CQE A;  5CPR B;  1D0X A;  2DK8 A;  2QKM B;  1B59 A;  3L2V A;  4GRI A;  2VAS A;  3V7C A;  4B8X A;  3ZGK A;  2HOT A;  4ZJZ A;  2PJR A;  1T0F C;  4HKU A;  1IV6 A;  3S5R A;  2JUG A;  4BAC A;  5CXI A;  1YW8 A;  3L9F A;  4M3E A;  4B3A A;  3S93 A;  5ILU A;  5DM7 F;  1I1S A;  1G3Y A;  3RYP A;  2DG7 A;  1MNM C;  3KYC B;  5KK1 A;  5J4Y A;  3V8J A;  2UXO A;  1IV8 A;  4U87 A;  2JT1 A;  1OJL A;  2O6G E;  3OYD A;  1WI9 A;  4I99 C;  2DN0 A;  5DD8 A;  1XB4 A;  1PP8 F;  2L7F P;  2PMZ N;  1ZG1 A;  2JJ7 A;  4BDY A;  4GYG A;  1W4M A;  1VQN I;  2GFN A;  2PX9 A;  4P55 A;  3BJB A;  3OYM A;  2ECC A;  1XGN A;  3A0H C;  5KHD A;  3OYN A;  3HRS A;  3VOE A;  2P5V A;  3KEO A;  2A69 F;  2GOM A;  4RLQ A;  2DT6 A;  3V8K A;  1W5T A;  1XPX A;  1FYK A;  3KNW A;  1HKQ A;  2DAO A;  4XRF A;  2BW3 A;  1YRN A;  1VQP I;  2A68 F;  3GLL A;  4A3C J;  1BA5 A;  3G56 A;  2STT A;  4RBO A;  4I0A A;  1QPM A;  3EUP A;  1ACI A;  4L5J A;  3KEY A;  5D5V B;  4NC6 A;  1XCV A;  4BHP A;  1J59 A;  4CA0 A;  5LHI A;  3RYR A;  2FBK A;  3H9G A;  2DA4 A;  2REK A;  3WHB A;  5TIS C;  5JVT A;  4MTD A;  1BR2 A;  4E4H A;  1W7P A;  2ZB9 A;  3OYB A;  5IOZ A;  3QPT A;  1ETY A;  3BNI A;  2EZL A;  5F04 A;  3CO7 C;  4FTH A;  2R5Z A;  2ZJ2 A;  1BW6 A;  4HV6 A;  3CCS I;  1WWX A;  3BTJ A;  3LAJ A;  3ZMS A;  4CCJ A;  3R61 A;  1DGW Y;  1W7P D;  4L9V A;  3BRO A;  2UZK A;  2KJB A;  5EG0 B;  3D5S C;  2IGM A;  3IP4 B;  4FT8 A;  4RLF A;  2AQE A;  5JLW A;  5FKO A;  4C2M A;  2K40 A;  3OS1 A;  4OWR B;  5DCM B;  3OYI A;  1ZHF A;  4BAY A;  2WY8 Q;  4AIK A;  1T08 B;  4E7I A;  5FHP A;  4L5I A;  4BJT A;  3H5N A;  4HZF A;  1QHH D;  1ZLJ A;  2E7W A;  2VKV A;  4FAS D;  5HDK A;  2CW8 A;  2LC2 A;  2NVX J;  2RNG A;  2RQQ A;  5E79 C;  2MA3 A;  3M9A A;  1KU7 A;  2H8W A;  1E3O C;  2QEX I;  2DOA A;  2P7V B;  1FJL A;  3CCE I;  4C2T A;  3H0D A;  4JK1 X;  1TLH B;  3NWS A;  4D7N A;  1ZGW A;  4F7Z A;  2HQ5 A;  4HNV A;  2L4M A;  3D1N I;  1T95 A;  3J7A Y;  2H94 A;  2P6T A;  3BCA A;  5E1Z B;  1B8I B;  3ZMT A;  1XGS A;  3K0L A;  1RRJ A;  2MD5 A;  4KFC A;  4RGR A;  2DMQ A;  5GTH C;  4B1R A;  1DGR M;  4M6Y A;  2GXA A;  1J7K A;  4ITV A;  3Q0W A;  2ADU A;  4NB5 A;  1HDP A;  3BJ6 A;  2LVS A;  5IYB J;  2FD5 A;  1REP C;  5D8L B;  5FKL A;  1RR7 A;  2BY2 A;  1WHU A;  2R5Y B;  3H3U A;  3MN2 A;  2O61 A;  4UXN A;  2CQQ A;  3QP5 A;  2LKP A;  5HLG A;  4ESJ A;  1YX3 A;  1QQI A;  2XGC A;  3HTU A;  1K6Y A;  2DA3 A;  5JHF A;  2LG4 A;  2HU9 A;  2PFB A;  2ELH A;  2V26 A;  3E7Q A;  2OQG A;  3PJR A;  1G6N A;  5GTI C;  4CGZ A;  3G1O A;  4NEL A;  2OA4 A;  3AG2 H;  1YIT I;  1UG2 A;  2WTE A;  3C2H A;  1ITY A;  4BXF A;  2NVT J;  4KT6 A;  5C4J J;  2YPR A;  2GWR A;  2D2W A;  3HPG A;  4EM1 A;  1EJ9 A;  1ON2 A;  3VSK A;  2QEN A;  1T38 A;  2MFZ A;  2KQR A;  1F5T A;  1A6Q A;  3K10 A;  2XKP A;  1FNN A;  4C2M J;  2F6C A;  3CP8 A;  1WVR A;  1H9G A;  2LBF A;  2FBI A;  3TL4 X;  4ETS A;  2GEN A;  2FF4 A;  3ZQQ A;  3HTA A;  1A04 A;  1ZRE A;  1TT0 A;  4OIP F;  4Y15 A;  2CQ7 A;  3ZMU A;  2FJI 1;  2BY1 A;  4EM2 A;  2O3F A;  1OCC H;  1LDD A;  3QOE A;  1TP4 A;  4A5M A;  3MFK A;  4HF2 A;  2LY1 A;  2PMU A;  3WGI A;  3BR3 A;  4PFO A;  5AIP A;  5GP9 A;  2XDV A;  4PJ0 C;  4HQE A;  3CC2 I;  4AID A;  1XC5 A;  1SVL A;  1P4W A;  3PQK A;  3HOZ J;  1VND A;  4XLF A;  3Q0V A;  2HVQ A;  1IN7 A;  1X3Z B;  2EBI A;  2CFX A;  1MH4 A;  1MMD A;  4DVY P;  3SXY A;  3R0J A;  4JYK A;  5GAG J;  3M1C A;  2EA4 A;  1BIA A;  1ZG3 A;  3DEW A;  4I7H A;  2X1D A;  2HOS A;  4EGY A;  4S04 A;  3FMQ A;  3MEX A;  4XOT A;  2WC2 A;  1U0J A;  3A0B C;  3ZQC A;  2DFE A;  2IA2 A;  1S7A A;  4M6V A;  2CQN A;  4EM0 B;  4FHT A;  1B9N A;  1VQ9 I;  4NNJ A;  5EZH A;  5TGT A;  1SFU A;  1LE8 A;  2L7K A;  3K70 D;  1SD7 A;  3F8F A;  4XID A;  3AFH A;  4L9N A;  2NVY J;  3FIW A;  5LFA A;  4ENM A;  1ZKG A;  3SZT A;  5ILS A;  2R7T A;  2DOE A;  2VOD A;  4BL0 B;  1SAX A;  3HYI A;  1VF9 A;  2P5L C;  4V2F A;  2GOX B;  1Z9C A;  1BN5 A;  1XN7 A;  3N97 A;  3SQN A;  3RH2 A;  3DFG A;  1YIJ I;  4XSZ F;  2CH0 A;  4DYC A;  1WJE A;  4HX4 A;  3HOX J;  2CUZ A;  5FKN A;  2V1U A;  3I3L A;  2ZSI B;  2AXT C;  4ZTJ A;  1FOW A;  2OCE A;  1R49 A;  4LLL A;  3AL0 C;  3GWZ A;  1UI5 A;  4X1E A;  3HOW J;  5IYD J;  1HC8 A;  1SAN A;  2W82 A;  1IGN A;  3ZQL A;  3CC7 I;  3A02 A;  1KGS A;  5M5X J;  1O57 A;  4XRM A;  1EH6 A;  3B6C A;  2QA4 I;  1TZL A;  5LGU A;  3FXK A;  3CTA A;  1WJD A;  1KON A;  3UR3 C;  4OD4 A;  2M4K A;  2VON A;  4B3X A;  4MQV A;  5J1Y A;  1BI0 A;  1HDD C;  3J7Y J;  4KT5 C;  3E5X A;  3MNL A;  4CCL A;  2OPT A; 
#chains in the Genus database with same CATH homology
 2K9S A;  3Q3S A;  2X9D A;  4G12 A;  2WV1 A;  2NOG A;  3MVP A;  5JLX A;  4CGR A;  3ZQF A;  4DYR A;  2QWT A;  2CU7 A;  2QIB A;  3LOC A;  1X58 A;  1POG A;  1QPI A;  4MIM A;  4JX4 A;  2DMN A;  3GTP J;  2E1O A;  3QQA A;  3LNQ A;  3I4N J;  3CDL A;  3PO3 J;  4PXI A;  3HKZ N;  1QVU A;  2NP5 A;  2D5V A;  3HOU J;  5E3L A;  4UUS A;  1RKT A;  4IHW A;  3BTC A;  1WGX A;  2DA7 A;  1FEX A;  4XRS G;  1TWG J;  4A3D J;  1MBF A;  3VOK A;  3JRG A;  3S1M J;  4L5E A;  2UXU A;  3KKC A;  1ORK A;  3IV5 A;  3QBM A;  1BL0 A;  3NPI A;  4UUT A;  4GCT A;  3LSP A;  2R0Q C;  1A5J A;  4M3B A;  1NK2 P;  2Y31 A;  1W0U A;  1SGM A;  3O60 A;  5EF6 A;  1I6H J;  3VW1 A;  1GT0 C;  2HOA A;  2R93 J;  1ETW A;  1JUP A;  4NDL A;  4YZE A;  3UKG A;  3LSR A;  4L62 A;  2JN6 A;  3FRQ A;  2L0K A;  2KDZ A;  1W0T A;  2DMT A;  3W6V A;  1X2M A;  4MO7 A;  1D5Y A;  4AF5 A;  3O8H A;  1H89 C;  3JRH A;  2TRT A;  4A69 C;  2R5Y A;  1UHS A;  2LK2 A;  5IYC J;  3HTI A;  5EDN A;  2O7T A;  5FLM J;  4FCY A;  4ACI A;  1IG7 A;  5FJ8 J;  1MBK A;  1FTZ A;  4B4C A;  1BJZ A;  3BR0 A;  5FKM A;  3ZQG A;  1I50 J;  2DMU A;  4C3I J;  1Q1V A;  5IP6 A;  1R9T J;  3V6G A;  3M3Y J;  2CRG A;  3WHC A;  3VP5 A;  1WH7 A;  1JT0 A;  1MSF C;  2AO9 A;  2X48 A;  4JX5 A;  2DG8 A;  1TWA J;  3F0C A;  4I76 A;  1HOM A;  3PO2 J;  2R5Z B;  5IP7 J;  5K7F A;  1RKW A;  3VUQ A;  2W53 A;  3RQI A;  5DAJ A;  2FJ1 A;  3KZ9 A;  1FTT A;  3I4M J;  1F43 A;  3M4O J;  1PUF B;  3LHQ A;  2V57 A;  4GFK A;  5BNG A;  1XG1 A;  3S1N J;  1QRY A;  2XGD A;  3OIO A;  3VVX A;  1JUM A;  1RPW A;  3PAS A;  2JMW A;  3SDG A;  1PUF A;  3LSJ A;  4DZP A;  2QCO A;  2X6O A;  2RHA A;  1OFC X;  2M34 A;  2LTP A;  1MBE A;  4IHY A;  3GEU A;  1MBH A;  1MBJ A;  2DA5 A;  1JJ8 C;  1ZK8 A;  5EYR A;  5HOD A;  3CJD A;  1WH5 A;  1DU6 A;  2NVQ J;  4GFB A;  2OF7 A;  1JKQ C;  2G7L A;  1JTY A;  1RES A;  5C44 J;  1JTX A;  2G7S A;  2QF7 A;  1MSE C;  1HCR A;  2DA6 A;  2ZCN A;  5EEA A;  4Y52 J;  3HEF A;  3HM5 A;  3BQY A;  1ZR2 A;  3TED A;  4J19 A;  5EZG A;  2NS7 A;  1VI0 A;  2ECB A;  2EQR A;  3HBL A;  1G2H A;  2PBX A;  2MGQ A;  3ZQH A;  2AHQ A;  2FQ4 A;  2D6Y A;  4JKZ A;  2L7M P;  5H9T A;  3COL A;  4EEF G;  3FKI J;  1JKO C;  2ELK A;  5E3M A;  3VVY A;  3GTJ J;  1TC3 C;  2XB5 A;  4QTR A;  3JRD A;  3JRI A;  1ZQ3 P;  1U9O A;  5EFY A;  2ZCX A;  3G7R A;  2DJN A;  4GFL A;  3ZQI A;  4BKX A;  3RZO J;  4JX6 A;  3BR5 A;  2CUE A;  1LFB A;  3RD3 A;  4V2G A;  2GLO A;  1LFU P;  2XSD C;  2E2I J;  5FGL A;  2HXO A;  1RET A;  3HIM A;  1JUS A;  3NXC A;  2GUH A;  3S2H J;  3BTL A;  4UDS A;  3DCF A;  2O9L A;  1WI3 A;  1DU0 A;  3IH4 A;  1T56 A;  2PZ9 A;  3JSJ A;  3FIS A;  2OI8 A;  3H0G J;  1SFO J;  2M9H A;  3E7L A;  3FK7 A;  2H8R A;  2FBQ A;  2ZOZ A;  5HAW A;  2KT0 A;  4DW6 A;  1AHD P;  2HOT A;  2WUI A;  1GDT A;  2JA8 J;  5CW8 A;  1TWH J;  4HKU A;  1IV6 A;  2XPU A;  2LLK A;  5M5W J;  2HXI A;  3HE0 A;  5CXI A;  3S5R A;  3BQZ A;  2DTZ A;  4GCL A;  4M3E A;  4B3A A;  3TW6 A;  2K9Q A;  2OER A;  2QKO A;  3ON2 A;  4IHX A;  4ME9 A;  5D1R A;  3VW0 A;  3OOU A;  1Z77 A;  3BR6 A;  1MNM C;  2DG7 A;  3S1Q J;  5J1R A;  5F08 A;  2UXO A;  1H88 C;  1APL C;  2FX0 A;  2WB1 N;  3BR2 A;  5K7H A;  1OJL A;  4A3F J;  1U8B A;  2LY9 A;  5IOY A;  2DN0 A;  3ANG A;  4BXX J;  2Y0S N;  4D7M A;  2ID6 A;  3NRG A;  1X2N A;  2L7F P;  2O8K A;  4IHV A;  2PMZ N;  5D18 A;  2JJ7 A;  1S7E A;  3HTJ A;  3T6N A;  2XDN A;  2GFN A;  3BJB A;  2EZH A;  3QPL A;  4D5C A;  2ECC A;  3B81 A;  4LOC A;  3HOV J;  3S2D J;  1BW5 A;  1EF4 A;  3IUV A;  4KWA A;  1OCT C;  1IC8 A;  1HLV A;  1U78 A;  1ZR4 A;  3KNW A;  2W48 A;  2EH3 A;  5J1U A;  1BA5 A;  1YRN A;  3G56 A;  4A3C J;  3BHQ A;  2XRL A;  1FIA A;  2VPR A;  3HOY J;  4RBO A;  2R92 J;  3EUP A;  4RDU A;  2HYJ A;  1IDY A;  1H8A C;  1YRN B;  4FE4 A;  1Z0X A;  1TWF J;  3VW2 A;  2COB A;  1VFC A;  2JA5 J;  2DA4 A;  2REK A;  2M8G X;  3WHB A;  1I3Q J;  3QPS A;  2G3B A;  1F36 A;  2ZB9 A;  4AYB N;  2CQX A;  4FIS A;  1U9N A;  5IOZ A;  3BNI A;  1ETY A;  3O8G A;  2EZL A;  4A3I J;  5F04 A;  4FTH A;  2R5Z A;  1BW6 A;  5M3M J;  5J3L A;  3BTJ A;  4C3J J;  4D5F A;  5EG0 A;  3S14 J;  4A93 J;  3JRA A;  5D19 A;  2IEK A;  5C4X J;  4W1U A;  4A3M J;  5EG0 B;  2UXP A;  2L7Z A;  3ON4 A;  5FKK A;  1MH3 A;  5JLW A;  4BY1 J;  5FKO A;  2K40 A;  2HDD A;  5F0F A;  1P7I A;  3BT9 A;  3Q0U A;  2B63 J;  3GZI A;  3B6A A;  2M0C A;  3GTQ J;  2N8G A;  2LFB A;  5FHP A;  3S1R J;  4MK6 A;  4XRS A;  1ENH A;  3OSG A;  4DZJ A;  2VKV A;  2NVX J;  4X6A J;  2LR8 A;  2IAI A;  3AQT A;  1E3O C;  2HI3 A;  3SJM A;  1FJL A;  1IUF A;  2QTQ A;  4MLO A;  1GUU A;  2L9R A;  5GPA A;  4D7N A;  1ZGW A;  2YVE A;  3HB9 A;  3A01 B;  2HQ5 A;  3LSG A;  4HNV A;  3D1N I;  2JWT A;  3RKQ A;  2RAE A;  3HTH A;  4CYC A;  1AKH A;  3PM1 A;  2YU9 J;  2MW8 A;  1B8I B;  1T33 A;  1O4X A;  3PPB A;  1ZTR A;  2Y2Z A;  3JRF A;  3JRC A;  4CYC B;  1B72 A;  1A6I A;  3NAU A;  2E19 A;  4XK4 A;  1B8I A;  2DMQ A;  4QIW N;  4W97 A;  4B1R A;  1HF0 A;  2WAQ N;  3A03 A;  1QVT A;  2XPV A;  2Y9Y A;  3S15 J;  3Q0W A;  1OCP A;  2WGB A;  3JRE A;  5E3O A;  1GV5 A;  3S16 J;  1HDP A;  2LVS A;  5IYB J;  1Y1W J;  2ZCM A;  3P9T A;  2FD5 A;  2GBY A;  2TCT A;  5FKL A;  3CCY A;  3ANP A;  1RR7 A;  3TP0 A;  5F27 A;  2R5Y B;  1WCM J;  3MN2 A;  2LD5 A;  3HGG A;  2NS8 A;  9ANT A;  2CJJ A;  2CQQ A;  3BCG A;  3IH2 A;  2XGC A;  4JP0 A;  3CMY A;  3NI7 A;  3ZOB A;  2DA3 A;  4A3L J;  5IP9 J;  3A01 A;  2NX4 A;  3G1M A;  3C07 A;  3QKX A;  4A3E J;  3CRJ A;  3E7Q A;  1JJ6 C;  1AU7 A;  3CQZ J;  4M3D A;  3GTM J;  4IEJ A;  5K58 A;  2F07 A;  2XB0 X;  1K61 A;  2HKU A;  5HSZ A;  3G1O A;  4NEL A;  5GPC A;  3S17 J;  5FLV A;  1UG2 A;  2VKE A;  3BTI A;  1JGG A;  1ITY A;  1UI6 A;  3G1L A;  2NVT J;  5C4J J;  2VI6 A;  3OSF A;  1JKR C;  2P81 A;  1FIP A;  1IRZ A;  3GBG A;  2NP3 A;  4ICH A;  2ID3 A;  3GTG J;  4C2M J;  3BG3 A;  3F1B A;  4AUX A;  2GEN A;  5F1J A;  1TWC J;  5C4Y A;  2MG4 A;  3GTL J;  3HTA A;  2YS9 A;  2XGE A;  4FE7 A;  5DTD A;  2HYT A;  4QSH A;  3LWJ A;  2YUS A;  2Y9Z A;  5F0H A;  2I10 A;  2UXI A;  1IJW C;  4Y7N J;  3BRU A;  2LP0 A;  3BR3 A;  5E3N A;  3JRB A;  1XS9 A;  3FK6 A;  5GP9 A;  2JA6 J;  1IDZ A;  2O7O A;  1ETX A;  1XC5 A;  3JR9 A;  4MXM A;  3HOZ J;  3HGY A;  3BG9 A;  1VND A;  2IU5 A;  2M2E A;  3Q0V A;  5M3F J;  2EBI A;  4A3B J;  1MH4 A;  2XPW A;  3IH3 A;  2QOP A;  4MFD A;  4JYK A;  2JK3 A;  2E2H J;  3BR1 A;  3DPJ A;  5F0C A;  2HOS A;  3DEW A;  3RZD J;  2K9N A;  2R7Z J;  4BBR J;  1LE8 B;  3TP3 A;  3HDD A;  3ZQC A;  1ETK A;  4M6V A;  4DYQ A;  2Q24 A;  3C2B A;  1K83 J;  5EZH A;  1LE8 A;  3LJL A;  3MKL A;  2ME0 A;  4XID A;  1Y1V J;  1P7J A;  2EZI A;  2NVY J;  3FIW A;  2G7G A;  3NNR A;  5AQC A;  1ZKG A;  2E2J J;  1JT6 A;  2ME6 A;  5FMP A;  3V78 A;  3NAR A;  1UMQ A;  1VF9 A;  1MBG A;  1ETQ A;  4M3G A;  4V2F A;  4JNN A;  4XIC A;  3K7A J;  2LKX A;  5EGO A;  2VUM J;  3RH2 A;  4A3K J;  5DS9 A;  1CQT A;  5K7Z A;  4DYC A;  1NK3 P;  4AC6 A;  2EZK A;  1B72 B;  2DMP A;  2CUF A;  2RAS A;  3L1P A;  5EGO B;  1GV2 A;  3HOX J;  5FKN A;  3CWR A;  2G0E A;  4BY7 J;  2H1K A;  3AQS A;  2UXH A;  1UI5 A;  3K2A A;  4X1E A;  3HOW J;  4A3G J;  4ABZ A;  3GTO J;  3GTK J;  3EGQ A;  5IYD J;  1SAN A;  4C3H J;  1IGN A;  1ETO A;  4S0H B;  3ZQL A;  4UUS B;  3A02 A;  5M5X J;  4XRM A;  3B6C A;  4BBS J;  3SFI A;  5M5Y J;  4NN1 A;  2GM4 A;  4M3F A;  4GCK A;  2IBD A;  5CXG A;  4A3J J;  4JL3 A;  4MFE A;  1JKP C;  3H3V K;  2YVH A;  2Y30 A;  3VIB A;  3KKD A;  5J1Y A;  1ETV A;  4I6Z A;  2MSY A;  5HBU A;  1WPK A;  4AC0 A;  3BG5 A;  1HDD C;  1AKH B;  5C3E J;  3VVZ A;  1NTC A;  2DA2 A;  3MNL A;  2JA7 J;  1GVD A;  2DA1 A;  2OPT A;  3VOX A;  2ZOY A;  5IPA A;  3VPR A;  3TW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...