3B6EA

Crystal structure of human dech-box rna helicase mda5 (melanoma differentiation-associated protein 5), dech-domain
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
199
structure length
182
Chain Sequence
DEENVAARASPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGLKISFPEVVKSCDIIISTAQILENSLLNGVQLSDFSLIIIDECVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interferon-induced helicase C domain-containing protein 1
publication title Human DECH-box RNA Helicase MDA5 (Melanoma differentiation-associated protein 5), DECH-domain.
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 67
structure length 182
sequence length 199
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2007-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3b6eA00
3VR3A 1G1MA 3RS4A 4Q9HA 1OFUX 3GJXC 4G5GA 3ZZ0A 1AM4D 1R5BA 3RVBA 3VX3A 3ZS9A 1ZC3A 4Q1CA 3RWOA 3ND8A 1XTQA 4EJSB 2IUTA 4NKRA 3KKPA 2WMNB 3B7GA 1NJGA 1TX4B 4JLOA 4LJ4A 3C16C 4PSAA 4PX9A 2YWGA 4Q7MB 3TBKA 4U02A 4ZO4A 2GXAA 2AX4A 2JCSA 5HTKA 2RB4A 4A8JA 5JSZA 1G20E 3AP1A 2ZEJA 1I4LD 4RZ3A 3WY9A 3K0AB 4LV5B 4ZCMA 4DB4A 3A1VA 5K8UA 1ZAKA 3I8XA 3K9LA 2BVNA 2XNSA 4DBLC 4PANA 1UADA 2MSEB 2NGRA 1FMJA 2W00A 2VP0A 2V1UA 1B23P 1G4AE 3VQTA 1OIVA 1N6OA 4LYFA 1L2TA 2B8TA 3FWYA 1S1MA 2JA1A 1F2TA 5KU1A 5EXSA 4G1UC 2VLIA 5DNYB 4BFXA 5KPJA 2WAXA 3K0FA 2AD1A 3QXCA 3QF7A 1RRPA 3B1VA 1DARA 3T5DA 4URZR 1KGDA 5FOTA 2ZANA 4OQLA 2W6JA 1HT1E 3B1ZA 3IIMA 1CIPA 5SZHB 5FPKA 1RKBA 3HPRA 2C2HA 3ASYA 3CRRA 1COWA 2X2FA 4TYPA 4HZUA 3TMKA 3GEIA 2GBLA 2VHTA 2RKOA 1KJYA 1F48A 2EFHB 1OF1A 2Q21A 5SZKB 3TR0A 3NHBA 4CEIA 3DEFA 4QJ5A 1E0AA 4LWZA 1Z6XA 3BD9A 2N1BA 1YZTA 3CWQA 2IX3A 3ZDQA 1NVVR 5HCNA 3CRVA 2JLUA 4B75A 4M22A 4V0OA 2VHUA 3ZVNA 3WXMA 4OL0A 1E2EA 1NIJA 1YJ5A 3MFYA 3QXSA 4PZZA 2C03A 3BORA 1KI6B 3B6EA 4KYIB 4F4CA 3GQBA 3DZDA 1L7VC 1UKEA 4PO1A 1LTQA 4B76A 5FBVB 2BC9A 2AFIE 2XITA 1R0YA 4NYIR 3CB4A 2ZR9A 2CNWD 5IRCD 2BCJQ 1HE1C 5L3SA 2A30A 1AJEA 5AJYA 3SJBA 5HR5A 1N6LA 2EWVA 3LBNA 3QPUA 3JZAA 3PVSA 1Z5ZA 2PMDA 2JJ2A 3CONA 1GFIA 1SHKA 4OI4A 4P32A 1G41A 4BFWA 1G19A 1X8JA 3PIRA 2CVFA 2FU5C 1Z8FA 4KU4A 1R2QA 1NVUQ 3V4FA 3SYNA 1OFIA 4TL8A 1GKYA 4RZXA 2IYZA 3QXHA 4RZ2A 1XWIA 1BMFA 5D3MA 4I1VA 3A4NA 2DFKB 4FIDA 2QPOA 1G8HA 2VSFA 2PX0A 2WJGA 4LJYA 4HAXA 2YHSA 2QEQA 2AK2A 3SC3A 4BASA 1JNYA 3QKSB 1MH1A 3UMFA 4WZAE 4V03A 3LH5A 2ZRHA 4JYBA 4NYJR 2RGAA 4A15A 1NN0A 1RZ3A 5HE8A 2ANBA 1F3OA 1AS2A 1P3JA 3T15A 4XWKA 2Q3FA 1T5IA 2ZVQX 1PUJA 2PZFA 5FFMA 4JJKA 3DZ8A 2OT3B 5CYPA 4GOKA 4RKEA 4Q1FA 2HT1A 1Z22A 2XXAB 3P4YA 4HLCA 4M8NE 1GWNA 1WRBA 2WKPA 3B5JA 3BGWA 1ZNWA 2PT5A 2Z83A 2AWNA 5CB6A 2JIZA 2Q0HA 4D0GA 1R0ZA 5FTKA 4OJQA 1XDBA 2WIAA 3LRPA 4Z1MD 1GP2A 2AD5A 3QKUA 3DM5A 1XPOA 3K0CC 5DI9A 3HU1A 1P2VA 3FKQA 3DKPA 1UBGA 4H1VA 4LV8B 3SJCA 3CZPA 4N0EA 1KK2A 1E2LA 1U0LA 2CEAA 3B85A 4TT3D 2V7QA 3K70C 1G7SA 4Q9JA 2IWHA 3TH5A 1NNEA 1UKZA 1DPFA 4KXFB 3EG5A 1GITA 1W4RA 3SNHA 1WBDA 4QBFA 4UNSA 4LYJA 3HP1A 4IVPA 4V0NA 3EPLA 4DCTA 4YC7A 1G3RA 1M8PA 3DMNA 1J90A 5BN4A 4MKGA 4V0LA 3HPQA 2QA5A 2IHYA 1JXMA 3FMOB 4R71A 1HH4A 3X1DA 4AWXA 5A0FA 4C0AC 2WJIA 4Q02A 1RIFA 4A0HA 2GF9A 2J41A 3CKLA 2F55A 4QOSA 1YHNA 3IKJA 1EX7A 2ZU0C 5LB2A 2ONJA 2PLRA 4HAZA 2RGEA 1GL7A 5FTNA 3VX4A 1A4RA 1LNZA 5EXTA 3I73A 3LD9A 3CNNA 1XFAA 3OIYA 2C78A 4Z8XA 1A5TA 1KMHB 1N3BA 1EFRD 3IGFA 1JECA 1M2OB 1W2GA 1HURA 2VYFA 3U3OA 1VCMA 1EGAA 1P6XA 4UQOA 1OXTA 3BRWD 4D80A 4URUR 3ND9A 4ABYA 3ADCA 1X1RA 2W6ID 3LXXA 3P20A 3TRFA 1UM8A 3AKDA 3DM9B 4KLNA 1K6MA 4OHWA 2ZE7A 821PA 5GJWC 1UF9A 1W44A 4K8OA 1S1CA 4KO8A 1VHTA 2R6DA 3S1AB 1JQLB 3R9WA 2DCUA 2FN4A 2A5FA 2Z5FA 2D7DA 4MH0R 1FPMA 4CDGA 1D9XA 1SXJD 4PAQA 4QNMA 2ZJAA 4HB2A 3K53A 2FWRA 2VTKA 5KYKA 5H70A 3I62A 1XMSA 2FJUA 1N6RA 4GZMA 3VR1A 3D3QA 5KSYA 1JJ7A 1HQCA 4HUQA 4F4JA 2XZLA 3QOFA 4MITA 5FL3A 1Q1EA 1GL9B 4Q5IA 1I4TD 4TQ9A 3QF4B 3ZVLA 3NBYC 5CDFE 2GTPA 4RFSA 4C4PA 2VEDA 3ZGXA 4NH0A 3I61A 2H16A 3A58B 3OIUA 2VHCA 3BFVA 1WMSA 4LGMA 2OE2A 4NYMQ 2A9KA 3EIHA 2ERXA 4A82A 1LS6A 2EYQA 2PZEA 1U8ZA 2R8RA 4Q1BA 1P62B 2HEIA 5KUTA 1XRJA 2QMHA 1KO7A 3N5CA 1QHGA 4LJ6A 4PC2A 5E7IA 4PZLA 4F92B 2F9MA 3CUEF 3C15C 4WOPA 1JR3D 2F7SA 4FW9A 3NEJA 3OEED 2ZRFA 3QE0A 4Q18A 1ZM4A 4QC2A 4RD2A 4X8OA 2YWFA 3UG6A 4AIIA 4B73A 2IUUA 1GRNA 3T34A 1XEFA 2O8BB 1IJEA 5JZVA 2O8DB 4I81A 4GNKA 4B43A 2IS2A 3MJRA 1NN5A 5TB5A 2D3WA 4EJSA 5B30A 4DZZA 1MKYA 2A78A 2IL1A 3N2IA 3BH0A 1SVSA 3GLHE 4K81B 3IEVA 1FQJA 1ZW6A 4B6FA 3PITA 4D82A 1AIPA 2OAQ1 2DFLA 5E4FA 1EWQA 2NG1A 1E98A 1LF5A 4XVQA 3Q3JB 1XNJA 3K0AA 2KB0A 3IIJA 3U4QB 5KPDA 3SOPA 2W2VA 1JAIA 2KBFA 3VU9B 2W2XA 3EZ7A 4W5WA 1DO0A 3FMFA 1U9IC 2J46A 4RD4A 1U8AA 3A4LA 3U7EB 1N5IA 2D62A 2XJ9A 221PA 2X77A 3RS2A 1X3SA 3CF6R 3WP1B 1OXXK 3HU3A 4YMVA 4Z51A 1G8YA 4M1YA 5SZJA 1WBBA 1GRQA 1WP9A 1J99A 2PCLA 4Z54A 2QAGA 3B13B 3U5ZB 4D26A 4Z1MA 2BWJA 1AS0A 3QPVA 3SI7A 5CJ2A 4A8JC 2J0QA 121PA 2ZM5A 1XMVA 4JSYA 5EP2A 3QKTA 1YR9A 2IYRA 2KBEA 3SYKA 2HYDA 4E03A 1AGRA 2WPDD 4B2IA 5F2EA 2DY1A 5C4GB 3TAHA 4A36A 4MGKR 4QRHA 2VP2A 2IF2A 2H57A 2WWWA 3OF5A 4DSTA 2ZYWX 1MV5A 1E2NA 4OK6A 5HKKD 4DCSA 5TXGA 2X19A 4AYTA 5KOYA 3RC3A 1KNQA 3GCGA 3MRSA 2ERYA 3QQ5A 5FPYA 1FTSA 5AJVB 2VIIA 4DDUA 1I2MA 5JRZA 4TTQA 1II8A 1F6BA 3HDTA 1FL9A 4BFZA 2PEYA 3IIKA 4FMCB 5FR1A 3KX2A 4S2EA 1E32A 4P31A 3T1TA 4E22A 2WKRA 3OFND 1E2JA 5P21A 4C0KA 2GBLC 2QP4A 4TTRA 2PZGA 2LCFA 4US2R 4DDWA 3RYTC 1MO3A 2REXB 2QZ4A 3ZJYA 3E1SA 4M9ZA 1T4GA 4AG6A 3NG1A 4BEBA 1QHHB 3FYHA 3I4LA 3T06B 1Q3HA 1KOFA 3L2OB 2HV8A 1QF9A 3KJHA 4IVQA 3OE7A 2O8EA 2V8OA 4GOXA 1BYIA 2NO6A 4XSHA 4I1UA 4RFVA 4URYR 3RS7A 4DSUA 1U8YA 1R5NA 2W6IA 3REFA 2HUPA 4DT1A 2KI5A 2FFBA 2CBZA 4KAXA 4AY2A 3AVWA 1N5LA 1VPLA 2GVDC 3AVTA 5JWHA 1E2FA 3C8UA 4IRUB 1G9XA 4C3ZA 4PPFA 2GXUA 1RRGA 3IBYA 3GLIE 4D0LB 5EJEA 1DG3A 3CM0A 4I4LA 2QENA 4KJZA 4M2LA 3Q5EA 1C1YA 4C0LA 3ZQ6A 3KQNA 3QKSA 3AP3A 1W5TA 4NTZA 1BKDR 5FBRB 4MDFA 3NDPA 2DWPA 1SXJA 4PAMA 3WBKA 4FMCF 4TMTA 3C41J 4JVMA 3E70C 2QT0A 4M1KA 4MKIA 3THYA 3TAUA 2R2AA 5J40A 2ZS8A 3TVDA 4M21A 4LI0A 4AURA 4EPRA 3CNLA 4LPKA 1QHNA 1RRFA 4B3GA 3LXRA 1ZNZA 4P4TA 1E3MA 2V55B 2VBCA 4HATA 2ORWA 1Z6AA 2WJYA 1T8TA 4PO9A 1E2KA 4LOAA 5AUPB 2GESA 4MKFA 1DG1G 2BKEA 2RMKA 3ZYCA 1Q22A 2B7CA 5JJIA 2DPXA 4C0HA 1EK0A 2JLXA 1F2UB 4TL9A 2QP9X 3DKVA 1QHSA 2IYUA 1P9WA 4DEYA 3BJIC 2FFAA 1W36B 1NY6A 2QN6A 5JI3E 1JR3A 1G18A 4KBFA 3OEEA 1TU3A 3KZ1E 2YNMA 2G0NA 1FUKA 2ZJBA 3RSLA 4BFSA 3SHFA 1WE2A 2YYZA 4A1FA 5C18A 2ONKA 3AF2A 2QT1A 3N2EA 5FPSA 2XGJA 2N42A 4B34A 5JJLA 3BB4A 3RS5A 2C96A 4UXHA 4TYWA 1P2UA 1UDXA 1M74A 5EQTA 1E2PA 4RSGA 5J4HA 1IHUA 1US8B 4R7ZA 4Q1DA 5UKDA 3UXMA 1G17A 4GFDA 1VCIA 1A7JA 2ZRGA 2PJRA 4QXAA 1CLUA 3L0IB 2W6JD 5AUQA 3KTAA 4NL4H 4KVAA 1WQ1R 2ZRLA 2J0UA 4XVUA 4BUJA 4GMDA 3CH5A 2OFWA 2AXPA 3QNUA 3GLFE 4B74A 4JVNA 2OCYC 5C1BA 2FMXA 3P4XA 4P3YA 3W8NA 4PQFA 1VG8A 1KMHA 1RPZA 1FX0B 1J8YF 3ZIAA 1HTWA 1P4SA 2QP3A 2ZREA 3R20A 4DUGA 3B2EA 4NCJA 4L15A 2QI9C 1XTSA 2NPFA 3W3ZB 3I92A 1XD2B 2R65A 3AQ4A 2GA8A 1DAEA 2WWYA 4M1OA 1S2MA 3SE0A 3OESA 3SEAA 3PEYA 3LQRA 2ZJ2A 3GLFB 3GJ3A 3BB1A 4BZXA 4LX0A 1W0JA 4FCTA 1E9SA 6Q21A 2F1RA 1VIYA 3IPYA 4NDZA 5AUOB 2QM8A 1GIAA 2JLYA 2VL7A 2ZYUX 2IS4A 1EESA 4F38A 1P75A 3LW7A 3M0EA 2W58A 5CIWA 4U5XA 2NMVA 1NMXA 1SZPA 4UJ5A 3LO5A 4UNRA 2VPPA 2JJ2D 4BE7B 3LBIA 5J4LA 2BV3A 3PUWA 4LJ7A 4CGZA 1ODFA 3T35A 5FUYA 1LV7A 3TR5A 2FPLA 5FOWA 2VQSA 4B32A 4NONA 2VF7A 4BZQA 3NH6A 4EPVA 3QF4A 1UKYA 1MO6A 2FF7A 4AC9A 1CULC 4S35A 2ZI6A 3O8CA 1W4AA 1Z2AA 2OFOA 4BPBA 1BMFD 2IXEA 3HR7A 1ZIOA 3K9NA 3EXAA 2FEOA 3WHLA 4B48A 3PENA 4MGYR 4B33A 1N6HA 2AKAB 4C0BA 4EPTA 4D6PA 1UKVY 3JVVA 4FXPA 4TYYA 1G16A 2QL6A 2QTHA 3FHOA 1GG2A 4PSVA 3W9YA 2RAPA 3KDSE 4G5SA 4HAVA 2J59A 1Z07A 2QM7A 3EAQA 1MO4A 2JEOA 3KKMA 4DKXA 5L3QB 4PO8A 2VO1A 4PC7A 3GFTA 4PR0A 2I1VB 2ZETA 1KZ7B 3R7WB 1KIMA 2YOHA 2J5XA 3LDAA 3BWDD 4TMWA 2GNOA 2RGDA 1VG0B 1II9A 1O3YA 4V0ME 1YR6A 2O8BA 1R0XA 4NP6A 2IYVA 3T12A 2F43A 4N3NA 4CW7A 2CJWB 2QORA 2JIZD 4A6XA 2ZAMA 2J1LA 1U81A 3EA0A 3IUYA 5DN6D 2C99A 4IDOA 1LB1B 4ITRC 4JLPA 2O0KA 3VKHA 4CEHB 2ATXA 4LV6A 2CLSA 2FSHA 1XXHE 1KY3A 4JL5A 4ZPXA 1M6NA 2AL7A 3VU9A 2CMKA 1KI2A 3CPHA 4HAYA 5AWFC 3PQCA 4DLWA 2FDCA 5DIFA 4LK2A 4PSKA 3NDBB 4TMKA 4TYQA 2CLCX 3UG7A 3KXIA 1ELOA 2O5VA 3ASZA 4HLQB 4Q19A 4QGGA 4YONB 4TYNA 5IK2A 3I32A 2QGZA 2ZSEA 1YZNA 4HDOB 4D2IA 1N6IA 3QUSA 1DAIA 1XXHB 1E4VA 1TF2A 2BJWA 2ZSAA 3BS4A 2R9VA 2DR3A 5J4KA 1W47A 4DLYA 1DAFA 3QVVA 1U0HC 3AVOA 2BJVA 3AF0A 1NN1A 5E7JA 1T3LA 1NSFA 3Q7QA 3U3RA 1G64A 3FPAA 5L3VA 3U44B 3LA6A 4IDPA 2XNDD 3BH6A 2JAQA 4A0GA 3AVXA 1I4DD 1XEWY 2CE2X 5LD2B 4JLVA 2BEJA 4DJTA 3O47A 1H8HD 3UK6A 5IF9A 2NO9A 1GSIA 1E1QD 3U2QA 3FKSD 4C7OA 1XCMA 2P6UA 2GJSA 4OBEA 3LX8A 4LHXA 1M34E 5DH9A 2FGJA 1WA5A 4BQSA 1OPXA 3GFOA 1K8RA 4U00A 4P4UA 3DO6A 1TUIA 2QAGC 1GTVA 4L8GA 1ZMXA 3FOZA 2RGGA 4X8LA 3LY5A 2WV9A 3QKRA 2L0XA 4MQBA 5JWRA 3TSWA 1NG9A 3NXSA 3QXXA 3ICEA 2GWHA 2RGNA 1IOZA 4BECA 4E07A 3TNFA 2RH5A 3Q72A 3AVVA 3U3JA 2IYYA 2IT1A 2QSYA 4C0SA 4EPXA 3D7MA 3K9GA 2CHQA 1HQYE 3QBTA 2ZJ8A 2QBYA 1XEWX 1QHHA 4YDHB 5J5CA 4DLRA 2H92A 4CEJA 1KTVA 4UJ3A 3AB3A 3TQFA 2AK3A 4QGAA 3CRQA 1M7HA 1TPZA 4RD0A 4EDHA 3DMDA 1W2HA 2HJGA 3EARA 2BHRA 2YOFA 1TQ2A 3D31A 1J2JA 3TLXA 3SJAA 1SVLA 4TQUS 1ANKA 3L0PA 4NPHA 4PHTA 2Q9CA 2QSZA 3PEWA 5DHFA 1W0KA 2IYWA 3SFVA 1XEXA 4EAQA 4Q1AA 1CJUC 4BLTA 1KSJA 2ORVA 2NIPA 4JLNA 3TSZA 2EWWA 3BC1A 4BLOA 2ZS9A 2JLRA 2XAUA 4MYUA 3B8HA 4ZIRA 1G6HA 2CDNA 1JAHA 2JJ1D 4WXRA 5DE3A 2PH1A 1T5LA 4Q4LA 4TN1A 4XOIA 4Y0VA 2ODWA 2F6RA 4MKHA 1NRJB 4M1WA 4BZPA 4DLXA 3FMIA 1D2MA 4GDFA 1R4AA 3T1VA 2IXGA 4Q4HB 3U7GA 2UZIR 4EFLA 4Q4JA 5JECA 2OHFA 1QBKC 2VP5A 3CO5A 1H65A 3H0KA 3GD7A 2BCGY 2O52A 5B2ZA 1G8PA 3B78A 4KI0A 3EPKA 3AVUA 1SXJC 4JS0A 5AJZA 2OBLA 2XJ4A 3X2SA 4M1TA 5KTYA 2EVWX 4KHZA 3LFUA 4D81A 1DEKA 5DYIA 5EZ5A 5KNDA 1KNXA 3TVTA 3ZZTA 4HYYA 4CT4B 3MAAC 2QUZA 1NBME 4JBYA 1W5SA 3QPWA 1TAGA 2RCNA 2C98A 2P5TB 1U2RA 3FFBA 4O25A 4URXR 2P0EA 2BBSA 3EASA 3ECCA 3U6KA 2C9CA 4L16A 1L4UA 1ZU5A 2OLJA 5DN6A 3VTKA 2XB2A 2F1HA 4KSBA 1ZM3A 1Y3AA 4TQAA 1GL6A 1NKTA 4P0TA 4US1R 4ARZA 4LBWA 3KQHA 1IBRA 4OI1A 3ZLJA 1OH5A 1EX6A 1IN6A 4GZLA 2GCOB 3K8YA 3LVRE 1CU1A 1DS6A 3T1OA 1YZQA 1YZLA 3FMPB 5TARA 3WHKA 4QKQA 1E0KA 2JLVA 1R8SA 4NCIA 3LBHA 4POAA 1IONA 2CXXA 4Q48A 2VRWA 4QJ4A 4I99A 3LNCA 4C2UA 4P4SA 4L9SA 2VHQA 3EC1A 1W7AA 2IYTA 3UKDA 4HZIA 2BDTA 4MUAA 2OILA 2XZOA 4PC1A 1RC8A 3KB2A 2FZLA 3DDCA 3EW9A 2QRZA 4ACAA 4GBMA 1E9AA 5FPTA 2DYKA 2H7VA 4EPWA 1LVGA 4U7DA 4MGZR 2XNDA 5BN3A 1E9DA 2WHXA 1TQ6A 1Z47A 1E2MA 4UXJA 4MDEA 3K70B 5CK5A 2QTFA 1G291 3KJEA 2FEMA 2ZJ5A 1H8HA 4DXAA 4BFYA 1JBKA 2WZQA 1E1QA 1QHXA 3FKSA 5EXXA 5DO9A 4NCHA 1E2HA 4RZUA 2IW3A 4WIAA 4F93B 2QU8A 3THXA 4JT2A 3HWSA 2GILA 3OE7D 3E2IA 2ZTSA 2CHVA 2ZXUA 1FZQA 1KK1A 2Q3MA 3W6OA 3LQQA 4FCVA 1KAOA 1G5PA 1YE8A 5LDDC 2WWXA 1OB2A 2W0SA 4AK9A 2ZRCA 8OHMA 4IDNA 1CRQA 3BE4A 4LDJA 4QL3A 5TV2A 3RRYA 2OZEA 5DI3B 4QHYA 4DWJA 3X1XA 1CTQA 1T6NA 3AP2A 4OKSA 2BKUA 5GADl 1SVWA 4OQNA 1XJCA 1S4QA 2DFTA 3O8RA 2B92A 1GOTA 3AKEA 3I5YA 5C2JB 2O8CA 2Q9BA 1HA3A 5L3QA 3BFKA 2V1XA 2ZRBA 2CL0X 4PC3A 3R7WA 4LJ9A 2R6CA 4PHGA 3SFZA 3EPJA 4F4IA 2CVHA 3B1XA 2ZE6A 2ODNA 3WYFA 2ZJZA 5FR2A 1TL7C 1NJFA 4CYMA 5IDVA 2YWHA 3BBPA 3WRYC 4JL6A 1YZGA 3A1UA 3TSOA 2MSDB 1HT2E 3FHCB 1CR1A 1VG1A 2DFNA 1XB2A 5HZHA 2ASEA 1PV4A 2WJVA 1EG7A 4MRSA 1RJ9B 4JLMA 3A6PC 3U3MA 1JEDA 1F60A 4PQYA 4CEHA 2XOKA 3R8CA 4EQ6B 3MLEA 1R5OA 1VTKA 1Z2CA 4LHVA 2VSXA 4NZYA 1DVRA 1SKYE 2A3RA 4JT4A 3HR8A 1NF3A 2JJ1A 4JLBA 2ZU6A 3RNLA 3GLGA 4XVRA 4KYUA 3ZD7A 3Q7PA 5A5GA 5TY0A 1OJLA 4FWIB 5FUXA 4ZDIA 4PQRA 2YKGA 4EUNA 4QHSA 4ESHA 3SHWA 2OO7A 4B3BA 1OYWA 3TJZA 4DSNA 2WJJA 2D2FA 2FOLA 3U6BA 2LWIA 1E9EA 1UBFA 2D74A 5EUMA 5FOUA 3AM1A 3ZVMA 2YZ2A 1SKYB 2PCJA 3A4MA 2VHJA 3HYRA 2FNAA 3VR5A 1FMLA 3RS0A 3F8TA 4JBWA 1M7BA 3WNBA 5K8TA 4O2RA 5JCPA 2CE7A 1LW7A 2CCGA 1OW3B 4IXMA 3U44A 2XTMA 3H84A 4OHVA 3KXLA 1GAJA 1QZXA 3GJ7A 3CRW1 4LBZA 4P33A 1IN7A 4D4KA 2EQBA 2WIBA 2WOJA 4WBSA 3THWB 2YINC 3OEHA 3GLHB 5JEDA 2ANCA 4KVGA 2GCPA 2GF0A 4IDHA 3ZIAD 4DUGD 5C4MA 2I3BA 3PJRA 3RC8A 4WZ6A 1OYYA 3W8RA 4YQFA 2P3SA 3AUYA 3VHLB 3H4MA 1KK3A 4O0MA 3WP0A 1XD9A 3NKVA 1QG2A 4LJ5A 2H5EA 3PEVA 2WVJA 5DHAA 2GKSA 4QBHA 1XPUA 2YOGA 5TDHA 1W0JD 2W0MA 3QXJA 4GRAA 3ZD6A 1E1RA 1KYIA 1OKKA 2ZSFA 4A92A 3CR8A 1E4YA 1ETUA 2XZPA 3I72A 3KKQA 3NTUA 2GK6A 3MWYW 4QGHA 2IS1A 4JVLA 4X8MA 1MRNA 3EIEA 3SS8A 3MGCA 1Q12A 2GJ8A 1VYUA 5CIQA 4DDTA 1UAAA 5H8WA 1ZJ6A 5JRJA 1AKYA 3GEHA 3GJ6A 3OIVA 1P61B 2D4HA 2ZI7A 1KO4A 1QVAA 3LW8A 4A8JB 4DEXA 3TUIC 1T3SA 5JSZB 2PX3A 3KL4A 4Q66C 2FX3A 1KI8A 1D9ZA 1KI6A 1U94A 5JEEA 4BLSA 1S96A 3IHWA 5HZKA 2RGNC 4O3MA 2WKQA 2KJQA 2DHRA 3U7FB 3V9PA 1XD8A 3W3AA 1BIFA 2OM2A 1Z3IX 1XJQA 3NC0C 1EFUA 4D25A 1Z0KA 2R6GA 4ERNA 3VAAA 1P7CA 2AFHE 4OJKA 1F2TB 3K09A 4B3DA 4PZYA 1VYTA 2K5UA 3K0FB 4E5UA 2HCBA 1OH6A 4RVCA 2NOAA 4A2QA 1O87A 2G1KA 5BN5A 1AA9A 1J7KA 1N5KA 4GP6A 4HDQB 4IOMA 1UEIA 1FNMA 1CJTC 1ESNA 1NVVQ 4YMTA 4HZUB 4KLZA 2QPAA 1OFTA 3GFPA 3B82A 4JVSB 1PZNA 5E7MA 1IN5A 2AWOA 1ZIPA 4HUTA 1AZTA 1Z0JA 2GEVA 3SJZA 4IEIA 1GZSA 2KSQA 5AUNB 4XH9B 4IXNA 2ECKA 2FA9A 3R9IA 2B6HA 2VA8A 3HJNA 1UJ2A 2W2TA 4JLKA 1ZUHA 4NYIQ 3NEYA 2A5YB 1KKLA 5B58C 3GLIB 1GRRA 4RD6A 2REBA 3UMSA 2JGNA 5GJVC 1AQYA 2LKDA 3A37A 4LYAA 3SZRA 3QBVA 3VFDA 2JDIA 5IK2D 3GMTA 2XXAA 5GJCA 2J9RA 3RS3A 3TW8B 5FUVA 4ON9A 1CXZA 4ESVA 1ZYUA 4H1UA 4RCYA 1T0HB 3L0SA 1KK0A 2RHMA 1E9BA 2GVZC 2ZRAA 1ONBA 1Q21A 4DLUA 1XCPA 3DL0A 4C0QC 3LLUA 1PLLA 4LRWA 1PVOA 4ILEA 2QMOA 2OFXA 4PFSA 2QE7D 3W5IA 2H8KA 2OCPA 3IEUA 1TQDA 3W34A 1E6CA 4HB0A 1IN8A 2GCOA 3AF4A 3THOA 5M04A 3GJ8A 5EE0A 3W6PA 1NL3A 3TKLA 3HU2A 4XTRA 5EXPA 1CF4A 3MSXA 1KAGA 4ASUD 3PUYA 5FPHA 1MR3F 1CBUA 1DAMA 4NYJQ 3RWMB 2XTNA 2C77A 4WAUA 2FZ4A 3U3KA 4YDSA 3CZQA 4LY6A 1G5TA 2QMEA 4IKEA 4AYWA 4M1MA 3JVUA 4CVNA 3I8SA 5KDOA 5KO2A 5KNBA 2IK8A 2EU8A 4WXPA 3UMRA 4A4DA 1XF9A 3BOSA 1WXQA 4TLDA 1LFDB 5H1YA 3I3SR 4AKIA 1FP6A 4QBGB 4IOLA 4FMDB 2A5JA 5F98A 4LJ8A 3SU8A 1TF5A 4Q01A 3SQWA 3L82B 1N0VC 1CR2A 3ADKA 4ZCLA 2KE5A 2IUSA 2PT7A 1PLJA 4M9XA 2JLWA 2AHOA 2IWRA 4OQXA 5B64A 2AR7A 3UWKA 3J81k 1N25A 3EZ9A 1FFHA 1SVOA 2CLDX 5FTJA 1OT3A 3FFAA 3RLFA 4TL7A 2YJTD 3VKWA 4EFMA 5C46F 1NP6A 3CF2A 3REGA 2FFHA 5JS7A 2P65A 4M53A 1ZNYA 3C4JA 1H8ED 4MRPA 1XZPA 2A2ZA 1GM5A 1W0KD 2UKDA 4Q21A 4XIGS 4Y0AA 2YWEA 5DI3A 3TUJC 4FMBB 3S1AA 2RGXA 2G88A 5KSZA 3R9XA 4W9MC 1D5CA 1HV8A 4TLCA 4KCGA 3N70A 2BOVA 2CCJA 4PHFA 1UBCA 2QMUA 2D06A 1T0JB 3WNCA 3SBDA 3CNOA 2QROA 2Q3HA 4QM6A 2GAOA 4NBSA 1FNNA 3EPHA 1OH8A 4FMDF 3IPXA 4X8HA 4YMUA 2IYQA 1B0UA 4WVFA 3OIWA 3DHWC 1X8KA 2ZAOA 3LVQE 1OHHD 1EFTA 1I2DA 3ICQB 4B2PA 4MYTA 4I1OA 2X2EA 3V00A 3GP8A 1X6VA 3QG5A 3B9QA 2WWIA 1DOAA 5EE5B 1T91A 4ACBA 3EWAA 1DAKA 2MSCB 2XB4A 3LLMA 4H9GA 1Q1BA 1YU9A 4OHZA 1Z6TA 5CDFA 4AKEA 4Q00A 5BXQC 2GZHA 1KI4A 1S9HA 3DVLA 4FINA 4NYMR 3T61A 1W36D 4TLEA 5DGXA 1VDZA 1ZINA 2CK3A 2JLZA 3EA5A 1OLOA 3L0OA 4V02A 5FBQB 2E87A 3PEUA 4NCKA 1CKEA 4PPGA 4EFNA 1VIAA 1U0JA 4EKDA 5E95A 3A1SA 4G5RA 1JXOA 4KFRA 1S9DA 4UXIA 2O8DA 1CJKC 1DAHA 1KI3A 2AN9A 1Z06A 2NO7A 4PAOA 1GVNB 1EFHA 3NHAA 1D8TA 4TTPA 2OXRA 3QEJA 4IEEA 2G83A 2PBRA 4AD8A 5KDDA 5JWOA 1P9RA 2F3RA 3BK7A 4C9BA 2OEPA 3T5GA 2P6RA 1KO8A 2V54A 5JS8A 3GJ4A 2FE4A 3TGPA 3U4QA 2C9YA 4LC0A 4GL2A 2P6NA 3C14C 4JSTA 2I4IA 1KZGB 1EXMA 5JCZA 1Z83A 1RVDA 2A5DA 1JQJC 3GLHA 1CJMA 1U98A 3VR6A 3FGNA 3W5JA 1ZM2A 2ZRDA 5FOVA 3SQXA 5B57C 2CL7X 5FL7D 4GI7A 2OLKA 4KFTA 1R6BX 4URWR 2Q9AA 2QTVB 5EZ6B 3KUDA 3D6TB 4EJSC 1QHYA 1CEEA 3K9HA 2GJKA 2R6AA 3MJHA 4CF7A 4QM7A 1G6OA 2EFGA 4HB3A 4F91B 3WMFA 1P73A 5KSOA 1IM2A 4DDVA 2VP4A 1G5RA 4G3XA 4IW3B 1K5GA 1KHTA 3AVPA 2ZSBA 1SVMA 2RHDA 2FPKA 5EP3A 4DRZA 4QJ3A 4LPSA 2QE7A 2ZUDA 3RSOA 2Q6TA 3CBQA 3B1YA 1NSTA 3PUZA 4XTCS 1Z28A 5BYKA 1U9IA 4IVRA 2ZSDA 1TU4A 1ZD1A 5G3YA 4PXAA 4US0R 1IXRC 2OXCA 4ASUA 4AKHA 1P9NA 2P5SA 3U60B 1FOEB 2SHKA 1V5WA 3IBGA 1IY0A 1VECA 1HEIA 2R44A 1D6JA 5G53C 3AH8A 1E69A 3EC2A 1NG1A 5JHHB 4ZKDA 1UEJA 1RFLA 1RW4A 4NMMA 3A1WA 4L5BA 5L3RA 4L9WA 1SHZA 2GJ9A 2ZI9A 4A0FA 4B3XA 2O8FB 2WWGA 3TUZC 2ZE5A 1KDTA 5JLJA 4UNQA 1LF0A 3B9PA 3NWJA 3FB4A 5TMPA 2HXYA 3IQWA 1W1WA 1Z0DA 4M9SA 3VR2A 5IHPA 4QGFA 3TE6A 2DBYA 1Q20A 3NBXX 2HLDD 1E2IA 4HLUA 4Q9IA 2QAGB 3KQUA 4KODA 3X1YA 2ZI4A 4TL6A 3X1WA 1G8GA 3PXGA 1JJVA 4R9UC 1P60A 1G7CA 4Q7LA 2ZRNA 3IO5A 1YZUA 2WWHA 3WMGA 5KHOC 3B60A 3QI2A 3IHLA 4QG7A 1H8EA 1VMAA 2P2LA 2R6FA 5DISB 4A2PA 1N6PA 3MWLA 2ZRMA 3FVQA 2V4ZA 1P72A 3WMEA 4HAUA 1HYQA 2XOKD 3CWZA 4ZKEA 5GVSA 3M1IA 4KBGA 4LSGA 3K09C 3RRMA 4AI6A 1GUAA 1E2DA 1PLKA 4Q9KA 2J45A 1II8B 4DSOA 1WCV1 3L8ZA 2IXFA 3AF3A 1YQTA 3BERA 2ZVPX 3GLIA 2EYUA 1QDEA 3DOFA 4XD7D 1FP7A 1A1VA 2OESA 3C5CA 1ZM9A 5AJWA 3B1WA 2J7PA 2NPIA 3RANA 5J4YA 5AK0A 1Z0IA 2GJAA 3MCAA 1E2QA 4A6PA 1DO2A 1N6NA 1OHHA 1NLYA 4BWYA 3LV8A 1Q1ZA 1R7RA 5G40A 2IF0A 1SGWA 5J47A 1K5DA 3WYAA 4JMPA 1X86B 3PCRB 1KMQA 2NO0A 1V43A 2DB3A 2FSGA 2WJHA 1NIPA 2VSOA 2WBLC 3KQLA 1F2UA 1ZNXA 3A8TA 2O8EB 4RD3A 1OFHA 1ZD9A 3AEZA 1W46A 4BLRA 4M9QA 2J0VA 4DCUA 4JBXA 1TTTA 3OEHD 1T8UA 3KJIA 3SDZA 1SXJE 2H18A 4DT1B 2BMFA 1XPRA 4Q4AB 4B35A 3H2YA 4LHYA 2IBMA 4D4JA 4JLDA 4B44A 3AVYA 5F9HA 4ZDKA 3GEEA 3QJYA 1NN3A 4CT5A 2QRNA 2C5LA 1FTNA 4G5OA 1NY5A 1US8A 4ZDJA 1AQUA 2UZ3A 2D2EA 3M6AA 5LB4A 1SXJB 5H68A 3EX7C 2ODEA 4OK3A 1RE0A 1A2KC 3THYB 2BBWA 4GSYA 1E1RD 1OKKD 4ZDWA 2C8VA 4XSGA 2F9LA 1KDPA 1PJRA 4ZCIA 4XWOA 1OE0A 3KKNA 721PA 3F3YA 1DAGA 1R0WA 2XX3A 2G9NA 2QY9A 1RRCA 5FTLA 1E0SA 1XJ0A 4HLDA 1FX0A 1AKEA 2EFEB 4CZ2A 2WAYA 1NKSA 5FL7A 1JR3E 3BAFA 2HT6A 3U61B 1XD2A 3TW4A 3KJGA 4HI0E 2GK7A 5FTMA 4HDCA 1JB1A 4RCZA 5KDLA 2NO1A 4PHHA 2GETA 3F0TA 3GLFA 4B2LA 1Q1QA 1G3IA 1XTRA 3G0HA 4TSFD 5ANRB 1BH2A 3KFVA 3UWOA 3ADBA 1E9FA 3O8BA 2Y8EA 3RRZA 3SR0A 4EPYA 1KKMA 2QQ0A 2ZYTX 1G7TA 2ZRKA 1VCNA 1OXUA 1FQKA 2OBNA 3SN6A 4DCNA 3RDPA 4RY2A 1KSFX 3DOEA 3WRXC 3OAAD 3P26A 2C9OA 1GNRA 4KITB 3PG5A 4KSCA 3X1ZA 1KI7A 1CRPA 5KSPA 3KTAB 1L8QA 4NHOA 4JL8A 4TZ0A 1DADA 1MABB 3ZQJA 2HDNB 2J0UB 1JEEA 2DWOA 4GPTA 1AS3A 5HE9A 2AKYA 4NCNA 4TLAA 4CRWB 4MGIR 1J8MF 4RD1A 1NVXQ 2QNRA 5SZIA 1S3GA 1EWRA 1KO5A 2IC5A 3NC1C 3LX5A 2WM9B 1YRBA 2ZE8A 3UIEA 1GNQA 4C0JA 4M4SA 3FDIA 2IYXA 3ZS8A 2Z43A 2HLDA 3W90A 3Q85A 1QVRA 2QPTA 1XBTA 4DLSA 1ESMA 4AYXA 1TADA 2ZQ5A 1JALA 2CCKA 4A9AA 1Z0FA 5AJXA 1VG9B 4DHEA 5CB8A 2JDID 3CR7A 4HEJA 1F5NA 4E09A 5JMTA 1G3MA 3IO3A 3QEOA 4Z8YA 2ZRJA 4DB2A 2A5GA 2GRJA 2HF8A 1N6KA 2CJWA 1WB9A 1AN0A 1T9HA 4QFMA 5AR1A 3I5XA 1G7RA 3ONWA 3P1JA 4LJAA 1W48A 2ZI3A 4R98A 1XMJA 4BFTA 5A4JA 3FE2A 1NBMD 2J7KA 4W7SA 4G5QA 3CPEA 1WDTA 4V0MA 2WSMA 1A82A 3AGQA 3CW2A 2ZITA 4N1AA 5EE1A 2H1LA 4QHTA 4YXWD 5CM8B 2B8WA 2YC4C 2FV8A 5F3WB 2JATA 3R8FA 2WSSD 1XU4A 3A36A 4AG5A 4DC9A 1XMIA 5FOXA 2X8AA 4XD7A 4C2TA 2BM1A 4IHQA 1DTSA 1XXHA 4UNPA 2GZAA 2CNWA 3ZZUA 1UPTA 4Q03A 3CH4B 2LKCA 1ZC4A 2V6JA 3I1FA 4R2HA 2N46A 2IA5A 3F5FA 3NIBA 4R2IA 5FI1B 1Q44A 2AXNA 5CITA 3RHFA 2GCNA 2NTYC 1IXSB 2GAAA 2ZI5A 4MA4A 3MWJA 3T1QA 3P27A 5EUQB 1OSNA 4N0DA 3K70D 4GP7A 1G21E 3A1TA 1VYVA 2VP6A 1Z63A 1XTJA 4G01B 1G4UR 2TMKA 5EE9A 1ZUNB 3PUXA 3DPUA 1PUIA 1XP8A 5FI0B 1N0WA 1N0UA 2F43B 1YKSA 3Q9LA 3CF0A 5BQ5A 1Z29A 5FOSA 5E3HA 1Z08A 4HAWA 4YMSA 1ZP6A 1ZU4A 4TWZA 2IS6A 4B47A 3WNDA 3C5HA 4J0QA 4DIDA 1SULA 3K0EA 2EW1A 4JLJA 4PPQA 4D4LA 1VKJA 2OCAA 2FFQA 1NVWQ 2A7QA 3JZMA 5K8IA 3UPUA 2O8FA 1KSGA 1XZQA 3PFIA 5BYJA 421PA 1ZRHA 4DVGA 5DSZA 1TEVA 5JHGB 4DIEA 2I1QA 2ZUCA 1WF3A 3C7KA 1E99A 3AF1A 1U90A 3RABA 3OHMA 1NLZA 3MWKA 4GOJA 2IEZA 1ZD8A 2DWQA 4HSEA 2WWFA 1D2EA 3PUVA 4UKDA 2F1IA 5F9FA 1FW6A 3KKOA 3SBEA 5CLQA 2YVUA 4O2LA 4Q47A 2V3CC 3VHXA 4LZZA 1E79D 1VHLA 3GPLA 1HY3A 4JYCA 3VMFA 2G0TA 3H1TA 1CP2A 2BBTA 2HXSA 1IY2A 2OAP1 2RGCA 2GHIA 4M0LA 4NU0A 3MD0A 1RYFA 1MT0A 4FN5A 4TMVA 2G1JA 3BXZA 1TEXA 2RGBA 4TSFA 4IFBA 4XWAA 1ZCAA 4TT3A 3D8BA 2NQ2C 3UANA 2UVQA 4IOJA 1Q57A 4BFVA 3ADDA 4QBIA 4C7OB 1HUQA 2NZJA 1NI3A 2QAJA 1ZCBA 5G3ZA 4C30A 3NVAA 2G77B 2MMCA 2VH5R 1E0JA 4FCWA 4LHWA 5D3QA 2HF9A 2W83A 4V0KA 5EP1A 4KFUA 1IJFA 5EE3A 4HLUC 3SYLA 3OAAA 1KY2A 4MYCA 4K46A 4DLZA 4JJZA 5BW8A 2EFCB 2MMGA 2CK3D 3M4YA 4ZI2A 4OQFA 2BM0A 4II7A 5TVKA 1ZBDA 4B6EA 2GZDA 3QKRB 4GT1A 5FBLB 1N2CE 4JZKA 1KJZA 1KO1A 2YC2C 3L43A 4WZBE 4Q4HA 4JLAA 1XCGB 2BMJA 1C4OA 1ZVQA 5CLLA 1IAQA 1SQ5A 1S8FA 2XEXA 3LWNA 1P2SA 4MUBA 1MOZA 1YZKA 2BMDA 5FUWA 2JJ8A 1GNPA 2QBYB 1CR4A 4CEIB 2PEZA 2Z4SA 2O0HA 1XTKA 1KI1A 2CL6X 2Z4RA 1EFRA 3LAWA 1GKUB 2V9PA 4CEJB 5IT5A 4PC6A 2ZS7A 3BIFA 1XTIA 621PA 3W6NA 1T3HA 3GJ0A 4A0RA 5KNCA 1OXSC 2V6IA 2XSZD 1SVKA 1AK2A 3QG1A 4Q4AA 4LUCA 3EZ6A 2R62A 3AKYA 2HCJB 4XJXA 2WTUA 3CIOA 2D7CA 1ZM7A 2H17A 5FH9A 1XEXB 3P32A 4FI3C 1TF7A 1VCOA 1J70A 3Q8XB 4NE2A 4KV9A 1E96A 4BRUA 2VP9A 5L3SB 2BIFA 2P67A 4FD2A 4JIMA 4M1SA 4BRWA 4ZIRB 2WICA 1NBMA 2C95A 2ORIA 3CRMA 4DLVA 1W4BA 1G3UA 1NMZA 4RKFA 3UATA 2QG6A 3CPJB 1W4CA 2IHBA 3G82C 2XTZA 4PTLA 4OK5A 3IQXA 5CJPA 1JPJA 2OCBA 4YXWA 1W36C 1UDWA 3O8DA 3RAPR 3K1JA 2WSSA 3RRNA 1R8QA 4G0NA 3H86A 4YMWA 1M1YE 4TMZA 3MMPA 521PA 1UBEA 4B71A 4OYHA 3BH7A 1X1SA 1ZUIA 1L4YA 4Q4JB 1JR6A 4PPNA 4B3FX 1HE8B 5BWMA 5D3MB 3V4RA 2VF8A 5HCIA 2QQEA 3E5HA 2JASA 3ZH9B 5LBIA 3HYTA 2ZROA 3EZ2A 3NH9A 2PMKA 3BB3A 1GKIA 1DBSA 4GMXA 4URVR 1LS1A 3K0CA 3VKGA 5FBWB 1E9CA 4HB4A 4FWTA 4BGDA 4MYHA 5G41A 4JKYA 3G5UA 1LY1A 2ATVA 2F3TA 1TMKA 5DYGA 1S3SA 3VR4A 5CM9C 3ETLA 1OB5A 5JI2E 2J0SA 1D2NA 4TLBA 4BEJA 1II0A 4Q7JB 4WA7A 1G3QA 2OBMA 4RJLA 1Z0AA 1E94E 4W5HA 2OG2A 2GXQA 2J87A 4OQMA 2JLQA 2C04A 2IYLD 1N5JA 2O0JA 4IOKA 5L8VA 1E9RA 1P2TA 1OIWA 2G6BA 2KWIA 3MUFA 4ARZB 2FGKA 1IY1A 4LHZA 1KDOA 1IN4A 4BLPA 4IFEA 1MABA 1COWD 4AKGA 1TNDA 5GJBA 3WBJA 4DLTA 2QGNA 1XX6A 1DELA 4LYHA 1Q0UA 2ZRPA 4UNNA 2GDJA 2ZRIA 3FTQA 1JPNA 2B7BA 4YLGA 2ZR7A 2ODBA 3CX8A 1Q3TA 5CK4A 4D4MA 4P4SB 3QIAA 2ZR0A 2GEUA 4IJMA 4QNRA 1RYHA 3AVQA 1E79A 1JI0A 2ZJOA 1BYUA 1IQPA 1YR8A 3IILA 3PR1A 2BEKA 1GILA 3FHTA 2JLSA 1FUUA 4KFSA 1R10A 2J7PD 2ZJYA 5GVRA 4MRNA 4Q1EA 2PJZA 3K0SA 1X8LA 2GXSA 1BO6A 2WPDA 4JKIA 2FG5A 3CX6A 2BMEA 4BFUA 2FSIA 1IXZA 1YRAA 2HJVA 2WOOA 2ZUBA 4OHXA 1RJ9A 5JJKA 3KUCA 5HKKA 3NBZC 4W5JA 5ELXA 3VNUA 1Z6YA 3KXKA 3VNVA 1P5ZB 1BS1A 3U7HB 1Y63A 4BLQA 4EQ6A 3IDQA 4MRVA 3THXB 3BFXA 2FPMA 1NLFA 2X1VA 1KI9A 1KJWA 2Z0MA 3EIQA 3NBFA 3TQCA 4CIDA 1CS4C 3AV0B 5J4VA 3EZFA 1EFCA 1QHIA 4TMXA 5HPYB 1CR0A 5K8LA 2ZIAA 2IEYA 4EIWA 2OV2A 3TK1A 1AGPA 4OHYA 4ZI3A 3QSYA 1SKQA 3L8YA 3WYGA 3EWSA 1YR7A 4B3CA 1OV4A 3OFNA 4TZ6A 2Z6VA 1W49A 2ZPTX 3GJ5A 2FH5B 1C9KA 1OXVA 4WW0A 2FSFA 2F1JA 2O8CB 1AZSC 1OH7A 4MRRA 3AGPA 4ZV4A 1TUEA 4A2WA 4LCBA 5JBQA 4OI2A 3QY0A 3QENA 1SVIA 3PV0A 2B21A 4LBVA 2E9SA 5CYOA 1NMYA 1S0UA 1UFQA 3MG9A 3QVUA 2PLFA 1MRSA 3KB1A 3Q5DA 4HUQB 2BBOA 4L4UA 4OI0A 3THWA 1M7GA 2XSZA 5JFGA 1KSHA 3KQKA 2ZYVX 4DCVA 3TIFA 5DLQC 4D0NA 1Z6GA 2GEDA 1GDDA 4LBYA 4RFSB 2HYIC 3OZXA 3GLGE 2OSBA 5EP4A 4LC1A 2OUKA 1QG4A 3AKCA 4IDQA 4Q9LA 1G8FA 4F7WA 2REOA 2EFDB 2YV5A 3AUXA 2J3EA 1MO5A 1U99A 2NZ8A 1TQ4A 1KDRA 3CLVA 2IYSA 5LPNA 1BOFA 2WMOB 2PL3A 3CX7A 1CJVC 1DE0A 3KFXA 3ZVRA 1A2BA 2CHGA 4I1SA 4Q7KA 1YVDA 3GLGB 1OIXA 2E1RA 5LD2C 2V7QD 1QRAA 2G3YA 1E2GA
chains in the Genus database with same CATH superfamily
1EZZA 3RS4A 1DRWA 4Q9HA 4XQGA 1PAUA 1AM4D 2BDUA 4JR2A 2HIMA 2PYZA 3VX3A 4LYEA 1ESZA 3ZS9A 4PNEA 3ND8A 1U4NA 1B00A 1XTQA 2DVMA 2IUTA 4WOBA 4EHAA 2XVZA 1WU7A 2C57A 2WMNB 4PSAA 1QMPA 5AOBA 4EF6A 3TCKA 4Q7MB 1KARA 1HMYA 1RBMA 3DXXA 4U02A 4F4HA 1H9CA 3HJTA 3KU4A 4A8JA 3HNRA 1V3VA 1LUAA 2VJCA 1P6QA 2ZEJA 3AP1A 4X63A 2C84A 3WY9A 4F3NA 4Y9RA 4YRCA 2J9XB 1T15A 4XYEA 3OCJA 3TX2A 3OVMA 1BDBA 1W5AA 3VDMA 4CMIA 3K9LA 4ZAVA 1UMCB 1QVWA 5DHPA 1PT7A 1ZL0A 2JD1A 2ZIXB 1N33B 1LX6A 1HF3A 2MSEB 1FMJA 1U2ZA 3D3JA 1B23P 1RQXA 4OJYA 2J3KA 4DYDA 3VQTA 1LI4A 1N6OA 4YACA 4B7CA 1NX9A 5DEIA 4S3MA 4TUYA 4FLEA 2B8TA 5JQGA 3FWYA 5IAEA 3ILYA 1JLKA 4N7RA 1S1MA 2DQKA 4DJAA 4E4TA 1F2TA 4BWFB 1N32B 5KOIA 3R5TA 4WCDA 3RASA 4G1UC 3VA7A 5BUQA 4BFXA 2AGVA 2WAXA 2AD1A 3CFYA 3K0FA 4PYNA 4PYRA 4WMLA 4FDUA 2HQ1A 1Y6RA 4QX6A 1A8UA 2HQRA 2X5XA 2NVUA 4JFAA 5SZHB 4OQLA 1L1FA 1HT1E 3U9LA 5FPKA 3ZHVA 3VM6A 1GR0A 1VA4A 1ZWLA 4GOOD 1RKBA 3HPRA 4D3YA 5B2FA 4YRJA 4AN0A 4RTLA 3IAAA 3C43A 3DHYA 1IC6A 1OJ7A 1V8FA 2OXFA 2VHTA 2X8JB 2RKOA 3K2EA 1KTIA 2Q21A 4ZU3A 1DCMA 2OAEA 3TR0A 4MJ7A 3E48A 3HEMA 4ZO9A 1QPBA 3B5IA 4U7FA 4Z9XA 3LQFA 4R3WA 3AHHA 1E0AA 1Z6XA 4BP9A 5CP8A 1YZTA 4RPCA 5KC8A 2IX3A 1NVVR 4EDFA 1GUBA 4GICA 3CRVA 1UFRA 2DTXA 3C7TA 5H3CA 3B51X 2VHUA 3WXMA 3VAZA 4BO1A 1WP4A 5GIPE 1TC1A 2WYIA 3QXSA 2HQSA 2VSQA 4WADA 4PZZA 4ENVA 4TRRA 2JCXA 3G9XA 4XPIB 1L7RA 5K09A 3DZDA 1UKEA 4PICA 1OBOA 3ZOZA 4HNAB 4BNNA 4B76A 3THSA 4FGWA 2MHCA 3KIPA 4JUIA 5J5VA 4X84A 4R2MA 3VSBA 2AG5A 3WK9A 4BHTA 4QGSA 4X94A 4RF2A 4BVGA 5ICFA 4Y1GA 2XBMA 1P3DA 3M3DA 3W77A 1CY7A 3QKWA 3TJRA 3GROA 4I0WB 4JEHA 4CXMA 3E3AA 2JD2A 3ZR4B 3LX6A 4G41A 3QYJA 3EC7A 1Z5ZA 4UVDA 3MMSA 5TQ0A 1KEEA 2W2MA 1K7EB 2CYAA 1U0TA 1PJ3A 5CFNA 1AQNA 4OH1A 1G41A 4EECA 4A5SA 1I0IA 1SCUB 1PJTA 2GUWA 2FU5C 3G1TA 3RUPA 3ZV7A 1IEQA 1R3DA 4W8HA 3HH8A 1NDHA 4OHFA 3F6SA 4V3BA 3WHPA 1GKYA 4RZXA 2CSUA 5G0TA 5A5DA 4FFSA 4R6WA 3W7AA 4KR0A 3ZX4A 2GVNA 5SY4A 4LXHA 1JFLA 2C7PA 1WXFA 3WI7A 1KWGA 4RESA 3G2QA 2VSFA 2OV8A 3RVRA 1DXHA 2Z1DA 2IZ0A 1A9ZA 3RYFA 1RTTA 3IT2A 4BASA 1HXHA 2R1VB 4WZAE 3QP9A 5LJLA 1DCTA 2HWKA 4F46A 4MA5A 1E18A 1NN0A 2WTMA 3SC6A 5U9CA 2GFIA 1T8RA 3QWIA 1AS2A 1P3JA 1QKIA 2GTHA 2PWZA 4UCQA 1EXNA 2MSNA 4KP7A 4EGAA 1EUYA 4GXTA 1HX7A 2PZFA 1D0IA 1BXKA 1HYHA 1NBIA 5CYPA 3RAEC 2IPLA 2I6TA 1DKPA 4TWJA 4RK6A 3MN1A 2JKYA 2XXAB 1RXVA 4M8NE 3LIIA 1WB5A 3B5JA 3ZKWB 3T1NA 1AGYA 4ZYUA 2AWNA 1JHVA 4L2IB 1S8NA 4YJHA 5G1PA 3VR4H 5FWNA 3BSFA 3OOWA 3I52A 5AHOA 5B4TA 2WIAA 4Z1MD 1RQGA 1QQBA 4YJ2A 1PG0A 1GP2A 5AW7A 4NICA 1EHIA 1YB4A 2XKBA 4YMHA 3DM5A 4MLDA 1B8VA 1CVIA 1SK8A 4KQWA 3NV7A 4H1HA 4N5HX 2ZYSA 1AHNA 4DILA 5BWCA 2NACA 3QW2A 4H1VA 4LV8B 4IEFB 3CZPA 2AMLA 4NE7A 3AR6A 1Q83A 3R6LA 1E2LA 3HUUA 4TT3D 3EBLA 4RXUA 1DFGA 3PC8A 3TH5A 1Y8QA 1UKZA 2YWBA 2DXIA 2VHEA 1Y7PA 5A62A 2MYUA 1GITA 3L4EA 3MJSA 4G9EA 3VBCA 3DKKA 3PXBA 1W4RA 2FN9A 5FPQA 4RTQA 3PNLA 3EEYA 4GG1A 5F9MA 1PT9A 5K8JB 5CNIA 2XW6A 3KSBC 1LKZA 4V0NA 5TEWA 3A9RA 3VVCA 2G72A 3GN2A 3D5QA 4WUVA 3N2ZB 4NK5A 1VL6A 5AKKA 4YC7A 1EDDA 2PUDA 3DMNA 1J90A 4MQEA 2YMMA 4MKGA 3KSAC 5A6SB 2IHYA 3GN1A 3FMOB 4OB6A 4QULA 4WDQA 4R71A 4YXFA 1F7UA 1J25A 1RIFA 4MVJA 5LYJA 3BCRA 4I36A 4EA9A 2F55A 5KIAA 2F8MA 1YHNA 1ZMRA 1PBTA 4BX8A 3IKJA 3RNOA 2X7XA 2VF2A 1EE9A 3BCHA 2INGX 1DI0A 3OTIA 1VPDA 2RHRA 3TIGA 5MHTA 5JZSA 3LD9A 3WQQA 1XFAA 4X1KB 2O2JA 3BT7A 2A86A 2AOXA 3JRXA 3MLAA 3L4SO 4IINA 4CM1A 2ZUFA 1Z38A 3LFHA 4G6ZA 1U9ZA 1W2GA 2BRUC 2A92A 3PPIA 1VCMA 2CUTA 4JAVC 4NFSA 4R1PA 3BRWD 1T6XA 3QVOA 1YIOA 4ND8B 3ND9A 1X1RA 3MXOA 4ZU1X 4TROA 1OWPA 3G2LA 2YWRA 1C7QA 5JMPA 1Q0PA 4IH1A 4R40A 3AKDA 4B4DA 1I7LA 2VZ0A 4OHWA 2ZE7A 1ISPA 3VISA 4D43A 4BU0A 3OX4A 4XB2A 4UDOA 1O0BA 2X0EA 3S1AB 2AQHA 4Z3DA 5B58T 3OIDA 4WBNB 2XVYA 5HP4A 3IS3A 3HR4A 1JHRA 4UEWA 1U7TA 4M1QA 1MW9X 1SXJD 1LPOA 2NWQA 2W4IA 2ZULA 3QPAA 4I50A 4QNMA 2XMZA 2QDKA 2VTKA 1EP1B 1QAQA 1XMSA 3WTCA 1QCDA 2JFUA 3AUSA 4GHWA 4HMQA 3D3QA 4NX2A 4PW0A 1HBJA 3VR1A 2UYHA 2XMBA 1AKQA 2IOHA 2XMPA 2H7CA 3ESCA 3FTPA 4MCHA 4KE6A 1IZ8A 1NFRA 4TKZA 1AKVA 2ENWA 2P78A 1GL9B 1PFUA 3OJWA 1I4TD 3LQYA 1PD1A 2YDXA 3OPMA 4TQ9A 5IKPA 3NBYC 5J1SB 1R6TA 5TMDA 3RT1A 1GRVA 4CL8A 5DGHA 1V8BA 3I61A 2DH5A 2VHCA 3PK0A 4XDYA 2QTRA 5H5JA 4RL6A 3WLOA 4NYMQ 3RLIA 2A9KA 5FEMA 4BGUA 4DCCA 4Z0TA 4EAAA 1ZK4A 1TTHA 3PYMA 3Q3GE 2EYQA 5B2EA 1U8ZA 4R1TA 3R0VA 4RUKA 1GPJA 4BKMA 4N65A 3G13A 5F5NA 1FRQA 2FUG6 5E7IA 4LJ6A 3RQIA 4AQDA 2DC1A 4MW6A 2Y1FA 3MB8A 1YQUA 2F9MA 2IOFA 3C15C 1JR3D 2WB2A 2QJTA 4FYWA 2ZRFA 3MCWA 4Q18A 1YI0A 2WF5A 1A98A 1HYEA 4DN6A 4OHUA 1QHFA 1XEFA 1XIVA 7REQB 1P1FA 5KNLA 4BNLA 2LIVA 3E53A 5DGIA 4BQNA 5JZVA 4J2TA 1S2IA 5AKZA 3ZNPA 1MKYA 1B2RA 2IL1A 4K81B 4GR4A 1SVSA 3L1KA 4ISCA 1FQJA 3F97A 4NV3A 3R3UA 4XIYA 4B6FA 2EIXA 1ESCA 2RBEA 4Y1EA 3U19A 5BP7A 1PL0A 1SWWA 1AIPA 2JCYA 2OAQ1 3BIXA 4D82A 1EWQA 1E98A 1LF5A 1L7MA 1ZCZA 4XWGA 1ZESA 4RKWA 1NBEA 1XNJA 3IIJA 4FD3A 4JP1A 3FVWA 3U4QB 5LIPA 4KN9S 4QPNA 1I3LA 4CCYA 4AMZA 2BGMA 1M73E 3ON5A 4HPJB 4K88A 3KV3O 1Y9ZA 2E5WA 3G2OA 4W5WA 1JTEA 1DO0A 4RQAA 1NP7A 5T57A 3FMFA 2J46A 3R3WA 4J29A 4ZOBA 1U8AA 3A4LA 2D1SA 1TIBA 3M5WA 3AOEA 3NHWA 2XJ9A 1E64A 5H83A 3PXDA 3E9NA 1X3SA 2JW5A 2ZZKA 3CF6R 2R5WA 3NR2A 4XX0B 3WP1B 5IBCA 1E0DA 3ZN2A 5K8VA 3HU3A 1DT5A 2Q8PA 1G8YA 1ZRMA 5SZJA 3AIIA 2A9OA 4N0QA 2XVXA 3IAS1 4TRNA 2YXNA 4WK0B 3RIYA 1QJ4A 1J99A 1U2TA 3R23A 4U6NA 3BL5A 4WNCA 3AW9A 3E9QA 3EN0A 4XEHA 2JLBA 3L06A 1AS0A 2YHBA 3QPVA 4A8JC 1SUCA 2ASVA 1VE5A 2Y1OA 2PSFA 4I6EA 4KRXA 2Q5OA 3IEPA 4XVHA 4P86A 4X3PA 2IYRA 1GAQA 1XDZA 3AUUA 5DU2A 4AJ9A 5EFZA 2X76A 1NAHA 2DY1A 1RDFA 3FLEA 4MUXA 4A36A 4D44A 4QRHA 2WWWA 4WFJA 5HKKD 4OK6A 1DAPA 2X19A 5FWXB 1HDIA 1EVLA 4GYWA 3TOXA 5KOYA 1V39A 1DXQA 3H1EA 3D7LA 3LQ2A 2DPLA 3TLKA 3NJ4A 1V1RA 5IAOA 1ZSYA 3MRSA 1JG3A 3IFSA 5T41A 5AKXA 3KR9A 4PRYA 4EABA 5FPYA 5IABA 3UB4A 2VIIA 1KOJA 2HJ9A 2RI1A 2SKCA 3MUNA 3O83A 2O7NA 1JHDA 1FUYB 3RRXA 4AMYA 3AM4A 3WB9A 1F6BA 3HDTA 3U9TA 3A70A 2JHFA 3IIKA 3SYMA 3ZE7A 2X0JA 4FMCB 4R6XA 3TD9A 3MNFA 4IFIA 5FORA 1L8XA 1YJBA 3NALA 1E32A 2VDVE 4FJ1A 4MHTA 2CV2A 3T1TA 3S4YA 3V4ZA 3OFND 1NT2A 5I4CA 4RVSA 3VNQA 3GLTA 2BHLA 2QP4A 4O2AF 1Q19A 2PTHA 2A67A 2PZGA 4HNTA 3MAJA 1UEXC 4W1SA 3RYTC 2REXB 1U3VA 2QZ4A 5JNLA 2BAGA 1E92A 4INOA 1IM5A 3KSRA 1P7PA 2WD7B 3L8EA 4FYMA 4TN5A 4UBJA 3AB7A 1G4HA 5AJUA 1QHHB 3PNPA 4C6SA 1Q3HA 1KOFA 3CHYA 4AZ0B 2QTCA 5JIBA 2OV1A 2O8EA 3ZTYA 5B55A 3DLTA 3JVEA 1ZDMA 4UQLA 4URYR 3JQDA 3OIGA 1U8YA 3STUA 2O50A 2NZXA 4DLNA 4DT1A 2HUPA 2YHAA 2KI5A 2JFZA 4AT1A 3G49A 3HB7A 3PX2A 3AVTA 1LGYA 3LXUX 5JWHA 3SY8A 3C8UA 4IRUB 3ORSA 1G9XA 3MCUA 4IIJA 2QT9A 4PPFA 1GLGA 1PWXA 1RRGA 2BGLA 3IBYA 3MK31 3I2YX 4QUAA 1DG3A 3CM0A 3Q6IA 4I4LA 2AC2A 2QENA 4ZCQA 3HYNA 5EJEA 5M2QA 3CW9A 4JZYA 4M2LA 3QHQA 1TYZA 4CODB 3QKSA 2G82A 1W5TA 1BKDR 4D1YA 4NBTA 4RH3A 4NBKA 5FP0A 3ULKA 2C7RA 4PAMA 1V37A 3WBKA 2GHQA 1JKFA 4MKIA 4Y6SA 4US2R 3MJTA 4CMEA 2X0IA 4AX8A 1TCUA 3DVQX 1P7YA 3O38A 4Z4HA 1W94A 1M9NA 1HOXA 4G4SP 3N8HA 2AOUA 3IODA 1SUAA 3X1KA 1JEQA 1Y81A 2V55B 1N0IA 1JDSA 1M67A 5HILA 2VK1A 4HATA 1Z6AA 2IPXA 3E9YA 4PO9A 5EEGA 3UFBA 2RMKA 3IR5A 3E2PA 4F97A 4CMHA 4CTNA 4GLLA 2O54A 3GYBA 2IZOA 3TWOA 2MINB 1E3EA 1J2TA 2NVBA 4JY7A 1EWYA 2OWDA 3DOUA 4EMBA 3KE9A 4C0HA 1T36B 4B8YA 2JLXA 1CFJA 2Q1SA 1BXGB 1M1YB 4KYVA 1MXHA 1HG1A 2H1OA 1NY6A 4ODIA 3DONA 3E9ZA 4L76A 1NRWA 2W22A 3WGQA 2B94A 2ZJBA 3NP9A 4OOEA 1KPIA 1WE2A 2GBGA 3VYTB 1YFZA 2ONKA 3AF2A 3ET5A 4M38A 3VOBA 3PE6A 1CZKA 3OT1B 3K05A 3DE2X 4LJSA 3ZDRA 2VTVA 2C96A 1YSCA 4B34A 2ILVA 2NV0A 4QXPA 9MHTA 1C29B 4GI2A 3DZCA 3L7OA 3MD9A 1IHUA 4KLAA 1BE6A 2H9AA 4MVJI 5JPDA 1G17A 3PF9A 3R1IA 4F8EA 2FZVA 2PJRA 4EFKA 1GZ4A 3U16A 16PKA 4G1MB 4KQKA 3P9PA 5AUQA 3KTAA 4NL4H 5KTMA 1NLMA 4O4JB 5JSHA 4UEOA 2C9ZA 4DIBA 1THTA 3QELB 1SA0B 3KLNA 1DBQA 2Z5VA 1JT9A 4GMDA 1XU9A 4QQNA 5FWYA 3P9CA 4LNUB 3GLFE 3DKRA 2EZUA 4PXSA 4JVNA 1DWQA 1ONSA 2OCYC 3O21A 4C07A 3P4XA 4H1WA 5C1BA 2B9VA 3NQ41 2B3DA 4KE7A 1E5LA 1RPZA 4DUGA 1J8YF 4LY0A 1GTL1 2QP3A 4I4IA 4KSYA 4LRTB 3UGQA 2GKOA 3MRVA 1Y7HA 2QI9C 3I2FA 3V1TC 1XD2B 3EGXB 3LUAA 4MUFA 1ADFA 4R8SA 3WLMA 2ZW9A 5JCOC 3S81A 1FRVA 1MOPA 3HCNA 3PKJA 1I4EB 3FCOA 3N59A 4GRIA 4I6JA 1OD6A 2FDXA 2ZJ2A 4KIUA 2BFDA 1G66A 1KBOA 2JFFA 2R86A 1VLLA 2HMTA 3BB1A 3CNEA 1W0JA 2E89A 2RGUA 2IQIA 6Q21A 1M6YA 1CUSA 1VIYA 3O74A 1EZ1A 1JFTA 1GIAA 2WHQA 3HDVA 1PR6A 1VSQA 2E1PA 4O4IB 2IS4A 1CE8B 1EESA 4K03A 1UXKA 1F51E 1NQ5A 3LW7A 2RH8A 1P44A 3ZQKA 2WQZA 4LE1A 5I8PA 5DLYA 2C7BA 4DKJA 1U63A 2NMVA 4X60A 1NMXA 1SZPA 3FBGA 3W5VA 3IUJA 3HNOA 6REQB 3LBIA 4RGYA 3UB2A 4OXIA 1CC1S 4G1BA 1H2AS 1V3TA 3CZ9A 3T35A 2GZ1A 2VSNA 2XKJE 2FPLA 3E35A 1I33A 4JI6B 2E4UA 4RSRA 2LIPA 4TKLA 4NONA 4B32A 2WKWA 2ODAA 3QF4A 4DSAA 3WFZA 2B37A 1WVIA 4LQDA 1MQ8B 2ZB4A 3TRHA 4ZAWA 4S35A 2ZI6A 4RKYA 3OI7A 3WGMA 3S7TA 4KLCA 1JIIA 4UHHA 2IXEA 3PUHA 3HR7A 3K9NA 3ZOKA 3WHLA 5F2NA 4OHBA 5AXBA 1ORRA 2I66A 1C1DB 2ISSD 4XDZA 4D6PA 1UKVY 3JVVA 4K2HA 1ZVJA 2IDMA 4E5PA 4ZICA 1V4BA 4A8HA 4E3WA 4YASA 4ZVMA 3KDSE 2HHCA 5L3QB 1ADCA 1J23A 1I5OA 3OTHA 3UAYA 2YYYA 4ZVSA 2WYHA 2RONA 2G67A 2VJKA 2XUGA 1Z56C 2A0FA 7GPBA 2QLBA 3S5UA 1T9BA 3WA7A 2BI8A 2O8BA 4ZOAA 3GH1A 1J1UA 4GMKA 5T6MA 1P1BA 1E62A 1L7BA 2FFJA 3DB2A 3ZVKA 4N39A 1R74A 5EXEA 3U9SA 5M34A 5C81A 4YYZA 2XUHA 3AT1A 2GN2A 5DN6D 2I6UA 1DAOA 2M1XA 2C99A 5CVDA 3E8XA 4XPZA 2HN9A 3UVEA 1Z36A 4P7FA 1G21A 3MEQA 5FOQA 4ZTZB 1DKNA 3L7DA 2XR1A 4F5EA 4LV6A 1U7PA 4U3JB 3R5HA 4AY3A 2XUQA 1XXHE 1KY3A 3L1HA 3QGMA 1M6NA 2AL7A 2Q6VA 3CPHA 4JNCA 4ARSA 2QN7A 2NXJA 5KVVA 2FDCA 5DIFA 4TMKA 3I23A 4RLFA 4C4OA 4JT8A 1PEYA 3UG7A 5CFRA 4QGGA 1CY4A 1X1QA 5AXAA 3TTYA 3VHRA 3I32A 5BW6B 2QGZA 2PUEA 5C5CA 2ZSEA 3CLSD 4HDOB 3V3KA 2B1QA 4CHGA 1Z7WA 2FMTA 3QUSA 4MJLA 5DTJA 3F49S 4G0ZA 4OO3A 1TF2A 2W2OA 2Y77A 2ZSAA 1PTKA 2R9VA 3BS4A 3HY3A 1YQWA 2DT8A 2O3TA 4IUYA 3WWPA 1APBA 1Z2NX 1DAFA 1NJSA 2O2XA 1U0HC 3AVOA 3INYA 3QVVA 1XUOA 4H1TA 5E7JA 5D1NA 3FMVA 1M5UA 2A9JA 1YRLA 2V03A 3CTMA 3Q7QA 3RODA 3U3RA 1I94B 5L3VA 3LA6A 1OAOA 5E2IA 4O02B 2AJLI 3L7NA 3E0XA 2EKBA 2L69A 1YBFA 3IDFA 4D3FA 1Z2OX 4I1IA 1I4DD 1JW9B 1H0HA 4ZVOA 2FPUA 1PUXA 4CV3A 1T1EA 1G2PA 3MJDA 3O47A 4BBPA 3PFKA 4DJTA 5JTTA 4I5EA 4R68A 1M1NA 2ZT8A 3LUJA 3L79A 5F12A 1CF9A 3AOEC 3CJRA 5DWQA 3ZDAA 2OD2A 3BMCB 3U2QA 3FKSD 2X15A 1SH7A 2GJSA 1MD9A 4E30A 4YUXA 1MLDA 4UMVA 4KXQA 3ZTWA 1UBLS 5BVGA 4LJKA 4DJDC 4DBLE 3O8QA 5CDGA 5K0NA 1QE0A 4U00A 1GVHA 4BO2A 1WLSA 4S24A 3DO6A 4A6DA 1CY8A 4DC0A 1TUIA 3KXDA 3NLLA 5B1IA 3KEGA 3JATA 3B6KA 1ENOA 2RGGA 4DL9A 3H2GA 4DPLA 3QKRA 5KZMB 1JBQA 1QAMA 2CMFA 5D00A 3TEMA 3ICEA 1PF7E 5G0SA 4K6OA 1VSVA 2EARA 1WUKS 4O4HF 4XEUA 4TPKA 5FBZA 4BECA 1PK7A 2RGYA 1YJQA 3AVVA 5KC9A 2MSLA 3JALB 4C0SA 4YPVA 4EPXA 3QE4A 3D8RA 2KPOA 4IGIA 3AR9A 2AXQA 1HQYE 4KMSA 4Q12A 5K0CA 2QBYA 4BDSA 4CIVA 2B35A 1T4DA 2R00A 2H92A 2O2HA 4MR9B 3SQMA 1N2CA 4GBJA 4RVOA 5G4KB 5C8YB 4KK4A 3TMYA 2AK3A 3TQFA 2XIJA 5KX5A 1Z4QA 1VXOA 1M7HA 1PV2A 1TPZA 2I62A 4KQ6A 2KQUA 1OVMA 3DMDA 2X9QA 4MRMA 2O20A 4KV7A 5ENZA 3E8MA 1KH2A 3SJAA 1ANKA 3L0PA 4KXMA 4ETNA 5JUWA 3K30A 1O0CA 4EY5A 1QZTA 4DS3A 3GJTA 4KDCA 3PEWA 1U7ZA 5LUBA 2YS6A 4F6RB 4F6CA 2QN2A 1ADYA 2IYWA 5JNWA 3NTOA 1FXWF 1XEXA 2Z1NA 4MXDA 1NPTO 4UUOA 3STXA 2NYUA 4INZA 4H2DA 3LT0A 2EWWA 1IOWA 3LKDA 4TV8B 3TSZA 2B8NA 3UXEA 4X93A 2AJBA 2XAUA 2PVCA 4HXEB 4RVUA 1LLDA 1G6HA 3GI1A 5LQCA 2XYVA 1ZSVA 5DXJA 1K75A 3RVSA 3I04A 5CLIA 4LOLA 1UPFA 2VPTA 1M76A 5DE3A 1QYCA 4TN1A 3PFCA 2RAFA 2ODWA 1SEVA 2VLBA 2RK4A 1BGVA 3QX9A 4CKBB 3ASUA 1I0ZA 1WD7A 4IAOA 4WK4B 5ALTA 4CF4A 1O94C 5F35A 1NBHA 3OM1A 4MQLA 3T1VA 2K7ZA 4L0QA 2XECA 2PQ2A 3EFHA 4IO1A 3OJEA 1JG2A 3DEHA 1E1MA 4ZVUA 3PSHA 4WFQA 5CDYA 5JECA 3CO5A 3SHVA 3U13A 1H65A 4KKVA 3VZBA 4R41A 3OQMA 3OQIB 3W4KA 2BCGY 2HCRA 3U0BA 4FDVA 4RTPA 3IAXA 2FWAA 3AVUA 2C42A 2OBLA 2XJ4A 3N6XA 3OLWA 1T24A 3RAJA 3UCFA 2EVWX 1JHOA 2P8JA 3MWEA 3O8LA 4KZPA 4CMEC 3M6IA 4D9KA 3PGVA 5T6BA 1DEKA 3X3HA 7ABPA 1OA1A 2A3NA 3FNEA 3VRHA 3O84A 1M5RA 3ZJTA 4O1HA 4WY2A 3ZZTA 4CT4B 4FP9A 3K8QA 2QUZA 4EITA 1RMYA 1UIRA 1W5SA 3QPWA 5A9SB 5B4VA 2XUAA 2FUKA 5SYMA 2HJSA 5KYNA 3HKCA 2SCUA 5C3UA 4UCWA 1NOJA 1GQYA 2UZ0A 3F1LA 4O0LA 4OXRA 3Q8MA 2P0EA 2BBSA 4D4GA 3HXMA 3DBHB 1EH5A 4MA0A 1Z7GA 2DF8A 1X80A 2P41A 4MOWA 4LNAA 1H6AA 1Y9EA 4D79A 4Z9FA 3ZX5A 3N05A 4HAIA 4ARZA 4P0TA 4D02A 5F52A 4LBWA 2G1AA 3ZGVA 3ZBUA 2RHJA 1ZH4A 3ZCVA 3RU2A 5JALA 4QLOA 2WFZA 4UUBA 4ZAFA 5JRDS 3MWGA 3TLEA 3KPYA 2GZSA 1MIOB 1CU1A 3T94A 3BMXA 3NWPA 3T1OA 2VUSA 1AKTA 2FY8A 1L7PA 3UJ7A 4RLQA 5TARA 4QKQA 1J4AA 4JI8B 2YZMA 3ABSB 2JLVA 5KCMA 4RYLA 1H2EA 1U0RA 2WFLB 3BK1A 4NCIA 3A6ZA 4POAA 4CV0A 4QJ4A 4LY9A 5FV7A 4I99A 3LNCA 4PG7A 3K9FC 3M83A 3V8QA 3OQJA 4XOUA 2XV1A 4KAJA 4I9UA 2VHQA 3UGTA 2P91A 1RXYA 4F1KA 4KMOA 4ZVKA 1V11A 1DJQA 2R1TA 2RHOA 4PC1A 2QVLA 3M82A 1CDOA 4LCJA 3WZLA 5CA1F 4Y2PA 5ALWA 3BQ9A 3EODA 2YMQA 3OE4A 4ACAA 3NM5A 3PZBA 4PYOA 5LP6A 1CZUA 1LVGA 3OQPA 4G97A 5A3VA 4JYZA 4DOMA 4K9NA 1XV5A 5G0WA 4IIXA 5BN3A 5EIWA 1L7NA 1E2MA 1P7ZA 3W3AD 3K70B 4XB1A 2P2YA 4S2UA 1G291 1GKLA 2AFVA 1SBCA 3GJZA 1H8HA 3RRFA 5C7YA 2C5SA 4DXAA 4BFYA 3QEAZ 4AF7A 3KNZA 1QHXA 3PICA 2BE9A 3I58A 4NCHA 4FSHA 3R7DA 4DA0A 1O6FA 4F4CA 1A7AA 3HWSA 4ARCA 5BPFA 4AJ4A 3E2IA 2ZXUA 1KK1A 2ORED 4FCVA 1WBJB 3L7LA 2PKYX 4B45A 2WWXA 5D6OA 4FYJA 4OYLA 2IH4A 1ODKA 1GAXA 1GADO 2ZIGA 2ZRCA 1C30A 2O5EA 4GI1A 3ISVA 3BE4A 3RJTA 1A69A 4QL3A 1CD5A 5KYYB 4MIOA 3C24A 2Y0EA 4BNMA 3X1XA 4DWJA 3E7DA 2BKUA 3K9QO 3MVEA 4DCOA 3O8RA 1GOTA 3X1MA 1NUUA 3H5IA 1OTYA 2D13A 4B0OA 1A8PA 2E6UX 3WGOA 5KJFA 5CD1A 1QF7A 3R7WA 4LJ9A 1KEZA 3WBFA 2BD0A 2QRHA 4X41A 3Q11A 4OSOA 4ZEXA 4GZ6A 4F4IA 3B1XA 4OVKA 4D8YA 5FR2A 4OF4A 1GCGA 1YI8A 2YWDA 2YWHA 1TECE 3NOVA 2YZGA 5ECDA 2HM7A 2E6KA 3H18A 4GX2A 3KTOA 2XTJA 2GYYA 3A1UA 5GAJA 2C2GA 3TSOA 1HT2E 3FHCB 4LMAA 3V4OA 4BNHA 1VG1A 1UQUA 4H6XA 4O3FA 1XB2A 2J9GA 5DOVA 1RT9A 5JJ5A 1I7NA 4KH0A 2ZJ0A 1IRXA 1DHTA 3VV3A 1LNQA 4L4SA 2IZ6A 5ITSA 2FQWA 4V1CA 5BNIA 1RZRD 5TS2A 1M2EA 2V5AA 1RU3A 5FB3A 3WK6A 3JD1A 1FYVA 1AV7A 1ECPA 4LVUA 1O8BA 5C7IO 1VTKA 1DQSA 2GN9A 3OHPA 3OOJA 1DVRA 1E5QA 5WRFA 5CIYA 1H4SA 4E0BA 3HR8A 5HM6A 2FZCA 3N7AA 5A3JA 2ZU6A 5ICGA 3E9RA 3D6HA 4GE3A 4KRGA 4QUBA 1R64A 1HOTA 4BGIA 2A94A 2J30A 4MWSA 3KR1A 2K4MA 2H5IA 3ST7A 2PS0A 2GSWA 2QNIA 4RS3A 2W37A 4B3BA 1GO2A 1C3OA 3HS3A 3L4BA 4DSNA 1F0PA 2C7VA 2FMIA 2QAIA 5EUMA 1AQIA 2E4WA 2P6MA 1ABEA 3KR2A 4OXXA 3OQBA 5FOUA 3A4MA 4FR5A 2VHJA 3VSCA 2WJZB 5AI9A 3AEUB 3RVPA 5DX0A 4M9CA 4NESA 1FMLA 1WEHA 3F8TA 2Y1WA 3RS0A 3WNBA 3ONNA 2IU0A 4D4HA 2NNLD 5JCPA 2DETA 2CE7A 3IB3A 1OW3B 2XVAA 3G79A 3PHLA 2XTMA 4IXMA 1FVXA 1SG6A 1Z7BA 3A32A 3ONFA 3WL5A 4JJFA 3JZIA 4PLTA 4TZTA 3A2MA 3T0GA 3ZGOA 5AVZA 3K1YA 1LPAB 5JV5A 4P33A 1IN7A 4RZHA 3DHEA 3ENNA 4UHKA 2FUCA 2WIBA 2WOJA 4KQHA 4NU5A 1KFCB 4WBSA 3THYB 3HRHA 2HNAA 3GLHB 2GS9A 3MLBA 2M6SA 4UHEA 4LEIA 2XCIA 2GCPA 4IDHA 4DUGD 2BDEA 1G20A 1QV9A 2Y1XA 2I3BA 3PJRA 1H1TA 1OYYA 4NV0A 2GB4A 3PI6A 4RHTA 3AUYA 1QC5B 4BNDA 3TECE 1FFXB 1XD9A 1UT8A 2HHAA 3NKVA 5EIXA 4R9VA 2H5EA 3K4QA 1ZMBA 1C80A 4Q4CA 4XDHA 2WVJA 5DHAA 3GRFA 2HL6A 4RKQA 2YOGA 2X5OA 5DULA 5TDHA 1T1IA 4EI8A 1W0JD 4MYRA 4GRAA 3FNIA 3ZD6A 1KYIA 4LTDA 4FHFA 4PZ0A 2HZBA 4RIGA 5COQA 5IANA 1U3FA 2XZPA 4LQ4A 5KVCA 3L04A 3NTUA 3SXPA 4WLEA 1KAQA 5CU7A 3MWYW 3G3EA 5IVHA 5IULC 3L7IA 2QVCA 1SM4A 1UK8A 3DZFA 3DDNA 2IS1A 4KKXB 5E9WA 2BF7A 1USVA 3CLTD 5B6JA 5JXJA 1PJBA 2ZBVA 3A6KA 1N8NA 3FDZB 2C4TA 1FDUA 1NJ2A 3SS8A 3MGCA 1Q12A 2M2IA 1VYUA 4RV5A 1JSCA 5CIQA 5JS1A 3JWJA 5HX7A 1K06A 5JRJA 1W25A 2YN0A 1W87A 3OIVA 4F04A 1P61B 2ZI7A 1NFFA 1QIKA 2Y92A 1E1CB 4N7BA 1QVAA 1ZVMA 3LW8A 3TUIC 2AG8A 1CYDA 2HIGA 3QOXA 4PFKA 4BVHA 4QUKA 4JA0A 4RETA 3O94A 3JQ8A 3HCEA 1L7AA 2C0CA 2J6IA 3PWSA 4UBIA 4IGKA 3EIXA 4FOPA 1N2BA 4BLSA 4REQB 5HZKA 1KF0A 2AUMA 3CVVA 3A3PA 2YUIA 3I6QA 3FYUA 4FEEA 4MDHA 1RI1A 3U7FB 4XM2A 1VIDA 4M86A 3CWCA 3NC0C 5HSGA 1ISRA 4P9NA 3PGA1 4D25A 3U17A 4DADA 4GO1A 3O7MA 5LN1A 4RHEA 3MT9A 2R00C 3RW9A 2Q9UA 3GFFA 4UVIA 5ELLA 1JZSA 5AVQA 1CETA 1KYYA 4RTMA 1ZH8A 3LI2A 5EMMA 2AFIA 2HCBA 3CUTA 5JJCA 1OH6A 4BRZA 3U1VA 1FTGA 3HL4A 3BXOA 3H8JA 3NHSA 1SXPA 2FSVA 5TE9A 4A2QA 1O87A 3TTSA 4F4FA 2HI0A 3DEYX 3EF1A 3R4CA 1J7KA 1GU7A 1AMUA 5IZCA 1N5KA 4RDHA 1HL7A 2JG3A 1UEIA 3VZSA 2AFHB 1CJTC 2J48A 2QX6A 5ER6A 1YBAA 2CVZA 1YS7A 1YHYA 2HPZA 1MHTA 1MHPA 3ZWMA 3O2JA 4YB8A 3UQZA 1UBJS 4RPKA 4K9SA 3TLJA 3UCXA 1MP0A 3EXEB 4YQEA 2RD2A 3LGXA 1XQVA 3UK1A 2AJ8A 4WN9B 1GSOA 2FZEA 1ODCA 4XH9B 1ZH2A 1MDBA 1LBHA 2Z08A 4K26A 2BFPA 3CKYA 3ACBA 5IH3A 4FE3A 4B73A 5L7WA 5BYBA 1QFYA 1L1EA 4NYIQ 1ZCJA 2A5YB 3AETA 3GMDA 1SEPA 3VR6D 4R2WA 3GZJA 4BIMA 2OWEA 5GJVC 1AQYA 2CFSA 2LKDA 2GAJA 3OJOA 3FRHA 3AUFA 3RSQA 1T2EA 1ZXLA 2J9RA 3RS3A 3TW8B 5DM60 4JSRA 5I6DA 5CX1B 4HLNA 1CUJA 1JAXA 4ON9A 2BSQA 2IZ5A 1NOIA 1MT3A 2Q5EA 1HE5A 1HZZC 2Z04A 4QICA 3VUFA 1SOUA 1L6IA 3DLCA 1LPPA 2GVZC 3D7KA 4W4TA 5THKA 3JQRA 1Q0SA 1RLJA 4C0QC 1OLXB 2WUVA 2BW0A 3PLNA 3V7YA 4IBOA 4ILEA 4K9MA 4PFSA 1K66A 2QE7D 3HUDA 5CFMA 2OCPA 3KB6A 4FJ2A 3W34A 4Z1OA 4O5OA 1YC5A 2DHQA 2EJTA 3AF4A 2XEDA 5EE0A 3UENA 4J0FA 3TKLA 3OX2A 2WV7A 3HU2A 3KPUA 1AO3A 4K5QA 2UYQA 3PUYA 3SSAA 5ALYA 4ND2A 3WRWA 1CBUA 3D9QX 3DC7A 2XTNA 3RWMB 5AI8A 3QX7A 1T1JA 1YBMA 2QZZA 2FZ4A 4M49A 5IKXA 1SKMA 1ZBQA 1G5TA 1J24A 4OREX 3D5TA 1YI1A 5KQRA 1BC5A 1TA9A 2ZIFA 2QNBA 3HJAA 5KNBA 3AUJB 4ZALA 3PNOA 4WXPA 3GDWA 3REQB 4WKGA 1KJ8A 4OX9B 2QG4A 3QNMA 2QWXA 3FRJA 4JCOA 3BGVA 1WXQA 4N7MA 3L84A 3RTGA 3CSSA 3NI2A 4NARA 4PNPA 1C1XA 3MOIA 5TJ9A 4AKIA 3COZA 5LLSA 2Q6IA 4I9FA 4IOLA 4ZOCA 5IAKA 1L5KA 3AYZB 2AI1A 2NXEA 1MX5A 2LXNA 3H4VA 4DVJA 3NDIA 3UJDA 4HXFB 3RHSA 1H3FA 3SU8A 2OC9A 2WU4A 5DBGA 3FM9A 3L82B 3SQWA 4KNYA 3W9BA 1AQLA 3MWDA 4Q9NA 3W05A 1WVMA 1V5GA 2JRCA 2PT7A 2YQ5A 5BV7A 4FONA 1RWMA 3BUSA 4L75A 4M9XA 4WEQA 2AHOA 5ALUA 2JLWA 5B64A 2ZYHA 2I0FA 2EV9A 2AR7A 1WJGA 2HK6A 3MMZA 3J81k 2Y76A 5B3KA 3QEMA 3A6GA 1CRLA 1HL3A 3COWA 4LXUA 3VKWA