3B6CA

Crystal structure of the streptomyces coelicolor tetr family protein actr in complex with (s)-dnpa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
214
structure length
202
Chain Sequence
MAPLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEVEVPEPEPGRWAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDELAAYGGDLLSTFVTAEALEQSSRVFADQLHGYLKSLPATSFPNLVHLAGPITSLDSDRRFELGLEIIIAGLLAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ActII protein
publication title Crystal structures of the Streptomyces coelicolor TetR-like protein ActR alone and in complex with actinorhodin or the actinorhodin biosynthetic precursor (S)-DNPA.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 79
structure length 202
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3b6cA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3b6cA02
1A6IA 1D5YA 5IOYA 1G2HA 2ME6A 3S17J 2ID6A 1SANA 4JX5A 3S2DJ 3RQIA 2O7TA 2CQXA 2DTZA 5FKNA 3Q0WA 1MSFC 2UXOA 2NVXJ 4IHVA 2UXUA 4MLOA 2DG7A 3IH3A 4M3BA 4AC0A 1ZK8A 2R5ZB 3B6AA 4DZPA 5EG0A 2IAIA 5K58A 2DMNA 1UG2A 2R92J 2E2HJ 3G56A 2OPTA 3BJBA 1GT0C 1O4XA 2YUSA 5M5XJ 4DZJA 4FE4A 2XPVA 2F07A 2H8RA 3HE0A 2VPRA 3VW2A 3TP3A 1OFCX 3C07A 2G7GA 5JLWA 3BTCA 2V57A 2E1OA 2CUFA 3LSJA 3G1OA 1JJ6C 2ZOYA 1MBKA 1ZR4A 1RKTA 3EUPA 4UDSA 3IH2A 3ZQGA 3G7RA 4M3EA 2AO9A 3BR2A 1W0UA 3OOUA 3FIWA 4X6AJ 1FTZA 2K9QA 4DW6A 1LE8B 2H1KA 3CJDA 5K7FA 2WB1N 3VVZA 2G7SA 2AHQA 1VFCA 4EEFG 3JRHA 4IHWA 4JX6A 2ZOZA 2CRGA 4A3EJ 4HNVA 2LY9A 4MFEA 3BTIA 5E3LA 1WPKA 5EYRA 1QPIA 3DEWA 2R7ZJ 2NVYJ 2IU5A 3HTJA 3VW1A 1BJZA 4GFKA 4V2GA 1Y1WJ 2LK2A 2RHAA 1IRZA 2ECCA 3LHQA 2JA6J 5H9TA 2E19A 3LSGA 4IEJA 4MXMA 3VIBA 2EZKA 3OSGA 2R5YB 1H89C 2JK3A 2IEKA 4I76A 1YRNB 3BG3A 5E3NA 1IDZA 4CYCB 1XG1A 1FEXA 3F0CA 5D18A 1HDDC 1F43A 2X9DA 2Y9YA 2Y0SN 2XGDA 3CDLA 3BR0A 2ME0A 2JA7J 2YU9J 2EZIA 2YS9A 1OCTC 1Z77A 4A93J 3VPRA 5CXIA 1Q1VA 3A02A 5FGLA 2P81A 1WGXA 4D7NA 3H0GJ 2DMQA 3VVXA 3TEDA 1AU7A 3TW7A 3B81A 4ICHA 3LOCA 2M8GX 4XRMA 3JRFA 2PZ9A 2Y2ZA 3S15J 3GTLJ 5IP7J 5EF6A 3GTKJ 4QSHA 2NOGA 4A3MJ 4JX4A 4BXXJ 4ABZA 3NNRA 3G1LA 3JRCA 1RKWA 1A5JA 2MGQA 1JKQC 5DS9A 1IGNA 1IUFA 3JRGA 4XIDA 1H88C 1P7JA 3W6VA 3BR1A 2ID3A 1JUMA 2LTPA 1CQTA 4JL3A 2ECBA 2B63J 3F1BA 2M0CA 5E3MA 3DCFA 4A3GJ 3SDGA 3JRAA 1MBHA 5GPCA 3GTGJ 4Y52J 2L9RA 4NDLA 2QF7A 3HB9A 4B3AA 4JYKA 1MBEA 4Y7NJ 3O8HA 1UI6A 3HOUJ 3JRIA 1U9OA 3LSRA 1Z0XA 2W48A 3A01A 2Y9ZA 2QTQA 1PUFA 2X6OA 2XRLA 1BW6A 1ETWA 2KT0A 2XB5A 4BBRJ 3G1MA 5C4XJ 1TWAJ 3HIMA 9ANTA 3ZOBA 4D5CA 1ZQ3P 1HDPA 5F0CA 1ETXA 5GP9A 4DYQA 3GTOJ 2HYTA 5DAJA 1IDYA 2G3BA 2KDZA 4A3KJ 1K61A 3VW0A 2O7OA 5FMPA 3MKLA 1HLVA 1I50J 5J3LA 2ZCXA 5FJ8J 2LD5A 3ZQIA 2QKOA 4BKXA 2FBQA 2REKA 3PASA 2WGBA 2W53A 4DYCA 3MN2A 1OCPA 1AKHA 2Y30A 1FJLA 2PBXA 1U78A 4GCTA 1H8AC 2GM4A 4IHXA 2OI8A 2Y31A 4XK4A 1WH5A 3S16J 2HKUA 1TWCJ 2HDDA 3BR3A 5FKOA 1B8IA 1TWFJ 3HOXJ 1B72B 1GV2A 2MSYA 3HEFA 3BHQA 2DA6A 3PO3J 5EFYA 5J1UA 5FLMJ 5HSZA 3RZDJ 4XRSG 5EGOA 4D7MA 3HOYJ 4JP0A 4M3FA 4IHYA 2LP0A 4X1EA 2JA5J 3GTQJ 5F08A 2VUMJ 2HOAA 1IG7A 4MFDA 3S5RA 4AYBN 3VOXA 2MG4A 1WH7A 2D6YA 3DPJA 3NARA 2K40A 3BCGA 3CCYA 4GCLA 2I10A 4KWAA 2DA4A 5M5WJ 3S14J 3GEUA 1F36A 3QBMA 1W0TA 4MK6A 3H3VK 5D19A 3T6NA 2OF7A 2JA8J 3PPBA 4JKZA 3RKQA 5HAWA 1GUUA 5F1JA 2R0QC 1XS9A 3NPIA 3RD3A 4A3JJ 2HI3A 1TC3C 3HDDA 4CYCA 1UHSA 4S0HB 1JUSA 3A03A 3GBGA 2NP5A 4UUTA 4MIMA 4UUSB 2DG8A 3JSJA 2WUIA 5EEAA 2DN0A 5IYCJ 4CGRA 2CUEA 3V6GA 3BR6A 1DU6A 4MO7A 1Y1VJ 1I3QJ 3C2BA 5IOZA 1R9TJ 2FD5A 5BNGA 1RETA 2IBDA 1JT6A 1HCRA 1T56A 2WAQN 4XICA 3BRUA 3TP0A 5E3OA 2EZLA 4XRSA 2Q24A 4M3DA 2HYJA 1FIPA 3SJMA 4DYRA 2YVEA 2E2JJ 2DA3A 2GUHA 3AQTA 3E7QA 3O60A 2PMZN 2QCOA 4LOCA 5K7HA 4FCYA 4A3CJ 1JTYA 1VF9A 5C4JJ 1BL0A 2RASA 2ZCNA 1ORKA 1QVTA 1GVDA 3LSPA 4GFLA 4QTRA 3JRDA 3VOKA 1ETQA 5C3EJ 1DU0A 3B6CA 3FK7A 1ZR2A 3JRBA 1MNMC 4NELA 2QIBA 5EZGA 4A69C 5AQCA 3HTHA 1P7IA 4NN1A 2JWTA 1JKPC 1IJWC 2EZHA 3QQAA 1LFUP 3S2HJ 5JLXA 3CMYA 2CQQA 4C3IJ 1IC8A 3M3YJ 1RPWA 4HKUA 4M3GA 4V2FA 2L7FP 3V78A 1ETKA 4I6ZA 2JJ7A 1POGA 3GTMJ 1FIAA 3FK6A 1MH4A 4C3JJ 4GFBA 2UXHA 4W1UA 1ENHA 3LNQA 1ITYA 1JKOC 2JN6A 3MVPA 3RZOJ 2M9HA 1X58A 3PO2J 3S1RJ 3K7AJ 5J1RA 2TCTA 2MW8A 2XGCA 3LWJA 3M4OJ 3KNWA 3ZQHA 1GV5A 1BA5A 5HBUA 3ZQFA 3VUQA 1RESA 3UKGA 3BTLA 1XC5A 5FLVA 2YVHA 3QPLA 1MBGA 4B4CA 1U9NA 1JT0A 3GTPJ 3O8GA 4BBSJ 3Q0UA 3FKIJ 1TWGJ 3JR9A 1ZTRA 2L7ZA 3HKZN 1WCMJ 4RDUA 1S7EA 5K7ZA 1LFBA 2R5ZA 1TWHJ 3ANGA 1MH3A 1HF0A 2ZCMA 1ZKGA 5C4YA 3A01B 3ON2A 2LLKA 4BY7J 5F04A 1PUFB 3HOVJ 1MSEC 2XDNA 3PM1A 1ETOA 5HODA 2ZB9A 3EGQA 3Q3SA 4FISA 2M34A 5FHPA 3GZIA 1MBJA 2DA5A 5GPAA 4FTHA 3IUVA 4AF5A 3HM5A 5M3MJ 2E2IJ 2VI6A 2LFBA 4FE7A 3TW6A 2HOTA 3HOZJ 3JREA 1VNDA 4ACIA 4QIWN 3HTAA 2CJJA 5IYBJ 1LE8A 3HGGA 5FKLA 1JTXA 3GTJJ 1IV6A 2M2EA 2JMWA 3SFIA 1AKHB 2NVQJ 3WHCA 3BT9A 2HQ5A 2NS8A 5EG0B 1GDTA 3CWRA 3E7LA 5IP9J 2D5VA 2G7LA 3LJLA 4A3IJ 5M3FJ 3KZ9A 1B8IB 3QPSA 3BNIA 4ME9A 2DJNA 1NK3P 3OSFA 3IV5A 2L0KA 3S1NJ 1K83J 2GBYA 2XB0X 2R5YA 4A3LJ 3NXCA 5EGOB 4UUSA 1YRNA 5D1RA 3VP5A 3ZQCA 2NVTJ 2XPUA 1VI0A 2VKEA 5EDNA 2UXIA 3NI7A 2VKVA 2XGEA 5IP6A 2CU7A 3BQZA 2FJ1A 3BTJA 1ZGWA 3ON4A 1OJLA 2DMPA 3HBLA 5FKKA 4AUXA 1NK2P 2L7MP 5M5YJ 4GCKA 3ANPA 2WV1A 3L1PA 1E3OC 2DMTA 3RH2A 2OERA 1MBFA 5FKMA 2NX4A 1U8BA 2LVSA 3FISA 5F0HA 1BW5A 2K9SA 1RR7A 3HGYA 2LR8A 2ELKA 3CQZJ 3IH4A 3I4MJ 3VVYA 3HOWJ 3I4NJ 1T33A 2DA7A 1QVUA 1WI3A 2GFNA 2COBA 1I6HJ 3NAUA 3COLA 3BG5A 2UXPA 2G0EA 2R93J 3WHBA 2FX0A 2EH3A 2XSDC 5IYDJ 1HOMA 3KKCA 3S1QJ 1JUPA 5F27A 2EQRA 3ZQLA 1FTTA 5CW8A 2TRTA 1JJ8C 2K9NA 1JGGA 2XPWA 1ETYA 4M6VA 5EZHA 1JKRC 3CRJA 1NTCA 3QKXA 2O8KA 5CXGA 4RBOA 4C3HJ 1APLC 1UMQA 2DA1A 1SFOJ 1UI5A 4L62A 2HOSA 1ETVA 4B1RA 4L5EA 2GENA 4JNNA 3Q0VA 3KKDA 3P9TA 3HTIA 1QRYA 1X2MA 1AHDP 3S1MJ 2GLOA 3BG9A 4C2MJ 1X2NA 2QOPA 4D5FA 2O9LA 4A3FJ 2FQ4A 3AQSA 3MNLA 4W97A 5C44J 2DMUA 1EF4A 3D1NI 2LKXA 2X48A 4A3DJ 2NP3A 3OIOA 4G12A 2RAEA 5F0FA 2NS7A 4A3BJ 5J1YA 4PXIA 1SGMA 4YZEA 3FRQA 2DA2A 2EBIA 3K2AA 3NRGA 1B72A 2QWTA 2HXOA 2HXIA 5IPAA 5DTDA 2N8GA 4BY1J 4AC6A 3BR5A 3BQYA 4J19A
chains in the Genus database with same CATH superfamily
4HDVA 3ZGKA 1G2HA 2ME6A 1T38A 3RQIA 3WTUC 4G6TB 3SFZA 2DTZA 3Q0WA 2UXOA 2UXUA 4MLOA 2DG7A 3W2VA 3IH3A 5HS7A 3KYCB 5CVUA 1X4PA 2E1NA 2M0MA 2VBYA 4G9YA 5LEKA 3MEXA 2IAIA 2DYSH 1B9MA 3GXOA 3KIOA 1NH3A 2E2HJ 2NYXA 2OPTA 3K4KA 3VWBA 1S9HA 2WY7Q 4GYGA 2BHZA 1O4XA 1GT0C 3CMEI 2V79A 2F07A 2XPVA 4BQNA 2H8RA 1VQPI 2M45A 1VQ9I 1OFCX 5JLWA 1R4NB 1N78A 4OMYA 2CUFA 3LSJA 5B1AH 3CDIA 2JQ7A 2ZXWH 1MBKA 4KYWA 3QPHA 3O3KA 1HSTA 3HC7A 3BR2A 3R6SA 4ESFA 3FIWA 3OOUA 1K78A 3ABMH 4YIRX 3HUGA 1I27A 3IWFA 2WB1N 3VVZA 1V5FA 2G7SA 4XLAA 2AHQA 3RQ4A 4N0BA 4JX6A 2CRGA 2HQNA 4MFEA 2EK5A 1DPUA 1W5CC 3HTJA 4IO9F 3DEWA 3CC7I 2NVYJ 4KMFA 2LK2A 3L2RA 2YSRA 3SEQA 4G6QA 4X0GA 1DGWY 3EYYA 4HQMA 1B59A 4I76A 1OLTA 5CKTA 4DIQA 1IDZA 1FEXA 3F0CA 3KCCA 3MFKA 1HDDC 1F43A 3PIOF 3HRUA 4L9TA 2XGDA 2P7VB 3E6DA 3SXYA 3FKJA 4KN7X 1FBUA 1OCTC 1WHUA 5DUIA 2YU9J 2DOAA 4ENJA 3WU2C 3Q9VA 3VPRA 2D45A 4A93J 1YS7A 2NRAC 5DCMA 3A02A 5FGLA 1PUEE 4DOZA 3LL7A 1RI7A 2P81A 1XGMA 3TOBA 3CCRI 3H0GJ 1IV8A 1WJEA 3PQKA 1YX3A 2F5DA 2AS5F 3TEDA 3GLXA 1AU7A 3TW7A 4PJMA 4I2OA 3OOPA 5D4SA 4F93B 2VBWA 2M8GX 4LG0B 4XRMA 1VQKI 1R4MB 3HG9A 2Y2ZA 1PP7U 5IP7J 3ELKA 3NNRA 4BXXJ 4ABZA 1VQ7I 3BJAA 3G1LA 3HXLA 4RAZA 5D4RA 2X85A 1Z21A 3H3ZA 2MGQA 3CTAA 1IGNA 4N9IA 5KHDA 1H88C 1P7JA 3QAHA 4B44A 2XF6A 4J01A 2L9SA 2EFQA 4N4OB 2ID3A 5DCFA 3P9CA 5J4VA 1CQTA 2ISYA 3F1BA 3DCFA 4MNUA 1GXPA 4A3GJ 2CFXA 2E60A 2RC4A 3GTGJ 1WZ2A 4E7ZA 4OD4A 4RS8A 2L9RA 5D5XB 1BI2A 3HB9A 4B3AA 3WTTC 4M6XA 4S05A 3F23A 3D5RC 3A01A 3JTGA 2Y9ZA 4H4KC 2RDPA 3MAJA 1YITI 1XCVA 1BW6A 1ETWA 4NBQA 4BE0A 2H1LA 1TWAJ 9ANTA 1O3TA 2ZJRF 3KP5A 4AIHA 3CO7C 1XCBA 5F0CA 4F3QA 3JAMZ 4I7HA 3GTOJ 1SFEA 4A3KJ 3T8RA 2O7OA 5FMPA 3E6MA 3KX2A 4CA0A 3O6BB 5J3LA 3CLOA 3FHNA 3ZMSA 3ZQIA 2QQ9A 2OCCH 2WGBA 1R36A 4DYCA 2DYRH 3C2GA 4PK4A 2Q8KA 1BC8C 1MW7A 4KICA 1ZH5A 4B48A 4OIQF 2CW7A 1H8AC 2HNHA 4CCKA 3R4KA 2IJLA 3OYKA 5E20A 2O8XA 2HKUA 4LLLA 4I09A 4BJ5C 2HDDA 5FKOA 3C3WA 2UUZA 3K4LA 1ZRDA 1B72B 1RC9A 2ZFWA 4LK1F 1REPC 2MSYA 1USSA 3HEFA 2AXLA 5J1UA 5FLMJ 3RZDJ 2R7OA 3I59B 4XRSG 5E1XA 5EGOA 2ZMEA 4IXAA 2EFNA 3K70C 1YJ9I 2X51A 2KJCA 2O03A 2LP0A 5F08A 1VQNI 1IG7A 2HQRA 4CCLA 2IGMA 2D6YA 2K40A 2VPLA 1XGNA 2PEXA 2FMLA 3WGHA 2I10A 1GXQA 4XKBA 3DQVC 4M71A 4KMUX 3IAM2 3GEUA 1IN4A 1F36A 4RB3C 2F48A 2DFEA 4LIVA 2Y0MA 4U0YA 5HOOA 2X0LA 2FMYA 2KHMA 3DBLB 3ZP5A 1GUUA 4UVCA 5F1JA 1XS9A 2WY8Q 2STTA 3RD3A 4IF4A 2HI3A 2MABA 1TC3C 4CYCA 4S0HB 3A03A 1Y6IA 4KIFA 4MQ9F 1USTA 4B8XA 1R22A 3GBGA 5IT3A 1U8RA 4UUTA 2DG8A 4A5NA 1OCZH 5LHHA 2DN0A 4CGRA 4BHPA 1K78B 5JI6A 2M7AA 1DU6A 1I5ZA 1YJNI 4MO7A 1PJRA 5ICGA 1I3QJ 1XGSA 2FF4A 2VJ4A 1HXDA 4Q4ZF 2EV0A 4KJZA 5IOZA 3CCJI 1ZGAA 5BNGA 3ZXSA 2RVCA 1D8KA 4P5OA 5E3OA 3TDZC 2CV1A 2EZLA 1FNNA 4DJAA 1XB4A 1BIBA 3RYPA 1QZZA 3QYFA 4DYRA 2VASA 4I02A 3E7QA 2ZKZA 4JBAA 4CUGA 5LGNA 3AG2H 4FCYA 1JTYA 1S29A 3DU6A 4CSWA 1S72I 2TDXA 2R7TA 2XAFA 5BOXA 1GVDA 2W82A 3LSPA 4GFLA 4QTRA 3SZGA 1ETQA 3ECHA 5C3EJ 1DU0A 5D6FA 2P6TA 3FK7A 5DCMB 1ZR2A 1ZAOA 5EZGA 3R61A 2J5OA 4A69C 1E17A 4EATA 4NN1A 4RLQA 3WGIA 4L0ZB 3F8BA 2KDOA 4BEHA 1LEBA 1LPQA 5K5OA 2BVLA 3RCOA 1ZARA 4ZYDA 2DPUA 3TL4X 2CQQA 1IC8A 3ISPA 3F72A 2IGKA 3SQNA 1DP7P 5E8IA 3SEZA 4EM1A 1POGA 3GTMJ 3PL8A 3FK6A 5CYVA 1MH4A 1QHHD 1C0WA 1XMAA 4GFBA 2VT2A 3ZN0A 2VXDA 3EUAA 3ZMTA 4W1UA 1ENHA 2WB1A 3LFUA 5IT9Z 3RZOJ 1FBSA 4F52A 3PO2J 3S1RJ 4XORA 1QPMA 1U5TC 2DFFA 2MW8A 2XGCA 3G3ZA 3LQRA 3OS0A 1BA5A 3X2QH 4LG3A 3BTLA 4HA8A 3UKGA 4HRIA 4E7KA 2ZJPF 2YVHA 1MZBA 1EV7A 2Q1ZB 4B4CA 1BC7C 2D1VA 1RR8C 2ESNA 3FKIJ 2L7ZA 3H5NA 4D0PA 3PIPF 1LFBA 2HDWA 3CCUI 3A01B 2GA2A 2LLKA 3HOVJ 1MSEC 1YHQI 3I56I 1T8IA 2LREA 4FASD 1FSEA 3SYTA 4ENKA 4F7ZA 2X6WA 4YG2F 3EQLF 1T08B 4FISA 4L9NA 2JT1A 2X1CA 1MBJA 2FSWA 5GPAA 4GGGA 4AF5A 5M3MJ 4AD9A 1BIAA 3ZR8X 4FE7A 1LDKB 3HPHA 1IN6A 2HYGD 3H9JA 3JREA 4D9JA 4ACIA 4QIWN 2E1CA 3HTAA 5IYBJ 1AOYA 1FZPB 3GTJJ 2M2EA 5FD6A 1OYWA 2NVQJ 3V8KA 1IN7A 3GZNB 3QWLA 2CWEA 3OIQA 3E7LA 5IP9J 3LJLA 2G7LA 5GTIC 3KZ9A 5TGTA 4ZC3A 2V4JC 4ME9A 1DDNA 4PFPA 3IV5A 2GBYA 2R5YA 5D5WB 3NXCA 1YOVB 5EGOB 2ELJA 2ZMEB 3FXMA 3ZQCA 4BH9A 4KISA 2RKHA 3KZYA 1T39A 1K6OA 2MC4A 2OTLI 5FLXK 4EJVA 1ULYA 2A6EF 2XPUA 1B6AA 3L00A 2JSCA 1VI0A 2KISA 1XDUA 2IS2A 2VKVA 3L2CA 2F4MB 2FJ1A 4CCJA 3GZ6A 3MZHA 1R1VA 5HVQC 2QLZA 1QZYA 3ASNH 4AUXA 3MWMA 4HLXA 5M5YJ 1NK2P 3ANPA 2CW8A 2DMTA 4KITB 4XBFA 1BR2A 1Z3XA 5FKMA 1SD7A 5H20A 3CF2A 3CO6C 3GFMA 4Q48A 4MEYF 5ILUA 4G7OF 1BW5A 4NC7A 3HGYA 4OIRF 2LR8A 2QSFX 1YIJI 4UNOA 4HOBA 1N77A 1T33A 2DI3A 4EMSA 5L3FA 1P4WA 3WG7H 4EM0B 1Z7UA 1QVUA 4RA2A 2GFNA 5CVIA 3J7AO 1H0MA 1KU3A 1I6HJ 4F91B 3M9AA 2IW5A 2Y48A 1RUNA 2G0EA 1U0JA 2FU4A 1TL8A 1BR4A 3CJQB 4L18B 2DTRA 2L54A 3V7RA 3D5LA 5AONA 3DBHB 2H09A 2NAZA 1JGGA 1Z3YA 3CD6I 2XPWA 1VQ6I 1ETYA 4M6VA 3PNYA 3QKXA 4EGYA 4XOTA 1APLC 4ITVA 1O7LA 3MZ8A 1OISA 1SFOJ 1UI5A 1ETVA 4RGRA 1ON1A 4YRVA 2GENA 2VJ5A 4JNNA 3Q0VA 2OBPA 4XSXF 4A6EA 3P9TA 1QRYA 2P4WA 1FOWA 2X1EA 3WTSC 1XX5A 2HWVA 3BG9A 4OIPF 3I64A 4BEHB 4BXUA 2QOPA 2Z99A 2O9LA 2EIKH 2VKDA 2A61A 2K9LA 2A2FX 3OIOA 2RAEA 5F0FA 4GO1A 1TQMA 4P9FA 4DBQA 5J1YA 3MKZA 2CV2A 4PXIA 2PFBA 1SGMA 1W7PD 4LIUA 3OYNA 3Q9SA 5EEGA 1HW5A 3VODA 3MCZA 2HXOA 5DUKA 4YIFA 3I0TA 2FOWA 4E7IA 1Z7LA 3VYTB 3DPTA 1K4SA 1D5YA 3FXLA 2ZXJA 5IOYA 3U21A 1Y0NA 5CLSA 3RPQA 3S2DJ 2E1MB 1W4MA 4L5JA 4RAFA 4E7JA 2NVXJ 2ESHA 1ZHFA 2K02A 2IVMA 1OKRA 1A36A 1ZK8A 3B6AA 4DZPA 1O57A 4FX0A 4H0EA 2B9SA 3F6OA 3NWTA 2R92J 5F64A 1TW2A 2KJBA 2VE8A 4G8XA 1FOXA 3R0AA 4DZJA 1JHFA 2FUG2 5KK1A 3VW2A 1X1AA 3TP3A 3C07A 2DU9A 4IZZA 3BTCA 3N05A 2E1OA 2BY3A 2PN6A 3WTZA 1JJ6C 1D5VA 2ZOYA 1ZR4A 1Q1HA 1RKTA 4MTDA 3EUPA 2FXAA 3ZQGA 2AO9A 2AQEA 2KZVA 3BWGA 1SAUA 1MJAA 3DF8A 2G7UA 3OYMA 6PAXA 3AFHA 4DW6A 5LGUA 4CHUA 1V3FA 2P6SA 1VFCA 3IHUA 3JCUC 1HKSA 4IHWA 4A3EJ 4HNVA 3BTIA 2IU5A 3M07A 1KONA 4P55A 2HTJA 1BJZA 2XKOA 4V2GA 4LLNA 1R5GA 2MD5A 3H0DA 2ECCA 3OR2C 3LHQA 2JA6J 3LSGA 4KIGA 1LQ1A 4XN0A 3OSGA 3E6BA 2G9WA 2R5YB 2IEKA 5JR3A 3TGNA 3ULQB 1R1UA 3DV8A 2DODA 5LD2C 1KU7A 4PJLA 4UVAA 3G71I 3CDLA 1I39A 2JA7J 2EZIA 1ZYRF 3V8LA 5BPIA 5CXIA 4C30A 3DPUA 3OYAA 1O3RA 1WGXA 3T8TA 2DMQA 4OINF 1AA7A 3K8PC 3LOCA 1IRGA 4XLCA 1UELB 4BJTA 2PZ9A 2M1BA 4KDPA 3I53A 1FOKA 3KZIC 3K4NA 5EF6A 3SWHA 5FB2A 4P96A 2NOGA 4XKWA 4QSHA 3L2UA 4IHTA 3KNWA 2KIQA 1S3JA 2K4JA 4NQWB 2VQLA 3KLOA 3ABUA 1RKWA 2JPCA 1FOYA 4GCVA 1EH8A 4HAMA 4OMZA 4XM3A 3GX4X 1W36D 2V1DA 1RNLA 4XIDA 5H6RA 2WV0A 1MKMA 1SVMA 3H9QA 2NNNA 4CYDA 2ICWG 1WJBA 3SDGA 3JRAA 1MBHA 3P7NA 5K5RA 3CC2I 4NDLA 2QF7A 2QWWA 2CS3A 2E71A 3BG7A 1ODDA 3IKVA 3K6GA 2CH0A 1Z0XA 2W48A 3I4PA 4Y3OA 3AAFA 2QTQA 1EA3A 1PUFA 3BCBA 3K1NA 3IAS2 1TQIA 4E7LA 1X1PA 2KIFA 3S2WA 3QOPA 2XAHA 2HYTA 1IDYA 4ENMA 2EJRA 2KDZA 5HLHA 2COMA 1HLVA 1NG7A 4WX9A 4XLNF 2LD5A 3LAJA 2E36A 4HX4A 1KGSA 3M7GA 1KZHA 3NS4A 2LY2A 2MA3A 5TRDA 2UWMA 1OCPA 4RGSA 1HA8A 2OQRA 3PFYA 4C2UA 3QODA 5CJ9A 2V7FA 1WH5A 3FDYA 3KZZA 1TP4A 2EV6A 2QQ8A 4UXNA 3S16J 3KETA 2RQQA 1TWCJ 3J7YJ 3PFIA 2V1UA 2JSPA 3BZ6A 4WXDA 3JTHA 3PUBA 2M5WA 3HOSA 2HU9A 1X3ZB 4GRIA 5KAIC 3RPUD 3HOYJ 4JP0A 3K69A 4ON0A 4BQOA 2HKXA 4X1EA 4UV9A 3GTQJ 1VQMI 2HOAA 3VOXA 1OR7A 1QHGA 3S5RA 2JUCA 3LA7A 1T95A 1FT9A 2F4IA 4C2MA 2QQBA 3A1YA 3MQ0A 1EH6A 5J8CA 5KAFC 3W2WA 4KWAA 5M5WJ 4ZH4F 3H1CA 3F6VA 3QU6A 4Q5SF 3KP6A 4QPQA 1ZRFA 1MNDA 3E5QA 4YFNF 2EIJH 2R7FA 4UB6C 3HTUA 4II3A 1G3WA 4JKZA 2M30A 4A12A 5D8LB 2EWNA 3G4SI 2R0QC 3NPIA 4XONA 4A3JJ 3HDDA 2CFOA 3LSMA 3PNTA 1UHSA 4EQQA 1JUSA 2HYFA 4BL0B 2NP5A 4UUSB 4MIMA 5E8GA 3JSJA 2PMUA 2WUIA 4XLPF 5EEAA 1R1TA 3OR1C 5L3DA 5HLIA 3V6GA 2A68F 3TDUC 2D1HA 1JGSA 5GAHJ 3I5UA 4V19K 4AVZA 1UZCA 1A6QA 3FX3A 1R9TJ 2FD5A 2QVOA 2VJIA 1RETA 4LJZF 5HNHA 2WAQN 3K2ZA 4HNUA 3BZCA 4BNCA 1DQUA 1EH7A 2Q24A 4M3DA 2HYJA 1FIPA 2I8DA 3E97A 2GOMA 1F1ZA 1AWCA 4IQ4A 3T5XA 3DKXA 2YVEA 2E2JJ 2DA3A 4BDZA 3LSHA 3AQTA 2PMZN 4CO8A 3QYEA 2QCOA 2W57A 3KEYA 4EJOA 2NXNB 2XHKA 3C7JA 3VTIA 4BE1A 1PVEA 3D5SC 3Q5FA 1V4RA 2B1EA 4BXFA 1ZELA 3JRDA 1VQ4I 3B6CA 3JRBA 2OU2A 2E7WA 4XSZF 4IRIA 2QIBA 4CDGA 1SFXA 3B02A 4R1HA 2M87A 3V7SA 3QQAA 1LFUP 5FGMA 2VBZA 1N25A 5JLXA 3CMYA 5EJCA 4WXCA 2E5NA 3M3YJ 4NNJA 1UAAA 2L7FP 3FMQA 3BDDA 2FBHA 2VJJA 4ENNA 1ETKA 1S7OA 4BHCA 4MHGA 3CP8A 3CCLI 4AIDA 4OOIA 3RSNA 2XAQA 2AXTC 1JKOC 3U1KA 1BOAA 4PJJA 5L3BA 5DM6F 2IS1A 4S04A 4XN3A 2FBIA 3KFWX 3GMEA 3IRQA 2O6GE 3RIRA 4G7HF 5AIPA 2TCTA 1WSUA 5HBUA 1PP8F 1S8NA 2XSJC 1XC5A 1QU3A 1I3AA 3E5XA 2W4SA 3KYDB 4XLFA 2WWYA 1U9NA 3GF2A 2YU3A 3H92A 2DDBA 1ZTRA 2E35A 3HKZN 2BXZA 3CUQA 1G6NA 1TWHJ 2XDVA 1HF0A 4LK0F 4F92B 3GZ5A 4M9ZA 1PUFB 5F04A 4EJTA 4LB5A 2KL4A 3K70D 3EGQA 1FPQA 3BZKA 4WXHA 5HLGA 3GW2A 3JSPA 5FHPA 3L2VA 4ZTJA 1FMVA 3CLQA 5KVRA 3OYJA 3SZPA 5B1BH 3HM5A 1Y0UA 2VI6A 1VQ8I 3EDPA 3TW6A 2GA1A 2ZBKA 4NHJA 3KPHA 4HSTA 2O61A 2GQQA 5D8KB 2K86A 1XSDA 3K0LA 3H36A 5KCMA 3SFIA 3I58A 4ZZLA 4JOMA 3BT9A 2HQ5A 2NS8A 3OY9A 1XTAA 1ON2A 2EFOA 1PDNC 4YIIA 2CQKA 3AG3H 4A3IJ 3ZN1A 4BE2A 1NK3P 1H9TA 2IT0A 2FNAA 2XB0X 1JE8A 4A3LJ 3AL0B 4KFCA 1G3SA 1MD0A 2EPFA 2NVTJ 4C2TA 2VKEA 5EDNA 2LF7A 3HUGB 2XAUA 4ZDLA 4Q47A 2XGEA 2CU7A 3BQZA 3BTJA 4BAYA 1P4AA 3HIFA 3I54A 5LFAA 2DMPA 2KMUA 1W1WE 4BJ6C 2DW4A 3WU0A 1QNTA 4XNFA 3S32A 2KLOA 1Z9CA 2LH9A 2WV1A 3RI4A 1L0OC 2PX9A 1IUYA 1E3OC 1X1DA 2ZJQF 3WTYC 2O3FA 5JVTA 2LVSA 3JSOA 2K9SA 4RAYA 1A04A 3FXKA 1ONVA 2MC3A 4ZYAA 3F8NA 3GCMA 5HDKA 3FMSA 1T0FC 4Z6YA 3G2BA 3HOWJ 3I4NJ 4O5VA 5EEHA 2BEOA 2MD0A 3J81K 4MEXF 2FOKA 2QUFA 2FJI1 1WI3A 4CZCA 1YFHA 2M7BA 3COLA 2DJIA 1LUJB 2R7QA 3BG5A 1YX5A 2UXPA 2STWA 2Z9OA 3UNGC 2EINH 3W3CA 3J80K 2XSDC 2CW0F 1IN5A 2TRTA 1NHAA 2V1NA 2K9NA 4YEJA 3TO9A 5IY5H 4KIBA 5K5QA 3EUHA 2OV7A 1NTCA 4U9NA 3FXRA 5CXGA 2KP6A 3ZPLA 3S8PA 2EFWA 1E3HA 2KIMA 2OZUA 4PSXA 1WWXA 5HDGA 2A6HF 3FM3A 2F2EA 4M6YA 1KU9A 2V9KA 4I01A 1X2MA 4PJNA 3CP2A 1QBJA 3OYIA 2GLOA 3S1MJ 3DP7A 4D5FA 2QM3A 4M9XA 1FLIA 2FQ4A 3AQSA 3MNLA 4W97A 2ZNZA 1DP3A 3FXQA 1STZA 3R60A 1EF4A 1YYVA 3D1NI 2LKXA 2WAEA 2HZTA 2NS7A 2CYYA 1ZREA 3FRQA 4CH7A 3F8MA 1S5LC 2HXIA 4EM2A 1TTYA 5IPAA 2YX7A 4IRVA 4IJAA 2WAQA 3A4CA 1VZ0A 3IP4B 3DBRB 1A6IA 2QBYA 2IGNA 4U7BA 2PMZA 2O7TA 2CQXA 3SHFA 5ED4A 5CQEA 2QA4I 3FM5A 2HVQA 4DGWB 2DO7A 3BP8A 2L01A 1VQOI 3HRSA 5EG0A 3CUQB 5HNFA 4KUMA 1V54H 2F4OB 3HYIA 5GAEJ 2ISZA 1T98A 5K58A 2VB6A 2DMNA 1UG2A 2X6XA 1KYZA 3DEUA 3BJBA 4AVPA 5A2QK 1Y56A 3DPLC 1E0EA 2YUSA 2ZCWA 1ZG3A 5D6EA 5M5XJ 2VPRA 1P4XA 4PZJA 4RAGA 4I0AA 2V57A 3A0BC 2FRHA 3ECOA 3G1OA 3OYHA 4MQVA 2LDUA 3EUKL 2L2OA 4UDSA 3IH2A 3KP2A 2IGOA 3G7RA 5J6XA 5FD5A 4ASNA 3F8CA 3QRFF 2K9QA 2EA4A 1B9NA 2H6CA 1G4DA 1RUOA 2H1KA 2H94A 5K7FA 1SFUA 4EEFG 3JRHA 2WTEA 1IN8A 2XRNA 3S3OA 3K9TA 3LMMA 4I98B 1SMYF 2LY9A 2ZXIA 3CUOA 3V42A 5E3LA 5EYRA 3MKYB 1A35A 2R7ZJ 1MJBA 4B47A 4ESJA 1UCRA 4HQEA 2LBFA 3TO7A 2PI0A 4IHSA 3K4JA 3HSFA 1IRZA 2RHAA 1ZRCA 1G3TA 5H9TA 2E19A 2MFZA 1A5JA 2EZKA 3BC8A 1FYLA 2EILH 4G6DA 1IZ1A 1ZN2A 2BBYA 4CYCB 2QQAA 5D18A 2Y9YA 2BW3A 3M8EA 3CCQI 3HKZA 1K6YA 2HPIA 2Y0SN 3HSEA 3QU3A 2GOXB 2P5LC 3BR0A 1QA6A 1ZLJA 2YS9A 1Z77A 1TNSA 2IPQX 3ML6A 2BY2A 4A0ZA 5DM7F 1I1GA 2GXBA 4ZDPA 3OYFA 1VTNC 2IXSA 3MMYB 2JVGA 1JI8A 4ICHA 5KNLA 2CUZA 5LLQA 2DQLA 5F6FA 3GTLJ 4G7ZF 2OZ6A 2DAOA 3BY6A 1WJ5A 4BU2A 4A3MJ 1D0YA 2AQFA 4JX4A 1MDMA 2WAFA 3JRCA 1JKQC 2MLGA 4CCOA 4HLYA 5DS9A 4WIBA 3BPVA 4AWXB 1IUFA 2RNJA 4WK8F 2ZC2A 2PJPA 1J7KA 1WJDA 4YFXF 2VQHA 1YE9A 3RJPA 5BQTA 3W6VA 2VN2A 1WKMA 2MH9A 1JUMA 2LTPA 2BY1A 1ZG5A 3L7WA 4J00A 2IS4A 2B63J 4JL3A 3VEPA 5JHUA 2OAZA 3F21A 1R6RA 2DFHA 5GPCA 3TOAA 2HDCA 1E2XA 3BG6A 2XUBA 4PGHA 3I55I 5E17F 4RLFA 4JYKA 1MBEA 2VLAA 2JZYA 3L9FA 3JRIA 4B43A 3E5UA 2KFDA 1U9OA 4HNTA 3CCEI 3LSRA 1ERDA 1FC3A 3FBIB 2X6OA 3T0YA 2XRLA 2EV5A 1BN5A 3HIMA 3G1MA 3DLAA 4A6DA 2XVCA 2OTJI 4D5CA 1XN7A 2RREA 1ZQ3P 1HDPA 2R7VA 4DYQA 2QGUA 2RGVA 2ZO4A 2R7XA 2G3BA 5DAJA 3VW0A 1K61A 3IKTA 2GXAA 4P9UA 3MKLA 4R8HA 4FHTA 3CCMI 1X1CA 3WE2A 5FRNA 2X1DA 2FBQA 2LSOA 2REKA 3PASA 2W84A 4IQJA 1GVJA 3JW4A 3V7CA 1YLFA 1AKHA 2Y30A 2A69F 3LSIA 3M8FA 5B66C 1U78A 1FJLA 4GCTA 4HF0A 2W1OA 2GM4A 1OYIA 4IHXA 2OI8A 2Y31A 1TT5B 3C2HA 4OWRB 2W25A 2P5KA 2WA0A 3DKYA 5H2FC 1B8IA 3HOXJ 1HW2A 1GV2A 3KE2A 2DA6A 4KNYA 5EFYA 2DXIA 5HSZA 3HOTA 4U9LA 4D7MA 2DT5A 2ZNYA 3I9V2 2DDAA 4LMYA 3H3UA 2VUMJ 1WJAA 2HQAA 4AYBN 4XQFA 1BBYA 1XPXA 4WF2A 3NARA 4ANJA 3BCGA 3CCYA 1HC8A 4U87A 4EVIA 4GCLA 2J5PA 3S14J 2ACJA 5B3SH 3OYLA 3G73A 3QBMA 4MK6A 3T6NA 1QQIA 2OF7A 4XKCA 2JA8J 3FXUA 5HAWA 5J4YA 2IRFG 2H27A 2BYVE 2ZXHA 2E5ZA 1DUXC 4XKVA 2XAJA 3F3XA 5E18F 3W6KB 2HKOA 3S93A 2CUEA 3U1DA 4ZDOA 3BR6A 3DTKA 1U3EM 2GIZA 1J59A 4UY8I 3RYRA 5FO5A 2Z5UA 2E7XA 3C2BA 4M9SA 5FLXZ 2K5CA 3IUOA 3P5JA 4WCGA 2OD5A 3RDIA 1JT6A 2JRTA 1LKXA 1I6XA 2ETHA 3IRRA 3BRUA 2K85A 3TP0A 4LG0A 2VXZA 2LKSA 2GIVA 3DKWA 4XRSA 2NNYA 3SJMA 1X19A 4PFOA 1KQ0A 2GUHA 5L3CA 3O60A 4L9VA 4CZZA 1FX7A 5K7HA 2M4KA 1BI3A 4M72A 1VF9A 5DD4A 5C4JJ 1ZLKA 2IA0A 2BW3B 2RASA 1IF1A 2ZCNA 1ORKA 1BI0A 3IL2A 2K9MA 1TLHB 1IAWA 4KT6A 3DLLF 2DBBA 3VOKA 2P0WA 3FXJA 4NELA 3OYEA 1MNMC 1M1EB 1D1BA 1P7IA 3VYRB 1SVLA 1SFKA 1YG2A 2BZTA 2EZHA 1IJWC 1TZLA 2VT3A 4BGDA 2DFIA 3S2HJ 3L09A 4U7DA 2NS0A 1A31A 2RV8A 1RPWA 2IA1A 3FHZA 2RQPA 2VIXA 4EGZA 3V78A 2GXGA 4E7HA 3W6JB 1J09A 1FIAA 2HZDA 1VQLI 2VODA 1YI2I 1MDMB 1XMXA 1P92A 1Z6RA 2HVSA 3OMYA 2M9HA 1X58A 3GEZA 4UHTA 1UG0A 2KKOA 5J1RA 1S7AA 2E34A 2L4MA 3A2KA 1V5EA 2KZGA 2LMDA 3LSKA 3L2WA 3FMRA 1GV5A 3UR3C 3ZQHA 3ZQFA 2RN7A 1RESA 3M4OJ 1H9GA 1JXSA 2L5QA 1U6GA 2L3DA 3QPLA 2Y69H 1JT0A 3LFKA 1WI9A 4A5MA 3O8GA 3H9GA 3JR9A 3M8JA 2Y0SA 1WCMJ 2R5ZA 1S7EA 5K7ZA 1X4OA 2F5VA 1B4AA 1IRFA 1QGPA 1W7PA 4BY7J 2FBKA 5J8FA 3F9KA 1BI1A 3PM1A 2ZB9A 2BVMA 2K7LA 3FWEA 3R0JA 2CG4A 2M34A 1R5HA 4UB8C 5BS6A 4PJ0C 4RM2A 1J0RA 1R58A 2FA5A 2LFBA 2EB7A 2HOTA 5J47A 3HOZJ 2MLKA 2CJJA 1LE8A 3HGGA 5LEJA 4WWCA 2F6CA 1OCOH 2JMWA 5JFRA 1XD7A 2ZMEC 1AKHB 3WTVC 4RM3A 1V55H 4XL9A 3WHCA 4HZFA 3QOEA 1GDTA 3OWTA 4ZZDA 4PUSA 3ABTA 1IW7F 1J75A 1D1CA 2D5VA 5M3FJ 2VBXA 1B8IB 3QPSA 2P5VA 3BNIA 1FWZA 3OSFA 1VQ5I 2A3SA 4HW0A 3S1NJ 1E3PA 4DBRA 3QP5A 3VP5A 5D1RA 4HV6A 1YRNA 3CJTB 3ERMA 2UXXA 3HSRA 4C9YA 4O6JA 2UXIA 4NC8A 1D1AA 4BUPA 5IP6A 1HSJA 2YVXA 2R7SA 2Q0OA 1OJLA 2KRCA 4HYEA 4U88A 4FX4A 1FP1D 4GCKA 3L1PA 1XMKA 3RH2A 3K1PA 1F5TA 2NX4A 3ZQQA 5TISC 1T6SA 3WTXC 1UHWA 3DTEA 4LFUA 1RR7A 3CZ6A 1TT0A 1Y8QB 2PG4A 2W00A 2CGPA 3GWZA 4XMYA 3IH4A 2VOPA 2PFVA 3VOEA 2CQNA 3VVYA 4FQGA 3CMMA 4NB5A 2DA7A 3PUFA 3U2RA 3HRMA 4ZJZA 1HKTA 4IRHA 5ERIA 2COBA 2BGCA 2W85A 5DEQA 3NAUA 1Y39A 1CF7A 2ZY9A 1OYYA 4RGUA 2HPMA 3WODF 3WHBA 3V8JA 1JUPA 2UZKA 5F27A 1RRJA 1FTTA 5CW8A 2Z16A 1JJ8C 1R5ID 4AYBA 5IT9K 4YFKF 5EZHA 2EFPA 4AM3A 3CRJA 2YPRA 2O8KA 2HOEA 3N97A 2ELHA 4HSRA 1MMSA 1Z91A 2DA1A 2VC0A 4Y13A 4L62A 5FRMA 1J2XA 4B1RA 4L5EA 5ICFA 4QPOA 3EUHC 5K1YA 4II2A 3AKZA 2V6EA 5ILSA 2Z1DA 4LGWA 3WG9A 1WQ2A 3KKDA 1KA8A 4ZTFA 1SD5A 3HTIA 3IC7A 3ZMVA 2M8EA 4C2MJ 2BV6A 2HFHA 3GO5A 4L0YB 1B1BA 2MYSA 1G3YA 3HHGA 2DMUA 4B3XA 3P9KA 4XLEA 5C44J 4D1QA 2V26A 4IX7A 2X48A 2NP3A 4A2UA 4CCMA 2XIGA 1J9IA 3HZJA 3CJNA 4RB0A 2OUMA 4XOPA 1S6LA 3ABKH 3QP6A 5CPRB 3MKWB 2QSHX 4A0YA 2E1MC 4YZEA 2K3PA 3RKYA 1ZG1A 1YQAA 2EBIA 5AIQA 1W5SA 3P9IA 5LBQA 3NRGA 3K4BA 1BOBA 2LOOA 5CVRA 4BYYA 4N9HA 2QENA 1D0ZA 2A5WA 3GVAA 3BQYA 3OYCA 2M3AA 4J19A 1FTZA 5E1ZB 2LC2A 2MH2A 4FT8A 4U0WA 4DVYP 2GWRA 3S17J 2ID6A 1LVKA 1SANA 2X4HA 4JX5A 2A07F 2VOOA 1Z6TA 2F5FA 1ACIA 5FKNA 1X1BA 1MSFC 2P7CB 2CUJA 2OC6A 5JHFA 4IHVA 3VYUB 4IKFA 4M3BA 5B5EC 4AC0A 2KPMA 1G8XA 2R5ZB 4LD5A 3D0SA 4E6KG 3VFZA 1T2KA 4HF1A 2K3FA 4RB2C 3G56A 1W7PB 2B0LA 4JQFA 3MD2A 2R7WA 3GFLA 1O7FA 2X6YA 4FE4A 2WBMA 3HE0A 2DK5A 2DQRA 4A0XA 4PCQA 2F5CA 2G7GA 3BCAA 1FBQA 3C1DA 5GADJ 3RPUA 5DD8A 3J7ZI 4Y17A 4PSWA 4KA4A 3WGGA 4E70A 4M3EA 3S3NA 1W0UA 4X6AJ 3GUDA 5E1WA 1SMTA 4QWQA 2ZSHB 4EJUA 1LE8B 1OPCA 1KQ9A 3CJDA 2H8WA 2MBFA 2Z3YA 3OS2A 2EIMH 3EPZA 2Z2SB 2ZOZA 4GDFA 3DEEA 2JRMA 3DFGA 1WPKA 1QPIA 3ZCOA 4B09A 3VW1A 5HLTA 1Y1WJ 1MMAA 1GLNA 1P9QC 2ADUA 4IEJA 3DXJF 4MXMA 3VIBA 4HF2A 4OIOF 1H89C 3O2PE 2JK3A 3ZQ7A 1YRNB 1IXRC 3BG3A 5E3NA 4L5IA 3OYDA 2QSGX 1XG1A 1WFXA 2X9DA 2KRFA 2IP2A 1OQYA 2ZSIB 1OMIA 2ME0A 2QKLB 3ERED 1MGTA 2V9PA 1Q1VA 4DNCA 5LRSA 3RTRA 1YIOA 4RMNA 4D7NA 3W2AA 4Z2YA 4QLCU 2ZJ2A 3VVXA 3CDHA 1O3SA 3B81A 5ICEA 2DT7B 3VSKA 1FYMA 2JVHA 3JRFA 2LF8A 2FNPA 3ZMDA 1SC7A 3S15J 2R4GA 1XDSA 4GYIA 3GTKJ 3OL4A 4HEA2 5ICCA 5GAGJ 3ESWB 2CV0A 2PBIA 2BY0A 3TBIA 2O0YA 2V9VA 3SZTA 3JRGA 1WVRA 1FYKA 3BR1A 4Y15A 2L4AA 5GTHC 1CF7B 2ECBA 3BROA 2M0CA 5E3MA 3FXOA 3ZRGA 2KIUA 4Y52J 2BXYA 3NWSA 3VB2A 4E4HA 2HS5A 4Y7NJ 1Z67A 2V1XA 4CCNA 1KYWA 3O8HA 3HOUJ 2HEOA 1UI6A 4LITA 4UVBA 1MMNA 2CO5A 2DOEA 2JPBA 1KU2A 2KQRA 1NG6A 2KT0A 2XB5A 3VYSB 4BBRJ 5C4XJ 4KN4X 2IS6A 3ZOBA 2R7UA 1ETXA 5GP9A 3GFIA 2HTSA 1SEUA 2FQ3A 4LLGF 5CQGA 3DTIA 1I50J 2ZCXA 2BE5F 2QYOA 2XGXA 1TNTA 5FJ8J 3LQQA 2XF5A 4BS9A 2QKOA 4BKXA 4AIJA 5BPDA 3VDXA 1G59A 2W53A 3TQNA 3MN2A 4HPQA 4BDYA 2DCEA 3WTWC 2PBXA 3SDBA 4E7SA 2HGCA 4XR6A 2PJRA 1HBXG 4I99C 2OA4A 4XK4A 2FEZA 2UXNA 3BPXA 4BACA 3BR3A 3TMOA 4DQ2A 1TWFJ 3I3LA 4TV7A 3E1SA 3BHQA 3IWZA 3PO3J 2A5YB 3KP7A 3M1CA 2A05A 2R7DA 4M3FA 4IHYA 2JA5J 3OL3A 4NUBA 3CCVI 3AG1H 4MFDA 1D3YA 3FZVA 2D2WA 2MG4A 1WH7A 3DPJA 5FFZA 2O5RA 3ROUA 3KEQA 3OYBA 2VONA 2DA4A 1R00A 5H6QA 1YTYA 2DOFA 1N75A 1W0TA 3H3VK 5D19A 4Y33A 4IOAF 1MMDA 3H35A 3PPBA 3CJRB 3RKQA 2XKPA 2LG4A 1QO0D 4ZYHA 1BJAA 3KYLA 4HDUA 1UB9A 1UHMA 2XC7A 3GYHX 3L2QA 1GHCA 3HHHA 2NOJB 1K7AA 4I0BA 3KP4A 5LHIA 5IYCJ 2CMPA 2L02A 4HX8A 1YW7A 3BJOA 2ZFUA 3B73A 1Y1VJ 3LWFA 2PQ8A 2CSOA 1IO2A 3ZMUA 2DK8A 2IBDA 4IPAA 1HCRA 1T56A 3I71A 1WJFA 4XICA 1IXSB 2OCEA 4XRFA 1T0FA 5FFXA 3S3MA 1YW9A 2LY1A 1SD6A 4L9JA 3KLNA 1WJCA 4NQWA 4LOCA 3F22A 3QYBA 4CGZA 4PGGA 4A3CJ 3NQOA 2OJED 4IRGA 4F55A 1R49A 1LB2A 1BL0A 3LA2A 5FROA 1J5YA 1FSHA 1QZEA 2WADA 1QVTA 4HBLA 1CGPA 1XSVA 2EA2A 2F5EA 1P2FA 1EJ9A 4P1WA 1V5GA 3BOQA 5DDGA 2VC1A 2LKPA 3NEUA 5AQCA 4CXFA 3VSLA 3HTHA 2JWTA 1JKPC 1L3LA 3LA3A 3H5AA 4XLHA 5CVJA 3J81Z 2Q2EA 5HDNA 2YX4A 1IXCA 4KT5C 3GLLA 2V6CA 4C3IJ 3TKYA 4AIKA 3HRTA 4HKUA 2BOLA 4M3GA 1LEAA 1RZ4A 4V2FA 1MIJA 3J80Z 4I6ZA 4ZYEA 2JJ7A 2VL8A 2UV1A 2KRHA 2HVRA 1OCCH 3CF5F 4C3JJ 2UXHA 1U5TA 2G7HA 1D0XA 3LNQA 1ITYA 1U2WA 2JN6A 2WC2A 3MVPA 3QPTA 1HQCA 1FP2A 3K7AJ 4HV5A 2BHYA 1I1SA 3EYIA 5D5VB 5ILVA 2JUGA 3LWJA 3VUQA 3V4GA 1F4KA 3DWLE 2LNBA 2PMHA 5FLVA 3K10A 2M4GA 2XV4S 5HS9A 1RIOH 1MBGA 2JTVA 3GTPJ 3OV8A 4BBSJ 3Q0UA 1TWGJ 4LB6B 2HR3A 4UV8A 2L7KA 3ANGA 4RDUA 3OS1A 4GFKA 4PDKA 4K2EA 5C4YA 1MH3A 2ZCMA 1ZKGA 2GZWA 3ON2A 3E3VA 4AU7A 2DPDA 1P6RA 4HX7A 2XDNA 5F1RA 1LDDA 1ETOA 1SD4A 4YELA 5HODA 2K4BA 2W24A 3M1EA 2LRDA 1R71A 3Q3SA 4OAYA 1TW3A 5TJJA 2RNGA 3FBNB 4O3MA 1ZGJA 2YR2A 4EJWA 3GZIA 2DA5A 4MTEA 4FTHA 5BMZA 3IUVA 2XAGA 1UJ8A 3PQJA 2E2IJ 2P8TA 4RB1A 2QBYB 1VNDA 3PSFA 4NC6A 1XSXA 1YJWI 5FKLA 1JTXA 1IV6A 2B3WA 3AL0C 1YW8A 1EKEA 3RKXA 2PJRB 3J7AY 3REOA 1R23A 5D5UB 5EG0B 1OR7C 1Z05A 3K4MA 4RGXA 3CWRA 3MZYA 3RKWA 1FMWA 3PNVA 3WE3A 2DJNA 4M74A 2L0KA 3ABLH 1K83J 5A2QZ 4UUSA 2VE9A 4CICA 2NVUB 1D8JA 3COAC 1W5TA 3BJ6A 4JK1X 3N4MA 1YO5C 2PLYA 3E0JB 5J40A 3K1MA 3LAPA 4IOCF 2L9NA 3ONQA 1LNWA 1UFMA 3NI7A 5L3EA 4ESBA 3CCSI 1ZGWA 1LVAA 4N4NB 1PYVA 4BQQA 3ON4A 2R3SA 1SVOA 3HBLA 5FKKA 2L7MP 2Y75A 4HG2A 1MJ9A 1Y8RB 4OAZA 5DV5A 4BQAA 3KP3A 3OIPA 5HS8A 3EETA 2OERA 1MBFA 1LDJA 3OYGA 3H5RA 2LBFB 1KQ8A 3U9GA 4UUVA 4OD5A 3HL2A 2VKHA 1U8BA 3FISA 2C6YA 5F0HA 1BM9A 1LFPA 5JVGF 3HTSB 1HKQA 2ELKA 1XGOA 3CQZJ 1K79A 5LHGA 1LJ9A 2Z33A 1SAXA 3I4MJ 4ETSA 1K4TA 2XF7A 5CVVA 1IRXA 2CQ7A 1F9NA 2DT6A 5DYMA 3PJRA 3FF5A 3PSIA 3DU5A 4U0VA 2IA2A 1FY7A 3T1BA 1OCRH 2R93J 3BLYA 2QKMB 2FX0A 2EH3A 1HOMA 5IYDJ 3KKCA 1X3WB 2VQGA 3S1QJ 4OU0A 3CESA 4R79A 2EQRA 3ZQLA 3WU1B 3ASOH 2W7NA 2JA2A 5LGTA 3E6CC 1MNEA 2L9VA 3GFJA 3F8FA 3CMAI 1JKRC 2H6BA 5L3GA 4RBOA 4C3HJ 2QZ8A 1UMQA 3JAMK 1MMGA 2HOSA 3ZMZA 4Y4RA 2I5UA 2XASA 4EV0A 1TBXA 1BR1A 4IL6C 4MGRA 3HPGA 1R7JA 2R7RA 1W36C 3HJEA 2FE3A 1AHDP 3A0HC 1X2NA 2Q2EB 4ZYGA 4A3FJ 5LRRA 2QEXI 2OQGA 3LSTA 1Z1DA 4A3DJ 4FETA 3K4CA 1X3UA 2B7EA 4G12A 1JHHA 2GAUA 1HW1A 4A3BJ 1DPRA 2XROA 4G94A 1YS6A 2A6TA 2K27A 1O3QA 4BHBA 1DGRM 1U5TB 4IVNA 2DLLA 2DA2A 3K2AA 3TO6A 5E79C 3C18A 4GXOA 3AG4H 1WRJA 2LYCA 1B72A 2QWTA 5DTDA 3CC4I 2N8GA 3NRVA 4BY1J 1TQPA 2VQCA 3CUQC 4AC6A 3I59A 3KEOA 3G6EI 3BR5A 4M73A
chains in the Genus database with same CATH topology
1A6IA 1D5YA 5IOYA 1G2HA 2ME6A 3S17J 2ID6A 1SANA 4JX5A 3S2DJ 3RQIA 2O7TA 2CQXA 2DTZA 5FKNA 3Q0WA 1MSFC 2UXOA 2NVXJ 4IHVA 2UXUA 4MLOA 2DG7A 3IH3A 4M3BA 4AC0A 1ZK8A 2R5ZB 3B6AA 4DZPA 5EG0A 2IAIA 5K58A 2DMNA 1UG2A 2R92J 2E2HJ 3G56A 2OPTA 3BJBA 1GT0C 1O4XA 2YUSA 5M5XJ 4DZJA 4FE4A 2XPVA 2F07A 2H8RA 3HE0A 2VPRA 3VW2A 3TP3A 1OFCX 3C07A 2G7GA 5JLWA 3BTCA 2V57A 2E1OA 2CUFA 3LSJA 3G1OA 1JJ6C 2ZOYA 1MBKA 1ZR4A 1RKTA 3EUPA 4UDSA 3IH2A 3ZQGA 3G7RA 4M3EA 2AO9A 3BR2A 1W0UA 3OOUA 3FIWA 4X6AJ 1FTZA 2K9QA 4DW6A 1LE8B 2H1KA 3CJDA 5K7FA 2WB1N 3VVZA 2G7SA 2AHQA 1VFCA 4EEFG 3JRHA 4IHWA 4JX6A 2ZOZA 2CRGA 4A3EJ 4HNVA 2LY9A 4MFEA 3BTIA 5E3LA 1WPKA 5EYRA 1QPIA 3DEWA 2R7ZJ 2NVYJ 2IU5A 3HTJA 3VW1A 1BJZA 4GFKA 4V2GA 1Y1WJ 2LK2A 2RHAA 1IRZA 2ECCA 3LHQA 2JA6J 5H9TA 2E19A 3LSGA 4IEJA 4MXMA 3VIBA 2EZKA 3OSGA 2R5YB 1H89C 2JK3A 2IEKA 4I76A 1YRNB 3BG3A 5E3NA 1IDZA 4CYCB 1XG1A 1FEXA 3F0CA 5D18A 1HDDC 1F43A 2X9DA 2Y9YA 2Y0SN 2XGDA 3CDLA 3BR0A 2ME0A 2JA7J 2YU9J 2EZIA 2YS9A 1OCTC 1Z77A 4A93J 3VPRA 5CXIA 1Q1VA 3A02A 5FGLA 2P81A 1WGXA 4D7NA 3H0GJ 2DMQA 3VVXA 3TEDA 1AU7A 3TW7A 3B81A 4ICHA 3LOCA 2M8GX 4XRMA 3JRFA 2PZ9A 2Y2ZA 3S15J 3GTLJ 5IP7J 5EF6A 3GTKJ 4QSHA 2NOGA 4A3MJ 4JX4A 4BXXJ 4ABZA 3NNRA 3G1LA 3JRCA 1RKWA 1A5JA 2MGQA 1JKQC 5DS9A 1IGNA 1IUFA 3JRGA 4XIDA 1H88C 1P7JA 3W6VA 3BR1A 2ID3A 1JUMA 2LTPA 1CQTA 4JL3A 2ECBA 2B63J 3F1BA 2M0CA 5E3MA 3DCFA 4A3GJ 3SDGA 3JRAA 1MBHA 5GPCA 3GTGJ 4Y52J 2L9RA 4NDLA 2QF7A 3HB9A 4B3AA 4JYKA 1MBEA 4Y7NJ 3O8HA 1UI6A 3HOUJ 3JRIA 1U9OA 3LSRA 1Z0XA 2W48A 3A01A 2Y9ZA 2QTQA 1PUFA 2X6OA 2XRLA 1BW6A 1ETWA 2KT0A 2XB5A 4BBRJ 3G1MA 5C4XJ 1TWAJ 3HIMA 9ANTA 3ZOBA 4D5CA 1ZQ3P 1HDPA 5F0CA 1ETXA 5GP9A 4DYQA 3GTOJ 2HYTA 5DAJA 1IDYA 2G3BA 2KDZA 4A3KJ 1K61A 3VW0A 2O7OA 5FMPA 3MKLA 1HLVA 1I50J 5J3LA 2ZCXA 5FJ8J 2LD5A 3ZQIA 2QKOA 4BKXA 2FBQA 2REKA 3PASA 2WGBA 2W53A 4DYCA 3MN2A 1OCPA 1AKHA 2Y30A 1FJLA 2PBXA 1U78A 4GCTA 1H8AC 2GM4A 4IHXA 2OI8A 2Y31A 4XK4A 1WH5A 3S16J 2HKUA 1TWCJ 2HDDA 3BR3A 5FKOA 1B8IA 1TWFJ 3HOXJ 1B72B 1GV2A 2MSYA 3HEFA 3BHQA 2DA6A 3PO3J 5EFYA 5J1UA 5FLMJ 5HSZA 3RZDJ 4XRSG 5EGOA 4D7MA 3HOYJ 4JP0A 4M3FA 4IHYA 2LP0A 4X1EA 2JA5J 3GTQJ 5F08A 2VUMJ 2HOAA 1IG7A 4MFDA 3S5RA 4AYBN 3VOXA 2MG4A 1WH7A 2D6YA 3DPJA 3NARA 2K40A 3BCGA 3CCYA 4GCLA 2I10A 4KWAA 2DA4A 5M5WJ 3S14J 3GEUA 1F36A 3QBMA 1W0TA 4MK6A 3H3VK 5D19A 3T6NA 2OF7A 2JA8J 3PPBA 4JKZA 3RKQA 5HAWA 1GUUA 5F1JA 2R0QC 1XS9A 3NPIA 3RD3A 4A3JJ 2HI3A 1TC3C 3HDDA 4CYCA 1UHSA 4S0HB 1JUSA 3A03A 3GBGA 2NP5A 4UUTA 4MIMA 4UUSB 2DG8A 3JSJA 2WUIA 5EEAA 2DN0A 5IYCJ 4CGRA 2CUEA 3V6GA 3BR6A 1DU6A 4MO7A 1Y1VJ 1I3QJ 3C2BA 5IOZA 1R9TJ 2FD5A 5BNGA 1RETA 2IBDA 1JT6A 1HCRA 1T56A 2WAQN 4XICA 3BRUA 3TP0A 5E3OA 2EZLA 4XRSA 2Q24A 4M3DA 2HYJA 1FIPA 3SJMA 4DYRA 2YVEA 2E2JJ 2DA3A 2GUHA 3AQTA 3E7QA 3O60A 2PMZN 2QCOA 4LOCA 5K7HA 4FCYA 4A3CJ 1JTYA 1VF9A 5C4JJ 1BL0A 2RASA 2ZCNA 1ORKA 1QVTA 1GVDA 3LSPA 4GFLA 4QTRA 3JRDA 3VOKA 1ETQA 5C3EJ 1DU0A 3B6CA 3FK7A 1ZR2A 3JRBA 1MNMC 4NELA 2QIBA 5EZGA 4A69C 5AQCA 3HTHA 1P7IA 4NN1A 2JWTA 1JKPC 1IJWC 2EZHA 3QQAA 1LFUP 3S2HJ 5JLXA 3CMYA 2CQQA 4C3IJ 1IC8A 3M3YJ 1RPWA 4HKUA 4M3GA 4V2FA 2L7FP 3V78A 1ETKA 4I6ZA 2JJ7A 1POGA 3GTMJ 1FIAA 3FK6A 1MH4A 4C3JJ 4GFBA 2UXHA 4W1UA 1ENHA 3LNQA 1ITYA 1JKOC 2JN6A 3MVPA 3RZOJ 2M9HA 1X58A 3PO2J 3S1RJ 3K7AJ 5J1RA 2TCTA 2MW8A 2XGCA 3LWJA 3M4OJ 3KNWA 3ZQHA 1GV5A 1BA5A 5HBUA 3ZQFA 3VUQA 1RESA 3UKGA 3BTLA 1XC5A 5FLVA 2YVHA 3QPLA 1MBGA 4B4CA 1U9NA 1JT0A 3GTPJ 3O8GA 4BBSJ 3Q0UA 3FKIJ 1TWGJ 3JR9A 1ZTRA 2L7ZA 3HKZN 1WCMJ 4RDUA 1S7EA 5K7ZA 1LFBA 2R5ZA 1TWHJ 3ANGA 1MH3A 1HF0A 2ZCMA 1ZKGA 5C4YA 3A01B 3ON2A 2LLKA 4BY7J 5F04A 1PUFB 3HOVJ 1MSEC 2XDNA 3PM1A 1ETOA 5HODA 2ZB9A 3EGQA 3Q3SA 4FISA 2M34A 5FHPA 3GZIA 1MBJA 2DA5A 5GPAA 4FTHA 3IUVA 4AF5A 3HM5A 5M3MJ 2E2IJ 2VI6A 2LFBA 4FE7A 3TW6A 2HOTA 3HOZJ 3JREA 1VNDA 4ACIA 4QIWN 3HTAA 2CJJA 5IYBJ 1LE8A 3HGGA 5FKLA 1JTXA 3GTJJ 1IV6A 2M2EA 2JMWA 3SFIA 1AKHB 2NVQJ 3WHCA 3BT9A 2HQ5A 2NS8A 5EG0B 1GDTA 3CWRA 3E7LA 5IP9J 2D5VA 2G7LA 3LJLA 4A3IJ 5M3FJ 3KZ9A 1B8IB 3QPSA 3BNIA 4ME9A 2DJNA 1NK3P 3OSFA 3IV5A 2L0KA 3S1NJ 1K83J 2GBYA 2XB0X 2R5YA 4A3LJ 3NXCA 5EGOB 4UUSA 1YRNA 5D1RA 3VP5A 3ZQCA 2NVTJ 2XPUA 1VI0A 2VKEA 5EDNA 2UXIA 3NI7A 2VKVA 2XGEA 5IP6A 2CU7A 3BQZA 2FJ1A 3BTJA 1ZGWA 3ON4A 1OJLA 2DMPA 3HBLA 5FKKA 4AUXA 1NK2P 2L7MP 5M5YJ 4GCKA 3ANPA 2WV1A 3L1PA 1E3OC 2DMTA 3RH2A 2OERA 1MBFA 5FKMA 2NX4A 1U8BA 2LVSA 3FISA 5F0HA 1BW5A 2K9SA 1RR7A 3HGYA 2LR8A 2ELKA 3CQZJ 3IH4A 3I4MJ 3VVYA 3HOWJ 3I4NJ 1T33A 2DA7A 1QVUA 1WI3A 2GFNA 2COBA 1I6HJ 3NAUA 3COLA 3BG5A 2UXPA 2G0EA 2R93J 3WHBA 2FX0A 2EH3A 2XSDC 5IYDJ 1HOMA 3KKCA 3S1QJ 1JUPA 5F27A 2EQRA 3ZQLA 1FTTA 5CW8A 2TRTA 1JJ8C 2K9NA 1JGGA 2XPWA 1ETYA 4M6VA 5EZHA 1JKRC 3CRJA 1NTCA 3QKXA 2O8KA 5CXGA 4RBOA 4C3HJ 1APLC 1UMQA 2DA1A 1SFOJ 1UI5A 4L62A 2HOSA 1ETVA 4B1RA 4L5EA 2GENA 4JNNA 3Q0VA 3KKDA 3P9TA 3HTIA 1QRYA 1X2MA 1AHDP 3S1MJ 2GLOA 3BG9A 4C2MJ 1X2NA 2QOPA 4D5FA 2O9LA 4A3FJ 2FQ4A 3AQSA 3MNLA 4W97A 5C44J 2DMUA 1EF4A 3D1NI 2LKXA 2X48A 4A3DJ 2NP3A 3OIOA 4G12A 2RAEA 5F0FA 2NS7A 4A3BJ 5J1YA 4PXIA 1SGMA 4YZEA 3FRQA 2DA2A 2EBIA 3K2AA 3NRGA 1B72A 2QWTA 2HXOA 2HXIA 5IPAA 5DTDA 2N8GA 4BY1J 4AC6A 3BR5A 3BQYA 4J19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A6I A;  1D5Y A;  5IOY A;  1G2H A;  2ME6 A;  3S17 J;  2ID6 A;  1SAN A;  4JX5 A;  3S2D J;  3RQI A;  2O7T A;  2CQX A;  2DTZ A;  5FKN A;  3Q0W A;  1MSF C;  2UXO A;  2NVX J;  4IHV A;  2UXU A;  4MLO A;  2DG7 A;  3IH3 A;  4M3B A;  4AC0 A;  1ZK8 A;  2R5Z B;  3B6A A;  4DZP A;  5EG0 A;  2IAI A;  5K58 A;  2DMN A;  1UG2 A;  2R92 J;  2E2H J;  3G56 A;  2OPT A;  3BJB A;  1GT0 C;  1O4X A;  2YUS A;  5M5X J;  4DZJ A;  4FE4 A;  2XPV A;  2F07 A;  2H8R A;  3HE0 A;  2VPR A;  3VW2 A;  3TP3 A;  1OFC X;  3C07 A;  2G7G A;  5JLW A;  3BTC A;  2V57 A;  2E1O A;  2CUF A;  3LSJ A;  3G1O A;  1JJ6 C;  2ZOY A;  1MBK A;  1ZR4 A;  1RKT A;  3EUP A;  4UDS A;  3IH2 A;  3ZQG A;  3G7R A;  4M3E A;  2AO9 A;  3BR2 A;  1W0U A;  3OOU A;  3FIW A;  4X6A J;  1FTZ A;  2K9Q A;  4DW6 A;  1LE8 B;  2H1K A;  3CJD A;  5K7F A;  2WB1 N;  3VVZ A;  2G7S A;  2AHQ A;  1VFC A;  4EEF G;  3JRH A;  4IHW A;  4JX6 A;  2ZOZ A;  2CRG A;  4A3E J;  4HNV A;  2LY9 A;  4MFE A;  3BTI A;  5E3L A;  1WPK A;  5EYR A;  1QPI A;  3DEW A;  2R7Z J;  2NVY J;  2IU5 A;  3HTJ A;  3VW1 A;  1BJZ A;  4GFK A;  4V2G A;  1Y1W J;  2LK2 A;  2RHA A;  1IRZ A;  2ECC A;  3LHQ A;  2JA6 J;  5H9T A;  2E19 A;  3LSG A;  4IEJ A;  4MXM A;  3VIB A;  2EZK A;  3OSG A;  2R5Y B;  1H89 C;  2JK3 A;  2IEK A;  4I76 A;  1YRN B;  3BG3 A;  5E3N A;  1IDZ A;  4CYC B;  1XG1 A;  1FEX A;  3F0C A;  5D18 A;  1HDD C;  1F43 A;  2X9D A;  2Y9Y A;  2Y0S N;  2XGD A;  3CDL A;  3BR0 A;  2ME0 A;  2JA7 J;  2YU9 J;  2EZI A;  2YS9 A;  1OCT C;  1Z77 A;  4A93 J;  3VPR A;  5CXI A;  1Q1V A;  3A02 A;  5FGL A;  2P81 A;  1WGX A;  4D7N A;  3H0G J;  2DMQ A;  3VVX A;  3TED A;  1AU7 A;  3TW7 A;  3B81 A;  4ICH A;  3LOC A;  2M8G X;  4XRM A;  3JRF A;  2PZ9 A;  2Y2Z A;  3S15 J;  3GTL J;  5IP7 J;  5EF6 A;  3GTK J;  4QSH A;  2NOG A;  4A3M J;  4JX4 A;  4BXX J;  4ABZ A;  3NNR A;  3G1L A;  3JRC A;  1RKW A;  1A5J A;  2MGQ A;  1JKQ C;  5DS9 A;  1IGN A;  1IUF A;  3JRG A;  4XID A;  1H88 C;  1P7J A;  3W6V A;  3BR1 A;  2ID3 A;  1JUM A;  2LTP A;  1CQT A;  4JL3 A;  2ECB A;  2B63 J;  3F1B A;  2M0C A;  5E3M A;  3DCF A;  4A3G J;  3SDG A;  3JRA A;  1MBH A;  5GPC A;  3GTG J;  4Y52 J;  2L9R A;  4NDL A;  2QF7 A;  3HB9 A;  4B3A A;  4JYK A;  1MBE A;  4Y7N J;  3O8H A;  1UI6 A;  3HOU J;  3JRI A;  1U9O A;  3LSR A;  1Z0X A;  2W48 A;  3A01 A;  2Y9Z A;  2QTQ A;  1PUF A;  2X6O A;  2XRL A;  1BW6 A;  1ETW A;  2KT0 A;  2XB5 A;  4BBR J;  3G1M A;  5C4X J;  1TWA J;  3HIM A;  9ANT A;  3ZOB A;  4D5C A;  1ZQ3 P;  1HDP A;  5F0C A;  1ETX A;  5GP9 A;  4DYQ A;  3GTO J;  2HYT A;  5DAJ A;  1IDY A;  2G3B A;  2KDZ A;  4A3K J;  1K61 A;  3VW0 A;  2O7O A;  5FMP A;  3MKL A;  1HLV A;  1I50 J;  5J3L A;  2ZCX A;  5FJ8 J;  2LD5 A;  3ZQI A;  2QKO A;  4BKX A;  2FBQ A;  2REK A;  3PAS A;  2WGB A;  2W53 A;  4DYC A;  3MN2 A;  1OCP A;  1AKH A;  2Y30 A;  1FJL A;  2PBX A;  1U78 A;  4GCT A;  1H8A C;  2GM4 A;  4IHX A;  2OI8 A;  2Y31 A;  4XK4 A;  1WH5 A;  3S16 J;  2HKU A;  1TWC J;  2HDD A;  3BR3 A;  5FKO A;  1B8I A;  1TWF J;  3HOX J;  1B72 B;  1GV2 A;  2MSY A;  3HEF A;  3BHQ A;  2DA6 A;  3PO3 J;  5EFY A;  5J1U A;  5FLM J;  5HSZ A;  3RZD J;  4XRS G;  5EGO A;  4D7M A;  3HOY J;  4JP0 A;  4M3F A;  4IHY A;  2LP0 A;  4X1E A;  2JA5 J;  3GTQ J;  5F08 A;  2VUM J;  2HOA A;  1IG7 A;  4MFD A;  3S5R A;  4AYB N;  3VOX A;  2MG4 A;  1WH7 A;  2D6Y A;  3DPJ A;  3NAR A;  2K40 A;  3BCG A;  3CCY A;  4GCL A;  2I10 A;  4KWA A;  2DA4 A;  5M5W J;  3S14 J;  3GEU A;  1F36 A;  3QBM A;  1W0T A;  4MK6 A;  3H3V K;  5D19 A;  3T6N A;  2OF7 A;  2JA8 J;  3PPB A;  4JKZ A;  3RKQ A;  5HAW A;  1GUU A;  5F1J A;  2R0Q C;  1XS9 A;  3NPI A;  3RD3 A;  4A3J J;  2HI3 A;  1TC3 C;  3HDD A;  4CYC A;  1UHS A;  4S0H B;  1JUS A;  3A03 A;  3GBG A;  2NP5 A;  4UUT A;  4MIM A;  4UUS B;  2DG8 A;  3JSJ A;  2WUI A;  5EEA A;  2DN0 A;  5IYC J;  4CGR A;  2CUE A;  3V6G A;  3BR6 A;  1DU6 A;  4MO7 A;  1Y1V J;  1I3Q J;  3C2B A;  5IOZ A;  1R9T J;  2FD5 A;  5BNG A;  1RET A;  2IBD A;  1JT6 A;  1HCR A;  1T56 A;  2WAQ N;  4XIC A;  3BRU A;  3TP0 A;  5E3O A;  2EZL A;  4XRS A;  2Q24 A;  4M3D A;  2HYJ A;  1FIP A;  3SJM A;  4DYR A;  2YVE A;  2E2J J;  2DA3 A;  2GUH A;  3AQT A;  3E7Q A;  3O60 A;  2PMZ N;  2QCO A;  4LOC A;  5K7H A;  4FCY A;  4A3C J;  1JTY A;  1VF9 A;  5C4J J;  1BL0 A;  2RAS A;  2ZCN A;  1ORK A;  1QVT A;  1GVD A;  3LSP A;  4GFL A;  4QTR A;  3JRD A;  3VOK A;  1ETQ A;  5C3E J;  1DU0 A;  3B6C A;  3FK7 A;  1ZR2 A;  3JRB A;  1MNM C;  4NEL A;  2QIB A;  5EZG A;  4A69 C;  5AQC A;  3HTH A;  1P7I A;  4NN1 A;  2JWT A;  1JKP C;  1IJW C;  2EZH A;  3QQA A;  1LFU P;  3S2H J;  5JLX A;  3CMY A;  2CQQ A;  4C3I J;  1IC8 A;  3M3Y J;  1RPW A;  4HKU A;  4M3G A;  4V2F A;  2L7F P;  3V78 A;  1ETK A;  4I6Z A;  2JJ7 A;  1POG A;  3GTM J;  1FIA A;  3FK6 A;  1MH4 A;  4C3J J;  4GFB A;  2UXH A;  4W1U A;  1ENH A;  3LNQ A;  1ITY A;  1JKO C;  2JN6 A;  3MVP A;  3RZO J;  2M9H A;  1X58 A;  3PO2 J;  3S1R J;  3K7A J;  5J1R A;  2TCT A;  2MW8 A;  2XGC A;  3LWJ A;  3M4O J;  3KNW A;  3ZQH A;  1GV5 A;  1BA5 A;  5HBU A;  3ZQF A;  3VUQ A;  1RES A;  3UKG A;  3BTL A;  1XC5 A;  5FLV A;  2YVH A;  3QPL A;  1MBG A;  4B4C A;  1U9N A;  1JT0 A;  3GTP J;  3O8G A;  4BBS J;  3Q0U A;  3FKI J;  1TWG J;  3JR9 A;  1ZTR A;  2L7Z A;  3HKZ N;  1WCM J;  4RDU A;  1S7E A;  5K7Z A;  1LFB A;  2R5Z A;  1TWH J;  3ANG A;  1MH3 A;  1HF0 A;  2ZCM A;  1ZKG A;  5C4Y A;  3A01 B;  3ON2 A;  2LLK A;  4BY7 J;  5F04 A;  1PUF B;  3HOV J;  1MSE C;  2XDN A;  3PM1 A;  1ETO A;  5HOD A;  2ZB9 A;  3EGQ A;  3Q3S A;  4FIS A;  2M34 A;  5FHP A;  3GZI A;  1MBJ A;  2DA5 A;  5GPA A;  4FTH A;  3IUV A;  4AF5 A;  3HM5 A;  5M3M J;  2E2I J;  2VI6 A;  2LFB A;  4FE7 A;  3TW6 A;  2HOT A;  3HOZ J;  3JRE A;  1VND A;  4ACI A;  4QIW N;  3HTA A;  2CJJ A;  5IYB J;  1LE8 A;  3HGG A;  5FKL A;  1JTX A;  3GTJ J;  1IV6 A;  2M2E A;  2JMW A;  3SFI A;  1AKH B;  2NVQ J;  3WHC A;  3BT9 A;  2HQ5 A;  2NS8 A;  5EG0 B;  1GDT A;  3CWR A;  3E7L A;  5IP9 J;  2D5V A;  2G7L A;  3LJL A;  4A3I J;  5M3F J;  3KZ9 A;  1B8I B;  3QPS A;  3BNI A;  4ME9 A;  2DJN A;  1NK3 P;  3OSF A;  3IV5 A;  2L0K A;  3S1N J;  1K83 J;  2GBY A;  2XB0 X;  2R5Y A;  4A3L J;  3NXC A;  5EGO B;  4UUS A;  1YRN A;  5D1R A;  3VP5 A;  3ZQC A;  2NVT J;  2XPU A;  1VI0 A;  2VKE A;  5EDN A;  2UXI A;  3NI7 A;  2VKV A;  2XGE A;  5IP6 A;  2CU7 A;  3BQZ A;  2FJ1 A;  3BTJ A;  1ZGW A;  3ON4 A;  1OJL A;  2DMP A;  3HBL A;  5FKK A;  4AUX A;  1NK2 P;  2L7M P;  5M5Y J;  4GCK A;  3ANP A;  2WV1 A;  3L1P A;  1E3O C;  2DMT A;  3RH2 A;  2OER A;  1MBF A;  5FKM A;  2NX4 A;  1U8B A;  2LVS A;  3FIS A;  5F0H A;  1BW5 A;  2K9S A;  1RR7 A;  3HGY A;  2LR8 A;  2ELK A;  3CQZ J;  3IH4 A;  3I4M J;  3VVY A;  3HOW J;  3I4N J;  1T33 A;  2DA7 A;  1QVU A;  1WI3 A;  2GFN A;  2COB A;  1I6H J;  3NAU A;  3COL A;  3BG5 A;  2UXP A;  2G0E A;  2R93 J;  3WHB A;  2FX0 A;  2EH3 A;  2XSD C;  5IYD J;  1HOM A;  3KKC A;  3S1Q J;  1JUP A;  5F27 A;  2EQR A;  3ZQL A;  1FTT A;  5CW8 A;  2TRT A;  1JJ8 C;  2K9N A;  1JGG A;  2XPW A;  1ETY A;  4M6V A;  5EZH A;  1JKR C;  3CRJ A;  1NTC A;  3QKX A;  2O8K A;  5CXG A;  4RBO A;  4C3H J;  1APL C;  1UMQ A;  2DA1 A;  1SFO J;  1UI5 A;  4L62 A;  2HOS A;  1ETV A;  4B1R A;  4L5E A;  2GEN A;  4JNN A;  3Q0V A;  3KKD A;  3P9T A;  3HTI A;  1QRY A;  1X2M A;  1AHD P;  3S1M J;  2GLO A;  3BG9 A;  4C2M J;  1X2N A;  2QOP A;  4D5F A;  2O9L A;  4A3F J;  2FQ4 A;  3AQS A;  3MNL A;  4W97 A;  5C44 J;  2DMU A;  1EF4 A;  3D1N I;  2LKX A;  2X48 A;  4A3D J;  2NP3 A;  3OIO A;  4G12 A;  2RAE A;  5F0F A;  2NS7 A;  4A3B J;  5J1Y A;  4PXI A;  1SGM A;  4YZE A;  3FRQ A;  2DA2 A;  2EBI A;  3K2A A;  3NRG A;  1B72 A;  2QWT A;  2HXO A;  2HXI A;  5IPA A;  5DTD A;  2N8G A;  4BY1 J;  4AC6 A;  3BR5 A;  3BQY A;  4J19 A; 
#chains in the Genus database with same CATH topology
 4HDV A;  3ZGK A;  1G2H A;  2ME6 A;  1T38 A;  3RQI A;  3WTU C;  4G6T B;  3SFZ A;  2DTZ A;  3Q0W A;  2UXO A;  2UXU A;  4MLO A;  2DG7 A;  3W2V A;  3IH3 A;  5HS7 A;  3KYC B;  5CVU A;  1X4P A;  2E1N A;  2M0M A;  2VBY A;  4G9Y A;  5LEK A;  3MEX A;  2IAI A;  2DYS H;  1B9M A;  3GXO A;  3KIO A;  1NH3 A;  2E2H J;  2NYX A;  2OPT A;  3K4K A;  3VWB A;  1S9H A;  2WY7 Q;  4GYG A;  2BHZ A;  1O4X A;  1GT0 C;  3CME I;  2V79 A;  2F07 A;  2XPV A;  4BQN A;  2H8R A;  1VQP I;  2M45 A;  1VQ9 I;  1OFC X;  5JLW A;  1R4N B;  1N78 A;  4OMY A;  2CUF A;  3LSJ A;  5B1A H;  3CDI A;  2JQ7 A;  2ZXW H;  1MBK A;  4KYW A;  3QPH A;  3O3K A;  1HST A;  3HC7 A;  3BR2 A;  3R6S A;  4ESF A;  3FIW A;  3OOU A;  1K78 A;  3ABM H;  4YIR X;  3HUG A;  1I27 A;  3IWF A;  2WB1 N;  3VVZ A;  1V5F A;  2G7S A;  4XLA A;  2AHQ A;  3RQ4 A;  4N0B A;  4JX6 A;  2CRG A;  2HQN A;  4MFE A;  2EK5 A;  1DPU A;  1W5C C;  3HTJ A;  4IO9 F;  3DEW A;  3CC7 I;  2NVY J;  4KMF A;  2LK2 A;  3L2R A;  2YSR A;  3SEQ A;  4G6Q A;  4X0G A;  1DGW Y;  3EYY A;  4HQM A;  1B59 A;  4I76 A;  1OLT A;  5CKT A;  4DIQ A;  1IDZ A;  1FEX A;  3F0C A;  3KCC A;  3MFK A;  1HDD C;  1F43 A;  3PIO F;  3HRU A;  4L9T A;  2XGD A;  2P7V B;  3E6D A;  3SXY A;  3FKJ A;  4KN7 X;  1FBU A;  1OCT C;  1WHU A;  5DUI A;  2YU9 J;  2DOA A;  4ENJ A;  3WU2 C;  3Q9V A;  3VPR A;  2D45 A;  4A93 J;  1YS7 A;  2NRA C;  5DCM A;  3A02 A;  5FGL A;  1PUE E;  4DOZ A;  3LL7 A;  1RI7 A;  2P81 A;  1XGM A;  3TOB A;  3CCR I;  3H0G J;  1IV8 A;  1WJE A;  3PQK A;  1YX3 A;  2F5D A;  2AS5 F;  3TED A;  3GLX A;  1AU7 A;  3TW7 A;  4PJM A;  4I2O A;  3OOP A;  5D4S A;  4F93 B;  2VBW A;  2M8G X;  4LG0 B;  4XRM A;  1VQK I;  1R4M B;  3HG9 A;  2Y2Z A;  1PP7 U;  5IP7 J;  3ELK A;  3NNR A;  4BXX J;  4ABZ A;  1VQ7 I;  3BJA A;  3G1L A;  3HXL A;  4RAZ A;  5D4R A;  2X85 A;  1Z21 A;  3H3Z A;  2MGQ A;  3CTA A;  1IGN A;  4N9I A;  5KHD A;  1H88 C;  1P7J A;  3QAH A;  4B44 A;  2XF6 A;  4J01 A;  2L9S A;  2EFQ A;  4N4O B;  2ID3 A;  5DCF A;  3P9C A;  5J4V A;  1CQT A;  2ISY A;  3F1B A;  3DCF A;  4MNU A;  1GXP A;  4A3G J;  2CFX A;  2E60 A;  2RC4 A;  3GTG J;  1WZ2 A;  4E7Z A;  4OD4 A;  4RS8 A;  2L9R A;  5D5X B;  1BI2 A;  3HB9 A;  4B3A A;  3WTT C;  4M6X A;  4S05 A;  3F23 A;  3D5R C;  3A01 A;  3JTG A;  2Y9Z A;  4H4K C;  2RDP A;  3MAJ A;  1YIT I;  1XCV A;  1BW6 A;  1ETW A;  4NBQ A;  4BE0 A;  2H1L A;  1TWA J;  9ANT A;  1O3T A;  2ZJR F;  3KP5 A;  4AIH A;  3CO7 C;  1XCB A;  5F0C A;  4F3Q A;  3JAM Z;  4I7H A;  3GTO J;  1SFE A;  4A3K J;  3T8R A;  2O7O A;  5FMP A;  3E6M A;  3KX2 A;  4CA0 A;  3O6B B;  5J3L A;  3CLO A;  3FHN A;  3ZMS A;  3ZQI A;  2QQ9 A;  2OCC H;  2WGB A;  1R36 A;  4DYC A;  2DYR H;  3C2G A;  4PK4 A;  2Q8K A;  1BC8 C;  1MW7 A;  4KIC A;  1ZH5 A;  4B48 A;  4OIQ F;  2CW7 A;  1H8A C;  2HNH A;  4CCK A;  3R4K A;  2IJL A;  3OYK A;  5E20 A;  2O8X A;  2HKU A;  4LLL A;  4I09 A;  4BJ5 C;  2HDD A;  5FKO A;  3C3W A;  2UUZ A;  3K4L A;  1ZRD A;  1B72 B;  1RC9 A;  2ZFW A;  4LK1 F;  1REP C;  2MSY A;  1USS A;  3HEF A;  2AXL A;  5J1U A;  5FLM J;  3RZD J;  2R7O A;  3I59 B;  4XRS G;  5E1X A;  5EGO A;  2ZME A;  4IXA A;  2EFN A;  3K70 C;  1YJ9 I;  2X51 A;  2KJC A;  2O03 A;  2LP0 A;  5F08 A;  1VQN I;  1IG7 A;  2HQR A;  4CCL A;  2IGM A;  2D6Y A;  2K40 A;  2VPL A;  1XGN A;  2PEX A;  2FML A;  3WGH A;  2I10 A;  1GXQ A;  4XKB A;  3DQV C;  4M71 A;  4KMU X;  3IAM 2;  3GEU A;  1IN4 A;  1F36 A;  4RB3 C;  2F48 A;  2DFE A;  4LIV A;  2Y0M A;  4U0Y A;  5HOO A;  2X0L A;  2FMY A;  2KHM A;  3DBL B;  3ZP5 A;  1GUU A;  4UVC A;  5F1J A;  1XS9 A;  2WY8 Q;  2STT A;  3RD3 A;  4IF4 A;  2HI3 A;  2MAB A;  1TC3 C;  4CYC A;  4S0H B;  3A03 A;  1Y6I A;  4KIF A;  4MQ9 F;  1UST A;  4B8X A;  1R22 A;  3GBG A;  5IT3 A;  1U8R A;  4UUT A;  2DG8 A;  4A5N A;  1OCZ H;  5LHH A;  2DN0 A;  4CGR A;  4BHP A;  1K78 B;  5JI6 A;  2M7A A;  1DU6 A;  1I5Z A;  1YJN I;  4MO7 A;  1PJR A;  5ICG A;  1I3Q J;  1XGS A;  2FF4 A;  2VJ4 A;  1HXD A;  4Q4Z F;  2EV0 A;  4KJZ A;  5IOZ A;  3CCJ I;  1ZGA A;  5BNG A;  3ZXS A;  2RVC A;  1D8K A;  4P5O A;  5E3O A;  3TDZ C;  2CV1 A;  2EZL A;  1FNN A;  4DJA A;  1XB4 A;  1BIB A;  3RYP A;  1QZZ A;  3QYF A;  4DYR A;  2VAS A;  4I02 A;  3E7Q A;  2ZKZ A;  4JBA A;  4CUG A;  5LGN A;  3AG2 H;  4FCY A;  1JTY A;  1S29 A;  3DU6 A;  4CSW A;  1S72 I;  2TDX A;  2R7T A;  2XAF A;  5BOX A;  1GVD A;  2W82 A;  3LSP A;  4GFL A;  4QTR A;  3SZG A;  1ETQ A;  3ECH A;  5C3E J;  1DU0 A;  5D6F A;  2P6T A;  3FK7 A;  5DCM B;  1ZR2 A;  1ZAO A;  5EZG A;  3R61 A;  2J5O A;  4A69 C;  1E17 A;  4EAT A;  4NN1 A;  4RLQ A;  3WGI A;  4L0Z B;  3F8B A;  2KDO A;  4BEH A;  1LEB A;  1LPQ A;  5K5O A;  2BVL A;  3RCO A;  1ZAR A;  4ZYD A;  2DPU A;  3TL4 X;  2CQQ A;  1IC8 A;  3ISP A;  3F72 A;  2IGK A;  3SQN A;  1DP7 P;  5E8I A;  3SEZ A;  4EM1 A;  1POG A;  3GTM J;  3PL8 A;  3FK6 A;  5CYV A;  1MH4 A;  1QHH D;  1C0W A;  1XMA A;  4GFB A;  2VT2 A;  3ZN0 A;  2VXD A;  3EUA A;  3ZMT A;  4W1U A;  1ENH A;  2WB1 A;  3LFU A;  5IT9 Z;  3RZO J;  1FBS A;  4F52 A;  3PO2 J;  3S1R J;  4XOR A;  1QPM A;  1U5T C;  2DFF A;  2MW8 A;  2XGC A;  3G3Z A;  3LQR A;  3OS0 A;  1BA5 A;  3X2Q H;  4LG3 A;  3BTL A;  4HA8 A;  3UKG A;  4HRI A;  4E7K A;  2ZJP F;  2YVH A;  1MZB A;  1EV7 A;  2Q1Z B;  4B4C A;  1BC7 C;  2D1V A;  1RR8 C;  2ESN A;  3FKI J;  2L7Z A;  3H5N A;  4D0P A;  3PIP F;  1LFB A;  2HDW A;  3CCU I;  3A01 B;  2GA2 A;  2LLK A;  3HOV J;  1MSE C;  1YHQ I;  3I56 I;  1T8I A;  2LRE A;  4FAS D;  1FSE A;  3SYT A;  4ENK A;  4F7Z A;  2X6W A;  4YG2 F;  3EQL F;  1T08 B;  4FIS A;  4L9N A;  2JT1 A;  2X1C A;  1MBJ A;  2FSW A;  5GPA A;  4GGG A;  4AF5 A;  5M3M J;  4AD9 A;  1BIA A;  3ZR8 X;  4FE7 A;  1LDK B;  3HPH A;  1IN6 A;  2HYG D;  3H9J A;  3JRE A;  4D9J A;  4ACI A;  4QIW N;  2E1C A;  3HTA A;  5IYB J;  1AOY A;  1FZP B;  3GTJ J;  2M2E A;  5FD6 A;  1OYW A;  2NVQ J;  3V8K A;  1IN7 A;  3GZN B;  3QWL A;  2CWE A;  3OIQ A;  3E7L A;  5IP9 J;  3LJL A;  2G7L A;  5GTI C;  3KZ9 A;  5TGT A;  4ZC3 A;  2V4J C;  4ME9 A;  1DDN A;  4PFP A;  3IV5 A;  2GBY A;  2R5Y A;  5D5W B;  3NXC A;  1YOV B;  5EGO B;  2ELJ A;  2ZME B;  3FXM A;  3ZQC A;  4BH9 A;  4KIS A;  2RKH A;  3KZY A;  1T39 A;  1K6O A;  2MC4 A;  2OTL I;  5FLX K;  4EJV A;  1ULY A;  2A6E F;  2XPU A;  1B6A A;  3L00 A;  2JSC A;  1VI0 A;  2KIS A;  1XDU A;  2IS2 A;  2VKV A;  3L2C A;  2F4M B;  2FJ1 A;  4CCJ A;  3GZ6 A;  3MZH A;  1R1V A;  5HVQ C;  2QLZ A;  1QZY A;  3ASN H;  4AUX A;  3MWM A;  4HLX A;  5M5Y J;  1NK2 P;  3ANP A;  2CW8 A;  2DMT A;  4KIT B;  4XBF A;  1BR2 A;  1Z3X A;  5FKM A;  1SD7 A;  5H20 A;  3CF2 A;  3CO6 C;  3GFM A;  4Q48 A;  4MEY F;  5ILU A;  4G7O F;  1BW5 A;  4NC7 A;  3HGY A;  4OIR F;  2LR8 A;  2QSF X;  1YIJ I;  4UNO A;  4HOB A;  1N77 A;  1T33 A;  2DI3 A;  4EMS A;  5L3F A;  1P4W A;  3WG7 H;  4EM0 B;  1Z7U A;  1QVU A;  4RA2 A;  2GFN A;  5CVI A;  3J7A O;  1H0M A;  1KU3 A;  1I6H J;  4F91 B;  3M9A A;  2IW5 A;  2Y48 A;  1RUN A;  2G0E A;  1U0J A;  2FU4 A;  1TL8 A;  1BR4 A;  3CJQ B;  4L18 B;  2DTR A;  2L54 A;  3V7R A;  3D5L A;  5AON A;  3DBH B;  2H09 A;  2NAZ A;  1JGG A;  1Z3Y A;  3CD6 I;  2XPW A;  1VQ6 I;  1ETY A;  4M6V A;  3PNY A;  3QKX A;  4EGY A;  4XOT A;  1APL C;  4ITV A;  1O7L A;  3MZ8 A;  1OIS A;  1SFO J;  1UI5 A;  1ETV A;  4RGR A;  1ON1 A;  4YRV A;  2GEN A;  2VJ5 A;  4JNN A;  3Q0V A;  2OBP A;  4XSX F;  4A6E A;  3P9T A;  1QRY A;  2P4W A;  1FOW A;  2X1E A;  3WTS C;  1XX5 A;  2HWV A;  3BG9 A;  4OIP F;  3I64 A;  4BEH B;  4BXU A;  2QOP A;  2Z99 A;  2O9L A;  2EIK H;  2VKD A;  2A61 A;  2K9L A;  2A2F X;  3OIO A;  2RAE A;  5F0F A;  4GO1 A;  1TQM A;  4P9F A;  4DBQ A;  5J1Y A;  3MKZ A;  2CV2 A;  4PXI A;  2PFB A;  1SGM A;  1W7P D;  4LIU A;  3OYN A;  3Q9S A;  5EEG A;  1HW5 A;  3VOD A;  3MCZ A;  2HXO A;  5DUK A;  4YIF A;  3I0T A;  2FOW A;  4E7I A;  1Z7L A;  3VYT B;  3DPT A;  1K4S A;  1D5Y A;  3FXL A;  2ZXJ A;  5IOY A;  3U21 A;  1Y0N A;  5CLS A;  3RPQ A;  3S2D J;  2E1M B;  1W4M A;  4L5J A;  4RAF A;  4E7J A;  2NVX J;  2ESH A;  1ZHF A;  2K02 A;  2IVM A;  1OKR A;  1A36 A;  1ZK8 A;  3B6A A;  4DZP A;  1O57 A;  4FX0 A;  4H0E A;  2B9S A;  3F6O A;  3NWT A;  2R92 J;  5F64 A;  1TW2 A;  2KJB A;  2VE8 A;  4G8X A;  1FOX A;  3R0A A;  4DZJ A;  1JHF A;  2FUG 2;  5KK1 A;  3VW2 A;  1X1A A;  3TP3 A;  3C07 A;  2DU9 A;  4IZZ A;  3BTC A;  3N05 A;  2E1O A;  2BY3 A;  2PN6 A;  3WTZ A;  1JJ6 C;  1D5V A;  2ZOY A;  1ZR4 A;  1Q1H A;  1RKT A;  4MTD A;  3EUP A;  2FXA A;  3ZQG A;  2AO9 A;  2AQE A;  2KZV A;  3BWG A;  1SAU A;  1MJA A;  3DF8 A;  2G7U A;  3OYM A;  6PAX A;  3AFH A;  4DW6 A;  5LGU A;  4CHU A;  1V3F A;  2P6S A;  1VFC A;  3IHU A;  3JCU C;  1HKS A;  4IHW A;  4A3E J;  4HNV A;  3BTI A;  2IU5 A;  3M07 A;  1KON A;  4P55 A;  2HTJ A;  1BJZ A;  2XKO A;  4V2G A;  4LLN A;  1R5G A;  2MD5 A;  3H0D A;  2ECC A;  3OR2 C;  3LHQ A;  2JA6 J;  3LSG A;  4KIG A;  1LQ1 A;  4XN0 A;  3OSG A;  3E6B A;  2G9W A;  2R5Y B;  2IEK A;  5JR3 A;  3TGN A;  3ULQ B;  1R1U A;  3DV8 A;  2DOD A;  5LD2 C;  1KU7 A;  4PJL A;  4UVA A;  3G71 I;  3CDL A;  1I39 A;  2JA7 J;  2EZI A;  1ZYR F;  3V8L A;  5BPI A;  5CXI A;  4C30 A;  3DPU A;  3OYA A;  1O3R A;  1WGX A;  3T8T A;  2DMQ A;  4OIN F;  1AA7 A;  3K8P C;  3LOC A;  1IRG A;  4XLC A;  1UEL B;  4BJT A;  2PZ9 A;  2M1B A;  4KDP A;  3I53 A;  1FOK A;  3KZI C;  3K4N A;  5EF6 A;  3SWH A;  5FB2 A;  4P96 A;  2NOG A;  4XKW A;  4QSH A;  3L2U A;  4IHT A;  3KNW A;  2KIQ A;  1S3J A;  2K4J A;  4NQW B;  2VQL A;  3KLO A;  3ABU A;  1RKW A;  2JPC A;  1FOY A;  4GCV A;  1EH8 A;  4HAM A;  4OMZ A;  4XM3 A;  3GX4 X;  1W36 D;  2V1D A;  1RNL A;  4XID A;  5H6R A;  2WV0 A;  1MKM A;  1SVM A;  3H9Q A;  2NNN A;  4CYD A;  2ICW G;  1WJB A;  3SDG A;  3JRA A;  1MBH A;  3P7N A;  5K5R A;  3CC2 I;  4NDL A;  2QF7 A;  2QWW A;  2CS3 A;  2E71 A;  3BG7 A;  1ODD A;  3IKV A;  3K6G A;  2CH0 A;  1Z0X A;  2W48 A;  3I4P A;  4Y3O A;  3AAF A;  2QTQ A;  1EA3 A;  1PUF A;  3BCB A;  3K1N A;  3IAS 2;  1TQI A;  4E7L A;  1X1P A;  2KIF A;  3S2W A;  3QOP A;  2XAH A;  2HYT A;  1IDY A;  4ENM A;  2EJR A;  2KDZ A;  5HLH A;  2COM A;  1HLV A;  1NG7 A;  4WX9 A;  4XLN F;  2LD5 A;  3LAJ A;  2E36 A;  4HX4 A;  1KGS A;  3M7G A;  1KZH A;  3NS4 A;  2LY2 A;  2MA3 A;  5TRD A;  2UWM A;  1OCP A;  4RGS A;  1HA8 A;  2OQR A;  3PFY A;  4C2U A;  3QOD A;  5CJ9 A;  2V7F A;  1WH5 A;  3FDY A;  3KZZ A;  1TP4 A;  2EV6 A;  2QQ8 A;  4UXN A;  3S16 J;  3KET A;  2RQQ A;  1TWC J;  3J7Y J;  3PFI A;  2V1U A;  2JSP A;  3BZ6 A;  4WXD A;  3JTH A;  3PUB A;  2M5W A;  3HOS A;  2HU9 A;  1X3Z B;  4GRI A;  5KAI C;  3RPU D;  3HOY J;  4JP0 A;  3K69 A;  4ON0 A;  4BQO A;  2HKX A;  4X1E A;  4UV9 A;  3GTQ J;  1VQM I;  2HOA A;  3VOX A;  1OR7 A;  1QHG A;  3S5R A;  2JUC A;  3LA7 A;  1T95 A;  1FT9 A;  2F4I A;  4C2M A;  2QQB A;  3A1Y A;  3MQ0 A;  1EH6 A;  5J8C A;  5KAF C;  3W2W A;  4KWA A;  5M5W J;  4ZH4 F;  3H1C A;  3F6V A;  3QU6 A;  4Q5S F;  3KP6 A;  4QPQ A;  1ZRF A;  1MND A;  3E5Q A;  4YFN F;  2EIJ H;  2R7F A;  4UB6 C;  3HTU A;  4II3 A;  1G3W A;  4JKZ A;  2M30 A;  4A12 A;  5D8L B;  2EWN A;  3G4S I;  2R0Q C;  3NPI A;  4XON A;  4A3J J;  3HDD A;  2CFO A;  3LSM A;  3PNT A;  1UHS A;  4EQQ A;  1JUS A;  2HYF A;  4BL0 B;  2NP5 A;  4UUS B;  4MIM A;  5E8G A;  3JSJ A;  2PMU A;  2WUI A;  4XLP F;  5EEA A;  1R1T A;  3OR1 C;  5L3D A;  5HLI A;  3V6G A;  2A68 F;  3TDU C;  2D1H A;  1JGS A;  5GAH J;  3I5U A;  4V19 K;  4AVZ A;  1UZC A;  1A6Q A;  3FX3 A;  1R9T J;  2FD5 A;  2QVO A;  2VJI A;  1RET A;  4LJZ F;  5HNH A;  2WAQ N;  3K2Z A;  4HNU A;  3BZC A;  4BNC A;  1DQU A;  1EH7 A;  2Q24 A;  4M3D A;  2HYJ A;  1FIP A;  2I8D A;  3E97 A;  2GOM A;  1F1Z A;  1AWC A;  4IQ4 A;  3T5X A;  3DKX A;  2YVE A;  2E2J J;  2DA3 A;  4BDZ A;  3LSH A;  3AQT A;  2PMZ N;  4CO8 A;  3QYE A;  2QCO A;  2W57 A;  3KEY A;  4EJO A;  2NXN B;  2XHK A;  3C7J A;  3VTI A;  4BE1 A;  1PVE A;  3D5S C;  3Q5F A;  1V4R A;  2B1E A;  4BXF A;  1ZEL A;  3JRD A;  1VQ4 I;  3B6C A;  3JRB A;  2OU2 A;  2E7W A;  4XSZ F;  4IRI A;  2QIB A;  4CDG A;  1SFX A;  3B02 A;  4R1H A;  2M87 A;  3V7S A;  3QQA A;  1LFU P;  5FGM A;  2VBZ A;  1N25 A;  5JLX A;  3CMY A;  5EJC A;  4WXC A;  2E5N A;  3M3Y J;  4NNJ A;  1UAA A;  2L7F P;  3FMQ A;  3BDD A;  2FBH A;  2VJJ A;  4ENN A;  1ETK A;  1S7O A;  4BHC A;  4MHG A;  3CP8 A;  3CCL I;  4AID A;  4OOI A;  3RSN A;  2XAQ A;  2AXT C;  1JKO C;  3U1K A;  1BOA A;  4PJJ A;  5L3B A;  5DM6 F;  2IS1 A;  4S04 A;  4XN3 A;  2FBI A;  3KFW X;  3GME A;  3IRQ A;  2O6G E;  3RIR A;  4G7H F;  5AIP A;  2TCT A;  1WSU A;  5HBU A;  1PP8 F;  1S8N A;  2XSJ C;  1XC5 A;  1QU3 A;  1I3A A;  3E5X A;  2W4S A;  3KYD B;  4XLF A;  2WWY A;  1U9N A;  3GF2 A;  2YU3 A;  3H92 A;  2DDB A;  1ZTR A;  2E35 A;  3HKZ N;  2BXZ A;  3CUQ A;  1G6N A;  1TWH J;  2XDV A;  1HF0 A;  4LK0 F;  4F92 B;  3GZ5 A;  4M9Z A;  1PUF B;  5F04 A;  4EJT A;  4LB5 A;  2KL4 A;  3K70 D;  3EGQ A;  1FPQ A;  3BZK A;  4WXH A;  5HLG A;  3GW2 A;  3JSP A;  5FHP A;  3L2V A;  4ZTJ A;  1FMV A;  3CLQ A;  5KVR A;  3OYJ A;  3SZP A;  5B1B H;  3HM5 A;  1Y0U A;  2VI6 A;  1VQ8 I;  3EDP A;  3TW6 A;  2GA1 A;  2ZBK A;  4NHJ A;  3KPH A;  4HST A;  2O61 A;  2GQQ A;  5D8K B;  2K86 A;  1XSD A;  3K0L A;  3H36 A;  5KCM A;  3SFI A;  3I58 A;  4ZZL A;  4JOM A;  3BT9 A;  2HQ5 A;  2NS8 A;  3OY9 A;  1XTA A;  1ON2 A;  2EFO A;  1PDN C;  4YII A;  2CQK A;  3AG3 H;  4A3I J;  3ZN1 A;  4BE2 A;  1NK3 P;  1H9T A;  2IT0 A;  2FNA A;  2XB0 X;  1JE8 A;  4A3L J;  3AL0 B;  4KFC A;  1G3S A;  1MD0 A;  2EPF A;  2NVT J;  4C2T A;  2VKE A;  5EDN A;  2LF7 A;  3HUG B;  2XAU A;  4ZDL A;  4Q47 A;  2XGE A;  2CU7 A;  3BQZ A;  3BTJ A;  4BAY A;  1P4A A;  3HIF A;  3I54 A;  5LFA A;  2DMP A;  2KMU A;  1W1W E;  4BJ6 C;  2DW4 A;  3WU0 A;  1QNT A;  4XNF A;  3S32 A;  2KLO A;  1Z9C A;  2LH9 A;  2WV1 A;  3RI4 A;  1L0O C;  2PX9 A;  1IUY A;  1E3O C;  1X1D A;  2ZJQ F;  3WTY C;  2O3F A;  5JVT A;  2LVS A;  3JSO A;  2K9S A;  4RAY A;  1A04 A;  3FXK A;  1ONV A;  2MC3 A;  4ZYA A;  3F8N A;  3GCM A;  5HDK A;  3FMS A;  1T0F C;  4Z6Y A;  3G2B A;  3HOW J;  3I4N J;  4O5V A;  5EEH A;  2BEO A;  2MD0 A;  3J81 K;  4MEX F;  2FOK A;  2QUF A;  2FJI 1;  1WI3 A;  4CZC A;  1YFH A;  2M7B A;  3COL A;  2DJI A;  1LUJ B;  2R7Q A;  3BG5 A;  1YX5 A;  2UXP A;  2STW A;  2Z9O A;  3UNG C;  2EIN H;  3W3C A;  3J80 K;  2XSD C;  2CW0 F;  1IN5 A;  2TRT A;  1NHA A;  2V1N A;  2K9N A;  4YEJ A;  3TO9 A;  5IY5 H;  4KIB A;  5K5Q A;  3EUH A;  2OV7 A;  1NTC A;  4U9N A;  3FXR A;  5CXG A;  2KP6 A;  3ZPL A;  3S8P A;  2EFW A;  1E3H A;  2KIM A;  2OZU A;  4PSX A;  1WWX A;  5HDG A;  2A6H F;  3FM3 A;  2F2E A;  4M6Y A;  1KU9 A;  2V9K A;  4I01 A;  1X2M A;  4PJN A;  3CP2 A;  1QBJ A;  3OYI A;  2GLO A;  3S1M J;  3DP7 A;  4D5F A;  2QM3 A;  4M9X A;  1FLI A;  2FQ4 A;  3AQS A;  3MNL A;  4W97 A;  2ZNZ A;  1DP3 A;  3FXQ A;  1STZ A;  3R60 A;  1EF4 A;  1YYV A;  3D1N I;  2LKX A;  2WAE A;  2HZT A;  2NS7 A;  2CYY A;  1ZRE A;  3FRQ A;  4CH7 A;  3F8M A;  1S5L C;  2HXI A;  4EM2 A;  1TTY A;  5IPA A;  2YX7 A;  4IRV A;  4IJA A;  2WAQ A;  3A4C A;  1VZ0 A;  3IP4 B;  3DBR B;  1A6I A;  2QBY A;  2IGN A;  4U7B A;  2PMZ A;  2O7T A;  2CQX A;  3SHF A;  5ED4 A;  5CQE A;  2QA4 I;  3FM5 A;  2HVQ A;  4DGW B;  2DO7 A;  3BP8 A;  2L01 A;  1VQO I;  3HRS A;  5EG0 A;  3CUQ B;  5HNF A;  4KUM A;  1V54 H;  2F4O B;  3HYI A;  5GAE J;  2ISZ A;  1T98 A;  5K58 A;  2VB6 A;  2DMN A;  1UG2 A;  2X6X A;  1KYZ A;  3DEU A;  3BJB A;  4AVP A;  5A2Q K;  1Y56 A;  3DPL C;  1E0E A;  2YUS A;  2ZCW A;  1ZG3 A;  5D6E A;  5M5X J;  2VPR A;  1P4X A;  4PZJ A;  4RAG A;  4I0A A;  2V57 A;  3A0B C;  2FRH A;  3ECO A;  3G1O A;  3OYH A;  4MQV A;  2LDU A;  3EUK L;  2L2O A;  4UDS A;  3IH2 A;  3KP2 A;  2IGO A;  3G7R A;  5J6X A;  5FD5 A;  4ASN A;  3F8C A;  3QRF F;  2K9Q A;  2EA4 A;  1B9N A;  2H6C A;  1G4D A;  1RUO A;  2H1K A;  2H94 A;  5K7F A;  1SFU A;  4EEF G;  3JRH A;  2WTE A;  1IN8 A;  2XRN A;  3S3O A;  3K9T A;  3LMM A;  4I98 B;  1SMY F;  2LY9 A;  2ZXI A;  3CUO A;  3V42 A;  5E3L A;  5EYR A;  3MKY B;  1A35 A;  2R7Z J;  1MJB A;  4B47 A;  4ESJ A;  1UCR A;  4HQE A;  2LBF A;  3TO7 A;  2PI0 A;  4IHS A;  3K4J A;  3HSF A;  1IRZ A;  2RHA A;  1ZRC A;  1G3T A;  5H9T A;  2E19 A;  2MFZ A;  1A5J A;  2EZK A;  3BC8 A;  1FYL A;  2EIL H;  4G6D A;  1IZ1 A;  1ZN2 A;  2BBY A;  4CYC B;  2QQA A;  5D18 A;  2Y9Y A;  2BW3 A;  3M8E A;  3CCQ I;  3HKZ A;  1K6Y A;  2HPI A;  2Y0S N;  3HSE A;  3QU3 A;  2GOX B;  2P5L C;  3BR0 A;  1QA6 A;  1ZLJ A;  2YS9 A;  1Z77 A;  1TNS A;  2IPQ X;  3ML6 A;  2BY2 A;  4A0Z A;  5DM7 F;  1I1G A;  2GXB A;  4ZDP A;  3OYF A;  1VTN C;  2IXS A;  3MMY B;  2JVG A;  1JI8 A;  4ICH A;  5KNL A;  2CUZ A;  5LLQ A;  2DQL A;  5F6F A;  3GTL J;  4G7Z F;  2OZ6 A;  2DAO A;  3BY6 A;  1WJ5 A;  4BU2 A;  4A3M J;  1D0Y A;  2AQF A;  4JX4 A;  1MDM A;  2WAF A;  3JRC A;  1JKQ C;  2MLG A;  4CCO A;  4HLY A;  5DS9 A;  4WIB A;  3BPV A;  4AWX B;  1IUF A;  2RNJ A;  4WK8 F;  2ZC2 A;  2PJP A;  1J7K A;  1WJD A;  4YFX F;  2VQH A;  1YE9 A;  3RJP A;  5BQT A;  3W6V A;  2VN2 A;  1WKM A;  2MH9 A;  1JUM A;  2LTP A;  2BY1 A;  1ZG5 A;  3L7W A;  4J00 A;  2IS4 A;  2B63 J;  4JL3 A;  3VEP A;  5JHU A;  2OAZ A;  3F21 A;  1R6R A;  2DFH A;  5GPC A;  3TOA A;  2HDC A;  1E2X A;  3BG6 A;  2XUB A;  4PGH A;  3I55 I;  5E17 F;  4RLF A;  4JYK A;  1MBE A;  2VLA A;  2JZY A;  3L9F A;  3JRI A;  4B43 A;  3E5U A;  2KFD A;  1U9O A;  4HNT A;  3CCE I;  3LSR A;  1ERD A;  1FC3 A;  3FBI B;  2X6O A;  3T0Y A;  2XRL A;  2EV5 A;  1BN5 A;  3HIM A;  3G1M A;  3DLA A;  4A6D A;  2XVC A;  2OTJ I;  4D5C A;  1XN7 A;  2RRE A;  1ZQ3 P;  1HDP A;  2R7V A;  4DYQ A;  2QGU A;  2RGV A;  2ZO4 A;  2R7X A;  2G3B A;  5DAJ A;  3VW0 A;  1K61 A;  3IKT A;  2GXA A;  4P9U A;  3MKL A;  4R8H A;  4FHT A;  3CCM I;  1X1C A;  3WE2 A;  5FRN A;  2X1D A;  2FBQ A;  2LSO A;  2REK A;  3PAS A;  2W84 A;  4IQJ A;  1GVJ A;  3JW4 A;  3V7C A;  1YLF A;  1AKH A;  2Y30 A;  2A69 F;  3LSI A;  3M8F A;  5B66 C;  1U78 A;  1FJL A;  4GCT A;  4HF0 A;  2W1O A;  2GM4 A;  1OYI A;  4IHX A;  2OI8 A;  2Y31 A;  1TT5 B;  3C2H A;  4OWR B;  2W25 A;  2P5K A;  2WA0 A;  3DKY A;  5H2F C;  1B8I A;  3HOX J;  1HW2 A;  1GV2 A;  3KE2 A;  2DA6 A;  4KNY A;  5EFY A;  2DXI A;  5HSZ A;  3HOT A;  4U9L A;  4D7M A;  2DT5 A;  2ZNY A;  3I9V 2;  2DDA A;  4LMY A;  3H3U A;  2VUM J;  1WJA A;  2HQA A;  4AYB N;  4XQF A;  1BBY A;  1XPX A;  4WF2 A;  3NAR A;  4ANJ A;  3BCG A;  3CCY A;  1HC8 A;  4U87 A;  4EVI A;  4GCL A;  2J5P A;  3S14 J;  2ACJ A;  5B3S H;  3OYL A;  3G73 A;  3QBM A;  4MK6 A;  3T6N A;  1QQI A;  2OF7 A;  4XKC A;  2JA8 J;  3FXU A;  5HAW A;  5J4Y A;  2IRF G;  2H27 A;  2BYV E;  2ZXH A;  2E5Z A;  1DUX C;  4XKV A;  2XAJ A;  3F3X A;  5E18 F;  3W6K B;  2HKO A;  3S93 A;  2CUE A;  3U1D A;  4ZDO A;  3BR6 A;  3DTK A;  1U3E M;  2GIZ A;  1J59 A;  4UY8 I;  3RYR A;  5FO5 A;  2Z5U A;  2E7X A;  3C2B A;  4M9S A;  5FLX Z;  2K5C A;  3IUO A;  3P5J A;  4WCG A;  2OD5 A;  3RDI A;  1JT6 A;  2JRT A;  1LKX A;  1I6X A;  2ETH A;  3IRR A;  3BRU A;  2K85 A;  3TP0 A;  4LG0 A;  2VXZ A;  2LKS A;  2GIV A;  3DKW A;  4XRS A;  2NNY A;  3SJM A;  1X19 A;  4PFO A;  1KQ0 A;  2GUH A;  5L3C A;  3O60 A;  4L9V A;  4CZZ A;  1FX7 A;  5K7H A;  2M4K A;  1BI3 A;  4M72 A;  1VF9 A;  5DD4 A;  5C4J J;  1ZLK A;  2IA0 A;  2BW3 B;  2RAS A;  1IF1 A;  2ZCN A;  1ORK A;  1BI0 A;  3IL2 A;  2K9M A;  1TLH B;  1IAW A;  4KT6 A;  3DLL F;  2DBB A;  3VOK A;  2P0W A;  3FXJ A;  4NEL A;  3OYE A;  1MNM C;  1M1E B;  1D1B A;  1P7I A;  3VYR B;  1SVL A;  1SFK A;  1YG2 A;  2BZT A;  2EZH A;  1IJW C;  1TZL A;  2VT3 A;  4BGD A;  2DFI A;  3S2H J;  3L09 A;  4U7D A;  2NS0 A;  1A31 A;  2RV8 A;  1RPW A;  2IA1 A;  3FHZ A;  2RQP A;  2VIX A;  4EGZ A;  3V78 A;  2GXG A;  4E7H A;  3W6J B;  1J09 A;  1FIA A;  2HZD A;  1VQL I;  2VOD A;  1YI2 I;  1MDM B;  1XMX A;  1P92 A;  1Z6R A;  2HVS A;  3OMY A;  2M9H A;  1X58 A;  3GEZ A;  4UHT A;  1UG0 A;  2KKO A;  5J1R A;  1S7A A;  2E34 A;  2L4M A;  3A2K A;  1V5E A;  2KZG A;  2LMD A;  3LSK A;  3L2W A;  3FMR A;  1GV5 A;  3UR3 C;  3ZQH A;  3ZQF A;  2RN7 A;  1RES A;  3M4O J;  1H9G A;  1JXS A;  2L5Q A;  1U6G A;  2L3D A;  3QPL A;  2Y69 H;  1JT0 A;  3LFK A;  1WI9 A;  4A5M A;  3O8G A;  3H9G A;  3JR9 A;  3M8J A;  2Y0S A;  1WCM J;  2R5Z A;  1S7E A;  5K7Z A;  1X4O A;  2F5V A;  1B4A A;  1IRF A;  1QGP A;  1W7P A;  4BY7 J;  2FBK A;  5J8F A;  3F9K A;  1BI1 A;  3PM1 A;  2ZB9 A;  2BVM A;  2K7L A;  3FWE A;  3R0J A;  2CG4 A;  2M34 A;  1R5H A;  4UB8 C;  5BS6 A;  4PJ0 C;  4RM2 A;  1J0R A;  1R58 A;  2FA5 A;  2LFB A;  2EB7 A;  2HOT A;  5J47 A;  3HOZ J;  2MLK A;  2CJJ A;  1LE8 A;  3HGG A;  5LEJ A;  4WWC A;  2F6C A;  1OCO H;  2JMW A;  5JFR A;  1XD7 A;  2ZME C;  1AKH B;  3WTV C;  4RM3 A;  1V55 H;  4XL9 A;  3WHC A;  4HZF A;  3QOE A;  1GDT A;  3OWT A;  4ZZD A;  4PUS A;  3ABT A;  1IW7 F;  1J75 A;  1D1C A;  2D5V A;  5M3F J;  2VBX A;  1B8I B;  3QPS A;  2P5V A;  3BNI A;  1FWZ A;  3OSF A;  1VQ5 I;  2A3S A;  4HW0 A;  3S1N J;  1E3P A;  4DBR A;  3QP5 A;  3VP5 A;  5D1R A;  4HV6 A;  1YRN A;  3CJT B;  3ERM A;  2UXX A;  3HSR A;  4C9Y A;  4O6J A;  2UXI A;  4NC8 A;  1D1A A;  4BUP A;  5IP6 A;  1HSJ A;  2YVX A;  2R7S A;  2Q0O A;  1OJL A;  2KRC A;  4HYE A;  4U88 A;  4FX4 A;  1FP1 D;  4GCK A;  3L1P A;  1XMK A;  3RH2 A;  3K1P A;  1F5T A;  2NX4 A;  3ZQQ A;  5TIS C;  1T6S A;  3WTX C;  1UHW A;  3DTE A;  4LFU A;  1RR7 A;  3CZ6 A;  1TT0 A;  1Y8Q B;  2PG4 A;  2W00 A;  2CGP A;  3GWZ A;  4XMY A;  3IH4 A;  2VOP A;  2PFV A;  3VOE A;  2CQN A;  3VVY A;  4FQG A;  3CMM A;  4NB5 A;  2DA7 A;  3PUF A;  3U2R A;  3HRM A;  4ZJZ A;  1HKT A;  4IRH A;  5ERI A;  2COB A;  2BGC A;  2W85 A;  5DEQ A;  3NAU A;  1Y39 A;  1CF7 A;  2ZY9 A;  1OYY A;  4RGU A;  2HPM A;  3WOD F;  3WHB A;  3V8J A;  1JUP A;  2UZK A;  5F27 A;  1RRJ A;  1FTT A;  5CW8 A;  2Z16 A;  1JJ8 C;  1R5I D;  4AYB A;  5IT9 K;  4YFK F;  5EZH A;  2EFP A;  4AM3 A;  3CRJ A;  2YPR A;  2O8K A;  2HOE A;  3N97 A;  2ELH A;  4HSR A;  1MMS A;  1Z91 A;  2DA1 A;  2VC0 A;  4Y13 A;  4L62 A;  5FRM A;  1J2X A;  4B1R A;  4L5E A;  5ICF A;  4QPO A;  3EUH C;  5K1Y A;  4II2 A;  3AKZ A;  2V6E A;  5ILS A;  2Z1D A;  4LGW A;  3WG9 A;  1WQ2 A;  3KKD A;  1KA8 A;  4ZTF A;  1SD5 A;  3HTI A;  3IC7 A;  3ZMV A;  2M8E A;  4C2M J;  2BV6 A;  2HFH A;  3GO5 A;  4L0Y B;  1B1B A;  2MYS A;  1G3Y A;  3HHG A;  2DMU A;  4B3X A;  3P9K A;  4XLE A;  5C44 J;  4D1Q A;  2V26 A;  4IX7 A;  2X48 A;  2NP3 A;  4A2U A;  4CCM A;  2XIG A;  1J9I A;  3HZJ A;  3CJN A;  4RB0 A;  2OUM A;  4XOP A;  1S6L A;  3ABK H;  3QP6 A;  5CPR B;  3MKW B;  2QSH X;  4A0Y A;  2E1M C;  4YZE A;  2K3P A;  3RKY A;  1ZG1 A;  1YQA A;  2EBI A;  5AIQ A;  1W5S A;  3P9I A;  5LBQ A;  3NRG A;  3K4B A;  1BOB A;  2LOO A;  5CVR A;  4BYY A;  4N9H A;  2QEN A;  1D0Z A;  2A5W A;  3GVA A;  3BQY A;  3OYC A;  2M3A A;  4J19 A;  1FTZ A;  5E1Z B;  2LC2 A;  2MH2 A;  4FT8 A;  4U0W A;  4DVY P;  2GWR A;  3S17 J;  2ID6 A;  1LVK A;  1SAN A;  2X4H A;  4JX5 A;  2A07 F;  2VOO A;  1Z6T A;  2F5F A;  1ACI A;  5FKN A;  1X1B A;  1MSF C;  2P7C B;  2CUJ A;  2OC6 A;  5JHF A;  4IHV A;  3VYU B;  4IKF A;  4M3B A;  5B5E C;  4AC0 A;  2KPM A;  1G8X A;  2R5Z B;  4LD5 A;  3D0S A;  4E6K G;  3VFZ A;  1T2K A;  4HF1 A;  2K3F A;  4RB2 C;  3G56 A;  1W7P B;  2B0L A;  4JQF A;  3MD2 A;  2R7W A;  3GFL A;  1O7F A;  2X6Y A;  4FE4 A;  2WBM A;  3HE0 A;  2DK5 A;  2DQR A;  4A0X A;  4PCQ A;  2F5C A;  2G7G A;  3BCA A;  1FBQ A;  3C1D A;  5GAD J;  3RPU A;  5DD8 A;  3J7Z I;  4Y17 A;  4PSW A;  4KA4 A;  3WGG A;  4E70 A;  4M3E A;  3S3N A;  1W0U A;  4X6A J;  3GUD A;  5E1W A;  1SMT A;  4QWQ A;  2ZSH B;  4EJU A;  1LE8 B;  1OPC A;  1KQ9 A;  3CJD A;  2H8W A;  2MBF A;  2Z3Y A;  3OS2 A;  2EIM H;  3EPZ A;  2Z2S B;  2ZOZ A;  4GDF A;  3DEE A;  2JRM A;  3DFG A;  1WPK A;  1QPI A;  3ZCO A;  4B09 A;  3VW1 A;  5HLT A;  1Y1W J;  1MMA A;  1GLN A;  1P9Q C;  2ADU A;  4IEJ A;  3DXJ F;  4MXM A;  3VIB A;  4HF2 A;  4OIO F;  1H89 C;  3O2P E;  2JK3 A;  3ZQ7 A;  1YRN B;  1IXR C;  3BG3 A;  5E3N A;  4L5I A;  3OYD A;  2QSG X;  1XG1 A;  1WFX A;  2X9D A;  2KRF A;  2IP2 A;  1OQY A;  2ZSI B;  1OMI A;  2ME0 A;  2QKL B;  3ERE D;  1MGT A;  2V9P A;  1Q1V A;  4DNC A;  5LRS A;  3RTR A;  1YIO A;  4RMN A;  4D7N A;  3W2A A;  4Z2Y A;  4QLC U;  2ZJ2 A;  3VVX A;  3CDH A;  1O3S A;  3B81 A;  5ICE A;  2DT7 B;  3VSK A;  1FYM A;  2JVH A;  3JRF A;  2LF8 A;  2FNP A;  3ZMD A;  1SC7 A;  3S15 J;  2R4G A;  1XDS A;  4GYI A;  3GTK J;  3OL4 A;  4HEA 2;  5ICC A;  5GAG J;  3ESW B;  2CV0 A;  2PBI A;  2BY0 A;  3TBI A;  2O0Y A;  2V9V A;  3SZT A;  3JRG A;  1WVR A;  1FYK A;  3BR1 A;  4Y15 A;  2L4A A;  5GTH C;  1CF7 B;  2ECB A;  3BRO A;  2M0C A;  5E3M A;  3FXO A;  3ZRG A;  2KIU A;  4Y52 J;  2BXY A;  3NWS A;  3VB2 A;  4E4H A;  2HS5 A;  4Y7N J;  1Z67 A;  2V1X A;  4CCN A;  1KYW A;  3O8H A;  3HOU J;  2HEO A;  1UI6 A;  4LIT A;  4UVB A;  1MMN A;  2CO5 A;  2DOE A;  2JPB A;  1KU2 A;  2KQR A;  1NG6 A;  2KT0 A;  2XB5 A;  3VYS B;  4BBR J;  5C4X J;  4KN4 X;  2IS6 A;  3ZOB A;  2R7U A;  1ETX A;  5GP9 A;  3GFI A;  2HTS A;  1SEU A;  2FQ3 A;  4LLG F;  5CQG A;  3DTI A;  1I50 J;  2ZCX A;  2BE5 F;  2QYO A;  2XGX A;  1TNT A;  5FJ8 J;  3LQQ A;  2XF5 A;  4BS9 A;  2QKO A;  4BKX A;  4AIJ A;  5BPD A;  3VDX A;  1G59 A;  2W53 A;  3TQN A;  3MN2 A;  4HPQ A;  4BDY A;  2DCE A;  3WTW C;  2PBX A;  3SDB A;  4E7S A;  2HGC A;  4XR6 A;  2PJR A;  1HBX G;  4I99 C;  2OA4 A;  4XK4 A;  2FEZ A;  2UXN A;  3BPX A;  4BAC A;  3BR3 A;  3TMO A;  4DQ2 A;  1TWF J;  3I3L A;  4TV7 A;  3E1S A;  3BHQ A;  3IWZ A;  3PO3 J;  2A5Y B;  3KP7 A;  3M1C A;  2A05 A;  2R7D A;  4M3F A;  4IHY A;  2JA5 J;  3OL3 A;  4NUB A;  3CCV I;  3AG1 H;  4MFD A;  1D3Y A;  3FZV A;  2D2W A;  2MG4 A;  1WH7 A;  3DPJ A;  5FFZ A;  2O5R A;  3ROU A;  3KEQ A;  3OYB A;  2VON A;  2DA4 A;  1R00 A;  5H6Q A;  1YTY A;  2DOF A;  1N75 A;  1W0T A;  3H3V K;  5D19 A;  4Y33 A;  4IOA F;  1MMD A;  3H35 A;  3PPB A;  3CJR B;  3RKQ A;  2XKP A;  2LG4 A;  1QO0 D;  4ZYH A;  1BJA A;  3KYL A;  4HDU A;  1UB9 A;  1UHM A;  2XC7 A;  3GYH X;  3L2Q A;  1GHC A;  3HHH A;  2NOJ B;  1K7A A;  4I0B A;  3KP4 A;  5LHI A;  5IYC J;  2CMP A;  2L02 A;  4HX8 A;  1YW7 A;  3BJO A;  2ZFU A;  3B73 A;  1Y1V J;  3LWF A;  2PQ8 A;  2CSO A;  1IO2 A;  3ZMU A;  2DK8 A;  2IBD A;  4IPA A;  1HCR A;  1T56 A;  3I71 A;  1WJF A;  4XIC A;  1IXS B;  2OCE A;  4XRF A;  1T0F A;  5FFX A;  3S3M A;  1YW9 A;  2LY1 A;  1SD6 A;  4L9J A;  3KLN A;  1WJC A;  4NQW A;  4LOC A;  3F22 A;  3QYB A;  4CGZ A;  4PGG A;  4A3C J;  3NQO A;  2OJE D;  4IRG A;  4F55 A;  1R49 A;  1LB2 A;  1BL0 A;  3LA2 A;  5FRO A;  1J5Y A;  1FSH A;  1QZE A;  2WAD A;  1QVT A;  4HBL A;  1CGP A;  1XSV A;  2EA2 A;  2F5E A;  1P2F A;  1EJ9 A;  4P1W A;  1V5G A;  3BOQ A;  5DDG A;  2VC1 A;  2LKP A;  3NEU A;  5AQC A;  4CXF A;  3VSL A;  3HTH A;  2JWT A;  1JKP C;  1L3L A;  3LA3 A;  3H5A A;  4XLH A;  5CVJ A;  3J81 Z;  2Q2E A;  5HDN A;  2YX4 A;  1IXC A;  4KT5 C;  3GLL A;  2V6C A;  4C3I J;  3TKY A;  4AIK A;  3HRT A;  4HKU A;  2BOL A;  4M3G A;  1LEA A;  1RZ4 A;  4V2F A;  1MIJ A;  3J80 Z;  4I6Z A;  4ZYE A;  2JJ7 A;  2VL8 A;  2UV1 A;  2KRH A;  2HVR A;  1OCC H;  3CF5 F;  4C3J J;  2UXH A;  1U5T A;  2G7H A;  1D0X A;  3LNQ A;  1ITY A;  1U2W A;  2JN6 A;  2WC2 A;  3MVP A;  3QPT A;  1HQC A;  1FP2 A;  3K7A J;  4HV5 A;  2BHY A;  1I1S A;  3EYI A;  5D5V B;  5ILV A;  2JUG A;  3LWJ A;  3VUQ A;  3V4G A;  1F4K A;  3DWL E;  2LNB A;  2PMH A;  5FLV A;  3K10 A;  2M4G A;  2XV4 S;  5HS9 A;  1RIO H;  1MBG A;  2JTV A;  3GTP J;  3OV8 A;  4BBS J;  3Q0U A;  1TWG J;  4LB6 B;  2HR3 A;  4UV8 A;  2L7K A;  3ANG A;  4RDU A;  3OS1 A;  4GFK A;  4PDK A;  4K2E A;  5C4Y A;  1MH3 A;  2ZCM A;  1ZKG A;  2GZW A;  3ON2 A;  3E3V A;  4AU7 A;  2DPD A;  1P6R A;  4HX7 A;  2XDN A;  5F1R A;  1LDD A;  1ETO A;  1SD4 A;  4YEL A;  5HOD A;  2K4B A;  2W24 A;  3M1E A;  2LRD A;  1R71 A;  3Q3S A;  4OAY A;  1TW3 A;  5TJJ A;  2RNG A;  3FBN B;  4O3M A;  1ZGJ A;  2YR2 A;  4EJW A;  3GZI A;  2DA5 A;  4MTE A;  4FTH A;  5BMZ A;  3IUV A;  2XAG A;  1UJ8 A;  3PQJ A;  2E2I J;  2P8T A;  4RB1 A;  2QBY B;  1VND A;  3PSF A;  4NC6 A;  1XSX A;  1YJW I;  5FKL A;  1JTX A;  1IV6 A;  2B3W A;  3AL0 C;  1YW8 A;  1EKE A;  3RKX A;  2PJR B;  3J7A Y;  3REO A;  1R23 A;  5D5U B;  5EG0 B;  1OR7 C;  1Z05 A;  3K4M A;  4RGX A;  3CWR A;  3MZY A;  3RKW A;  1FMW A;  3PNV A;  3WE3 A;  2DJN A;  4M74 A;  2L0K A;  3ABL H;  1K83 J;  5A2Q Z;  4UUS A;  2VE9 A;  4CIC A;  2NVU B;  1D8J A;  3COA C;  1W5T A;  3BJ6 A;  4JK1 X;  3N4M A;  1YO5 C;  2PLY A;  3E0J B;  5J40 A;  3K1M A;  3LAP A;  4IOC F;  2L9N A;  3ONQ A;  1LNW A;  1UFM A;  3NI7 A;  5L3E A;  4ESB A;  3CCS I;  1ZGW A;  1LVA A;  4N4N B;  1PYV A;  4BQQ A;  3ON4 A;  2R3S A;  1SVO A;  3HBL A;  5FKK A;  2L7M P;  2Y75 A;  4HG2 A;  1MJ9 A;  1Y8R B;  4OAZ A;  5DV5 A;  4BQA A;  3KP3 A;  3OIP A;  5HS8 A;  3EET A;  2OER A;  1MBF A;  1LDJ A;  3OYG A;  3H5R A;  2LBF B;  1KQ8 A;  3U9G A;  4UUV A;  4OD5 A;  3HL2 A;  2VKH A;  1U8B A;  3FIS A;  2C6Y A;  5F0H A;  1BM9 A;  1LFP A;  5JVG F;  3HTS B;  1HKQ A;  2ELK A;  1XGO A;  3CQZ J;  1K79 A;  5LHG A;  1LJ9 A;  2Z33 A;  1SAX A;  3I4M J;  4ETS A;  1K4T A;  2XF7 A;  5CVV A;  1IRX A;  2CQ7 A;  1F9N A;  2DT6 A;  5DYM A;  3PJR A;  3FF5 A;  3PSI A;  3DU5 A;  4U0V A;  2IA2 A;  1FY7 A;  3T1B A;  1OCR H;  2R93 J;  3BLY A;  2QKM B;  2FX0 A;  2EH3 A;  1HOM A;  5IYD J;  3KKC A;  1X3W B;  2VQG A;  3S1Q J;  4OU0 A;  3CES A;  4R79 A;  2EQR A;  3ZQL A;  3WU1 B;  3ASO H;  2W7N A;  2JA2 A;  5LGT A;  3E6C C;  1MNE A;  2L9V A;  3GFJ A;  3F8F A;  3CMA I;  1JKR C;  2H6B A;  5L3G A;  4RBO A;  4C3H J;  2QZ8 A;  1UMQ A;  3JAM K;  1MMG A;  2HOS A;  3ZMZ A;  4Y4R A;  2I5U A;  2XAS A;  4EV0 A;  1TBX A;  1BR1 A;  4IL6 C;  4MGR A;  3HPG A;  1R7J A;  2R7R A;  1W36 C;  3HJE A;  2FE3 A;  1AHD P;  3A0H C;  1X2N A;  2Q2E B;  4ZYG A;  4A3F J;  5LRR A;  2QEX I;  2OQG A;  3LST A;  1Z1D A;  4A3D J;  4FET A;  3K4C A;  1X3U A;  2B7E A;  4G12 A;  1JHH A;  2GAU A;  1HW1 A;  4A3B J;  1DPR A;  2XRO A;  4G94 A;  1YS6 A;  2A6T A;  2K27 A;  1O3Q A;  4BHB A;  1DGR M;  1U5T B;  4IVN A;  2DLL A;  2DA2 A;  3K2A A;  3TO6 A;  5E79 C;  3C18 A;  4GXO A;  3AG4 H;  1WRJ A;  2LYC A;  1B72 A;  2QWT A;  5DTD A;  3CC4 I;  2N8G A;  3NRV A;  4BY1 J;  1TQP A;  2VQC A;  3CUQ C;  4AC6 A;  3I59 A;  3KEO A;  3G6E I;  3BR5 A;  4M73 A; 
#chains in the Genus database with same CATH homology
 1A6I A;  1D5Y A;  5IOY A;  1G2H A;  2ME6 A;  3S17 J;  2ID6 A;  1SAN A;  4JX5 A;  3S2D J;  3RQI A;  2O7T A;  2CQX A;  2DTZ A;  5FKN A;  3Q0W A;  1MSF C;  2UXO A;  2NVX J;  4IHV A;  2UXU A;  4MLO A;  2DG7 A;  3IH3 A;  4M3B A;  4AC0 A;  1ZK8 A;  2R5Z B;  3B6A A;  4DZP A;  5EG0 A;  2IAI A;  5K58 A;  2DMN A;  1UG2 A;  2R92 J;  2E2H J;  3G56 A;  2OPT A;  3BJB A;  1GT0 C;  1O4X A;  2YUS A;  5M5X J;  4DZJ A;  4FE4 A;  2XPV A;  2F07 A;  2H8R A;  3HE0 A;  2VPR A;  3VW2 A;  3TP3 A;  1OFC X;  3C07 A;  2G7G A;  5JLW A;  3BTC A;  2V57 A;  2E1O A;  2CUF A;  3LSJ A;  3G1O A;  1JJ6 C;  2ZOY A;  1MBK A;  1ZR4 A;  1RKT A;  3EUP A;  4UDS A;  3IH2 A;  3ZQG A;  3G7R A;  4M3E A;  2AO9 A;  3BR2 A;  1W0U A;  3OOU A;  3FIW A;  4X6A J;  1FTZ A;  2K9Q A;  4DW6 A;  1LE8 B;  2H1K A;  3CJD A;  5K7F A;  2WB1 N;  3VVZ A;  2G7S A;  2AHQ A;  1VFC A;  4EEF G;  3JRH A;  4IHW A;  4JX6 A;  2ZOZ A;  2CRG A;  4A3E J;  4HNV A;  2LY9 A;  4MFE A;  3BTI A;  5E3L A;  1WPK A;  5EYR A;  1QPI A;  3DEW A;  2R7Z J;  2NVY J;  2IU5 A;  3HTJ A;  3VW1 A;  1BJZ A;  4GFK A;  4V2G A;  1Y1W J;  2LK2 A;  2RHA A;  1IRZ A;  2ECC A;  3LHQ A;  2JA6 J;  5H9T A;  2E19 A;  3LSG A;  4IEJ A;  4MXM A;  3VIB A;  2EZK A;  3OSG A;  2R5Y B;  1H89 C;  2JK3 A;  2IEK A;  4I76 A;  1YRN B;  3BG3 A;  5E3N A;  1IDZ A;  4CYC B;  1XG1 A;  1FEX A;  3F0C A;  5D18 A;  1HDD C;  1F43 A;  2X9D A;  2Y9Y A;  2Y0S N;  2XGD A;  3CDL A;  3BR0 A;  2ME0 A;  2JA7 J;  2YU9 J;  2EZI A;  2YS9 A;  1OCT C;  1Z77 A;  4A93 J;  3VPR A;  5CXI A;  1Q1V A;  3A02 A;  5FGL A;  2P81 A;  1WGX A;  4D7N A;  3H0G J;  2DMQ A;  3VVX A;  3TED A;  1AU7 A;  3TW7 A;  3B81 A;  4ICH A;  3LOC A;  2M8G X;  4XRM A;  3JRF A;  2PZ9 A;  2Y2Z A;  3S15 J;  3GTL J;  5IP7 J;  5EF6 A;  3GTK J;  4QSH A;  2NOG A;  4A3M J;  4JX4 A;  4BXX J;  4ABZ A;  3NNR A;  3G1L A;  3JRC A;  1RKW A;  1A5J A;  2MGQ A;  1JKQ C;  5DS9 A;  1IGN A;  1IUF A;  3JRG A;  4XID A;  1H88 C;  1P7J A;  3W6V A;  3BR1 A;  2ID3 A;  1JUM A;  2LTP A;  1CQT A;  4JL3 A;  2ECB A;  2B63 J;  3F1B A;  2M0C A;  5E3M A;  3DCF A;  4A3G J;  3SDG A;  3JRA A;  1MBH A;  5GPC A;  3GTG J;  4Y52 J;  2L9R A;  4NDL A;  2QF7 A;  3HB9 A;  4B3A A;  4JYK A;  1MBE A;  4Y7N J;  3O8H A;  1UI6 A;  3HOU J;  3JRI A;  1U9O A;  3LSR A;  1Z0X A;  2W48 A;  3A01 A;  2Y9Z A;  2QTQ A;  1PUF A;  2X6O A;  2XRL A;  1BW6 A;  1ETW A;  2KT0 A;  2XB5 A;  4BBR J;  3G1M A;  5C4X J;  1TWA J;  3HIM A;  9ANT A;  3ZOB A;  4D5C A;  1ZQ3 P;  1HDP A;  5F0C A;  1ETX A;  5GP9 A;  4DYQ A;  3GTO J;  2HYT A;  5DAJ A;  1IDY A;  2G3B A;  2KDZ A;  4A3K J;  1K61 A;  3VW0 A;  2O7O A;  5FMP A;  3MKL A;  1HLV A;  1I50 J;  5J3L A;  2ZCX A;  5FJ8 J;  2LD5 A;  3ZQI A;  2QKO A;  4BKX A;  2FBQ A;  2REK A;  3PAS A;  2WGB A;  2W53 A;  4DYC A;  3MN2 A;  1OCP A;  1AKH A;  2Y30 A;  1FJL A;  2PBX A;  1U78 A;  4GCT A;  1H8A C;  2GM4 A;  4IHX A;  2OI8 A;  2Y31 A;  4XK4 A;  1WH5 A;  3S16 J;  2HKU A;  1TWC J;  2HDD A;  3BR3 A;  5FKO A;  1B8I A;  1TWF J;  3HOX J;  1B72 B;  1GV2 A;  2MSY A;  3HEF A;  3BHQ A;  2DA6 A;  3PO3 J;  5EFY A;  5J1U A;  5FLM J;  5HSZ A;  3RZD J;  4XRS G;  5EGO A;  4D7M A;  3HOY J;  4JP0 A;  4M3F A;  4IHY A;  2LP0 A;  4X1E A;  2JA5 J;  3GTQ J;  5F08 A;  2VUM J;  2HOA A;  1IG7 A;  4MFD A;  3S5R A;  4AYB N;  3VOX A;  2MG4 A;  1WH7 A;  2D6Y A;  3DPJ A;  3NAR A;  2K40 A;  3BCG A;  3CCY A;  4GCL A;  2I10 A;  4KWA A;  2DA4 A;  5M5W J;  3S14 J;  3GEU A;  1F36 A;  3QBM A;  1W0T A;  4MK6 A;  3H3V K;  5D19 A;  3T6N A;  2OF7 A;  2JA8 J;  3PPB A;  4JKZ A;  3RKQ A;  5HAW A;  1GUU A;  5F1J A;  2R0Q C;  1XS9 A;  3NPI A;  3RD3 A;  4A3J J;  2HI3 A;  1TC3 C;  3HDD A;  4CYC A;  1UHS A;  4S0H B;  1JUS A;  3A03 A;  3GBG A;  2NP5 A;  4UUT A;  4MIM A;  4UUS B;  2DG8 A;  3JSJ A;  2WUI A;  5EEA A;  2DN0 A;  5IYC J;  4CGR A;  2CUE A;  3V6G A;  3BR6 A;  1DU6 A;  4MO7 A;  1Y1V J;  1I3Q J;  3C2B A;  5IOZ A;  1R9T J;  2FD5 A;  5BNG A;  1RET A;  2IBD A;  1JT6 A;  1HCR A;  1T56 A;  2WAQ N;  4XIC A;  3BRU A;  3TP0 A;  5E3O A;  2EZL A;  4XRS A;  2Q24 A;  4M3D A;  2HYJ A;  1FIP A;  3SJM A;  4DYR A;  2YVE A;  2E2J J;  2DA3 A;  2GUH A;  3AQT A;  3E7Q A;  3O60 A;  2PMZ N;  2QCO A;  4LOC A;  5K7H A;  4FCY A;  4A3C J;  1JTY A;  1VF9 A;  5C4J J;  1BL0 A;  2RAS A;  2ZCN A;  1ORK A;  1QVT A;  1GVD A;  3LSP A;  4GFL A;  4QTR A;  3JRD A;  3VOK A;  1ETQ A;  5C3E J;  1DU0 A;  3B6C A;  3FK7 A;  1ZR2 A;  3JRB A;  1MNM C;  4NEL A;  2QIB A;  5EZG A;  4A69 C;  5AQC A;  3HTH A;  1P7I A;  4NN1 A;  2JWT A;  1JKP C;  1IJW C;  2EZH A;  3QQA A;  1LFU P;  3S2H J;  5JLX A;  3CMY A;  2CQQ A;  4C3I J;  1IC8 A;  3M3Y J;  1RPW A;  4HKU A;  4M3G A;  4V2F A;  2L7F P;  3V78 A;  1ETK A;  4I6Z A;  2JJ7 A;  1POG A;  3GTM J;  1FIA A;  3FK6 A;  1MH4 A;  4C3J J;  4GFB A;  2UXH A;  4W1U A;  1ENH A;  3LNQ A;  1ITY A;  1JKO C;  2JN6 A;  3MVP A;  3RZO J;  2M9H A;  1X58 A;  3PO2 J;  3S1R J;  3K7A J;  5J1R A;  2TCT A;  2MW8 A;  2XGC A;  3LWJ A;  3M4O J;  3KNW A;  3ZQH A;  1GV5 A;  1BA5 A;  5HBU A;  3ZQF A;  3VUQ A;  1RES A;  3UKG A;  3BTL A;  1XC5 A;  5FLV A;  2YVH A;  3QPL A;  1MBG A;  4B4C A;  1U9N A;  1JT0 A;  3GTP J;  3O8G A;  4BBS J;  3Q0U A;  3FKI J;  1TWG J;  3JR9 A;  1ZTR A;  2L7Z A;  3HKZ N;  1WCM J;  4RDU A;  1S7E A;  5K7Z A;  1LFB A;  2R5Z A;  1TWH J;  3ANG A;  1MH3 A;  1HF0 A;  2ZCM A;  1ZKG A;  5C4Y A;  3A01 B;  3ON2 A;  2LLK A;  4BY7 J;  5F04 A;  1PUF B;  3HOV J;  1MSE C;  2XDN A;  3PM1 A;  1ETO A;  5HOD A;  2ZB9 A;  3EGQ A;  3Q3S A;  4FIS A;  2M34 A;  5FHP A;  3GZI A;  1MBJ A;  2DA5 A;  5GPA A;  4FTH A;  3IUV A;  4AF5 A;  3HM5 A;  5M3M J;  2E2I J;  2VI6 A;  2LFB A;  4FE7 A;  3TW6 A;  2HOT A;  3HOZ J;  3JRE A;  1VND A;  4ACI A;  4QIW N;  3HTA A;  2CJJ A;  5IYB J;  1LE8 A;  3HGG A;  5FKL A;  1JTX A;  3GTJ J;  1IV6 A;  2M2E A;  2JMW A;  3SFI A;  1AKH B;  2NVQ J;  3WHC A;  3BT9 A;  2HQ5 A;  2NS8 A;  5EG0 B;  1GDT A;  3CWR A;  3E7L A;  5IP9 J;  2D5V A;  2G7L A;  3LJL A;  4A3I J;  5M3F J;  3KZ9 A;  1B8I B;  3QPS A;  3BNI A;  4ME9 A;  2DJN A;  1NK3 P;  3OSF A;  3IV5 A;  2L0K A;  3S1N J;  1K83 J;  2GBY A;  2XB0 X;  2R5Y A;  4A3L J;  3NXC A;  5EGO B;  4UUS A;  1YRN A;  5D1R A;  3VP5 A;  3ZQC A;  2NVT J;  2XPU A;  1VI0 A;  2VKE A;  5EDN A;  2UXI A;  3NI7 A;  2VKV A;  2XGE A;  5IP6 A;  2CU7 A;  3BQZ A;  2FJ1 A;  3BTJ A;  1ZGW A;  3ON4 A;  1OJL A;  2DMP A;  3HBL A;  5FKK A;  4AUX A;  1NK2 P;  2L7M P;  5M5Y J;  4GCK A;  3ANP A;  2WV1 A;  3L1P A;  1E3O C;  2DMT A;  3RH2 A;  2OER A;  1MBF A;  5FKM A;  2NX4 A;  1U8B A;  2LVS A;  3FIS A;  5F0H A;  1BW5 A;  2K9S A;  1RR7 A;  3HGY A;  2LR8 A;  2ELK A;  3CQZ J;  3IH4 A;  3I4M J;  3VVY A;  3HOW J;  3I4N J;  1T33 A;  2DA7 A;  1QVU A;  1WI3 A;  2GFN A;  2COB A;  1I6H J;  3NAU A;  3COL A;  3BG5 A;  2UXP A;  2G0E A;  2R93 J;  3WHB A;  2FX0 A;  2EH3 A;  2XSD C;  5IYD J;  1HOM A;  3KKC A;  3S1Q J;  1JUP A;  5F27 A;  2EQR A;  3ZQL A;  1FTT A;  5CW8 A;  2TRT A;  1JJ8 C;  2K9N A;  1JGG A;  2XPW A;  1ETY A;  4M6V A;  5EZH A;  1JKR C;  3CRJ A;  1NTC A;  3QKX A;  2O8K A;  5CXG A;  4RBO A;  4C3H J;  1APL C;  1UMQ A;  2DA1 A;  1SFO J;  1UI5 A;  4L62 A;  2HOS A;  1ETV A;  4B1R A;  4L5E A;  2GEN A;  4JNN A;  3Q0V A;  3KKD A;  3P9T A;  3HTI A;  1QRY A;  1X2M A;  1AHD P;  3S1M J;  2GLO A;  3BG9 A;  4C2M J;  1X2N A;  2QOP A;  4D5F A;  2O9L A;  4A3F J;  2FQ4 A;  3AQS A;  3MNL A;  4W97 A;  5C44 J;  2DMU A;  1EF4 A;  3D1N I;  2LKX A;  2X48 A;  4A3D J;  2NP3 A;  3OIO A;  4G12 A;  2RAE A;  5F0F A;  2NS7 A;  4A3B J;  5J1Y A;  4PXI A;  1SGM A;  4YZE A;  3FRQ A;  2DA2 A;  2EBI A;  3K2A A;  3NRG A;  1B72 A;  2QWT A;  2HXO A;  2HXI A;  5IPA A;  5DTD A;  2N8G A;  4BY1 J;  4AC6 A;  3BR5 A;  3BQY A;  4J19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...