3B6FD

Nucleosome core particle treated with cisplatin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
101
structure length
101
Chain Sequence
DGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 147-MER DNA
publication title Site selectivity of platinum anticancer therapeutics
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 30
structure length 101
sequence length 101
chains with identical sequence H
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3b6fD00
3WKJA 3O62D 5GSUB 3X1UB 3AFAA 2IO5C 5AVCB 3AZKC 5GT3C 1P3AB 3X1TC 3AV1C 2PYOA 3KXBA 2FJ7A 4Z66C 5B31A 3A6NC 5B32B 5B32G 3R45A 3AZND 3MNND 5GSUC 2F8NH 1P34D 5AVCC 5CPID 1P3AC 2YFWA 3VH6T 1P3BB 1HQ3D 3B6FD 1BH9B 5B32C 5B0ZA 3W97A 5AV5D 3W99A 5E5AD 1P3BC 4WU9A 1KX4B 1AOIB 1P3IA 5GXQD 1H3OB 5B2JA 3MGQD 1AOIA 5DNNB 2HIOD 3MVDD 3WTPD 5B2ID 3UT9B 4YM6D 4J8WA 1KX4C 3AZHB 4X23A 5BO0B 5CPJA 5DNNC 1P3FB 3UT9C 4Z5TB 5B33B 5BT1D 4HGAB 2CV5B 1ID3A 3UTAD 2YFVB 1HTAA 1P3PA 3AV2A 5BS7A 4Z5TA 4CSRB 1P3FC 4UUZA 1WWSA 3C1CD 3LELA 3B0CT 5B33C 4HGAC 3AZMB 4ZUXB 4CSRA 3MGPA 5B40B 3REJA 5F99B 5B0YA 3C1BD 3AZIA 3AZMC 3WAAD 4ZUXC 3AYWD 2BYMA 4KGCD 1U35B 4J8VD 4R8PD 4ZBJB 5B40C 5F99C 5BNVB 5CHLB 3V9RB 5JA4B 5BNXA 1U35C 4XUJB 1M18B 3AZKD 4ZBJC 1TZYB 5GT3D 3X1TD 1BH8A 4H9RA 4J8XB 3W96B 4Z66D 3X1SA 5AV9A 3A6ND 3AN2B 1N1JB 4XUJA 5AV6B 5GSUD 5CP6B 3X1UD 3MGRB 5AVCD 1M18C 1JFIA 1TZYC 4XZQB 1P3AD 3KUYC 3AZJB 2AROB 4J8XC 3W96C 3LZ1A 3AN2C 2NZDB 5B32D 5AV6C 5B1MA 3MGSA 5AV5C 5AVBA 1P3BD 4XZQC 2AROC 3NQUA 4NFTA 1TAFA 1S32A 1ZLAB 2NZDC 3MGQC 5DNMA 1KX3B 1EQZC 1KX4D 1P3OC 5GT0A 4H9NB 1ZLAC 4KUDA 2NQBA 5DNND 3AZEB 3UT9D 3WA9C 4KHAA 3AZHD 2F8NB 3B6GB 1P3KB 3B0DB 3KWQB 1P3FD 5B33D 3TU4A 4Z2MG 1M19A 1P3GB 1P3KC 5B24B 4J8UA 3X1VA 4NE6A 4H9PB 3AZMD 4ZUXD 5AV8B 5G49B 5B40D 1P3GC 4WU8B 4R8PC 5F99D 5JRGA 5CPKA 3WKJB 1KX5A 3AFAB 5B1LA 4QLCA 3C1CA 2PYOB 3KXBB 2FJ7B 5AV8C 5B31B 1U35D 3WTPE 5AY8C 3R45B 4WU8C 3WKJC 2JSSA 3AZGA 1WWIA 2YFWB 2FJ7C 3UTBA 5B31C 3X1UC 1M18D 1TZYD 5B0ZB 3KUYD 4J8XD 3W97B 3W96D 3W99B 3AN2D 3REKA 5AV6D 4WU9B 1P3IB 4XZQD 5B2JB 2AROD 3W97C 3W99C 3AV1A 2NZDD 4WU9C 4J8WB 1P3IC 4X23B 3W98A 1EQZD 1P3MA 5B2JC 5CPJB 1P3OD 1AOIC 4M6BA 4H9QA 1ZLAD 4AWLB 1ID3B 4J8WC 1P3PB 3WA9D 4CAYA 1KX3D 1BFMA 3LJAB 3AV2B 5CPJC 4WNNA 3REIA 3AZHC 4UUZB 3LELB 4AWLC 3LJAA 1ID3C 3VH6A 3AZED 3MGPB 1P3PC 1M1AB 3AV2C 5BS7C 4Z5TC 3REJB 2CV5C 2F8ND 3B6GD 5B0YB 3AZIB 1P3KD 1M1AA 3VH5W 2BYMB 3MGPC 3REJC 5B0YC 1P3GD 2F8NK 5B24D 3AZFA 1ULYA 5BNXB 4EO5B 1BH8B 4H9RB 5AV8D 3X1SB 5AV9B 4JJNA 3REHA 4YS3A 5C3IB 5AY8D 4WU8D 3WKJD 3RELA 1JFIB 4LD9A 3AZLA 1P3LA 2FJ7D 5B31D 5AV9C 3LZ0B 3LZ1B 3X1SC 2LY8A 5C3IC 1F66A 4XUJC 5B1MB 3MGSB 3NQJA 3LZ0A 5AVBB 3NQUB 5CP6C 1TAFB 3MGRC 1S32B 3O62A 5B1MC 3MGSC 3W97D 3W99D 3AZJC 5DNMB 5AVBC 4WU9D 1P3ID 5GT0B 1S32C 4KUDB 3AZNA 3MNNA 2NQBB 5B2JD 1P34A 1AOID 5CPIA 5DNMC 4KHAB 4J8WD 1HQ3A 4H9OB 3B6FA 5GT0C 4KUDC 4X23D 5AV5A 1KX3C 5CPJD 2NQBC 4H9SA 5E5AA 4H9OA 2F8NG 3TU4B 1ID3D 5GXQA 3AZEC 1P3PD 3MGQA 1M19B 3AV2D 4Z5TD 2HIOA 3MVDA 3WTPA 5FUGA 5B2IA 2CV5D 4YM6A 3B6GC 4J8UB 1P3OA 3X1VB 3TU4C 3B0DC 3KWQC 3MGPD 1M19C 3REJD 5CPKB 5JRGB 3WA9A 5B0YD 4J8UC 1KX5B 3X1VC 3AZID 3UTAA 5B1LB 4QLCB 5B24C 3C1CB 1Q9CA 5CPKC 5JRGC 5KDMA 1KX5C 5B31G 3AZGB 5B1LC 4QLCC 2BYKA 3UTBB 3AFAC 4E45A 4WZSB 3C1BA 3X1SD 5AV9D 2PYOC 3KXBC 3REKB 3WAAA 4XUJD 3AZGC 3AYWA 4KGCA 4J8VA 4R8PA 3UTBC 3LZ1D 5CP6D 3B0CW 3MGRD 3REKC 3AV1B 5B1MD 3A6NB 3MGSD 5B0ZC 5AY8A 3AZJD 3AZKA 5GT3A 3X1TA 5AVBD 3W98B 1B6WA 4Z66A 1P3MB 3A6NA 1S32D 4H9QB 5GSUA 3X1UA 5AVCA 5DNMD 1P3AA 4CAYB 3W98C 1P3MC 4WNNB 5B32A 5GT0D 3REIB 4KUDD 2NQBD 4X23C 1P3BA 3KSYA 4Z2MH 1BH9A 1R4VA 3REIC 4DRAA 3LJAC 4NE5A 1KX4A 3TU4D 3LELC 3KWQD 1H3OA 1M19D 5DNNA 1M1AC 3UT9A 3AZFB 4J8UD 3X1VD 3AZHA 3AZIC 4YS3B 4JJNB 5BO0A 3REHB 4G92B 1P3FA 5CPKD 5JRGD 3AZFC 3RELB 5B33A 2CV5A 1KX5D 2CWEA 2YFVA 5B1LD 3AZLB 4LD9B 4QLCD 1P3LB 1F1EA 4YS3C 4WV4B 4JJNC 3REHC 1F66B 3AFAD 4G92C 2L5AA 2RVQC 4EO5C 3B0BA 3RELC 2PYOD 3KXBD 3NQJB 3AZMA 4ZUXA 3AZGD 4LD9C 3AZLC 1P3LC 3UTBD 5B40A 5F99A 1F66C 3O62B 3REKD 3LZ0C 3LZ1C 5B0ZD 1U35A 1KU5A 1B67A 5BNVA 3AZNB 3MNNB 3O62C 3V9RA 1P34B 3AV1D 3KUYB 5CPIB 5JA4A 1HQ3B 1M18A 3B6FB 1A7WA 1TZYA 3KUYA 4J8XA 5AV5B 3W96A 3MNNC 3AZNC 1P3MD 3W98D 3AN2A 1P34C 1N1JA 5E5AB 5AV6A 5CPIC 5CP6A 3MGRA 3VH5T 5GXQB 1HQ3C 3B6FC 4XZQA 3MGQB 3AZJA 2AROA 3MVDB 2HIOB 3WTPB 5FUGB 5B2IB 4G91B 2NZDA 4H9SC 5E5AC 4YM6B 3REID 1EQZB 1P3OB 3LJAD 5GXQC 1EQZA 3VH6W 3MVDC 2HIOC 3LELD 3WTPC 1ZLAA 5B2IC 4G91C 3WA9B 4YM6C 3UTAB 1M1AD 1KX3A 2HUEB 4H9NA 5BT1C 5KDMB 3AZEA 3UTAC 3AZFD 2BYKB 2HUEC 4DRBA 2F8NA 3B6GA 3VH5A 3C1BB 4YS3D 4JJND 3C1CC 3REHD 1P3KA 3KWQA 4NE3A 3WAAB 2RVQD 3AYWB 4KGCB 3RELD 4J8VB 4R8PB 4LD9D 3AZLD 1P3LD 3C1BC 1P3GA 5B24A 1F66D 3WAAC 4E44A 3AYWC 4KGCC 2IO5B 5AY8B 4J8VC 4H9PA 3AZKB 5GT3B 3LZ0D 3X1TB 4Z66B 5G49A 5AV8A 4WU8A
chains in the Genus database with same CATH superfamily
3WKJA 3O62D 5GSUB 3X1UB 3AFAA 2IO5C 5AVCB 3AZKC 5GT3C 1P3AB 3X1TC 3AV1C 2PYOA 3KXBA 2FJ7A 2Y2GA 5B31A 4Z66C 3A6NC 5B32B 5B32G 3R45A 3AZND 3MNND 5GSUC 2F8NH 1P34D 3EPJA 5AVCC 5CPID 1P3AC 2YFWA 3VH6T 1P3BB 1HQ3D 2F2AC 3B6FD 1BH9B 5B32C 5B0ZA 3W97A 5AV5D 3W99A 3KFUG 5E5AD 1P3BC 4WU9A 1KX4B 1AOIB 1P3IA 5GXQD 1H3OB 5B2JA 2JCHA 3MGQD 1AOIA 5DNNB 2HIOD 2Y2KA 3MVDD 3WTPD 5B2ID 3UT9B 4YM6D 4J8WA 1KX4C 3AZHB 2Y2PA 4X23A 5BO0B 5CPJA 5DNNC 1P3FB 3UT9C 4Z5TB 5B33B 5BT1D 3H0LC 4HGAB 2CV5B 3UTAD 1ID3A 2YFVB 1HTAA 3EPHA 1P3PA 3AV2A 5BS7A 4Z5TA 4CSRB 1P3FC 4UUZA 1WWSA 3C1CD 3LELA 3B0CT 5B33C 4HGAC 3AZMB 4ZUXB 4CSRA 3MGPA 5B40B 3REJA 5F99B 5B0YA 3C1BD 3AZIA 3AZMC 3WAAD 4ZUXC 3AYWD 2BYMA 4KGCD 1U35B 4J8VD 4R8PD 4ZBJB 5B40C 5F99C 5BNVB 5CHLB 3V9RB 5JA4B 5BNXA 1U35C 4XUJB 1M18B 3AZKD 4ZBJC 1TZYB 5GT3D 3X1TD 1BH8A 4H9RA 4J8XB 3W96B 4Z66D 3X1SA 5AV9A 3A6ND 3AN2B 1N1JB 4XUJA 5AV6B 3A1IA 5GSUD 5CP6B 3X1UD 3MGRB 5AVCD 1M18C 1JFIA 1TZYC 4XZQB 1P3AD 3KUYC 3AZJB 2AROB 4J8XC 3W96C 3LZ1A 3AN2C 2NZDB 3EPKA 5B32D 5AV6C 5B1MA 3MGSA 5AV5C 2ZY2A 5AVBA 1P3BD 4XZQC 2AROC 3NQUA 4NFTA 1TAFA 1S32A 1ZLAB 2NZDC 3MGQC 5DNMA 1KX3B 1EQZC 1KX4D 1P3OC 5GT0A 4H9NB 1ZLAC 4KUDA 2NQBA 5DNND 3AZEB 3UT9D 3A1KA 3WA9C 4KHAA 3AZHD 2F8NB 3B6GB 1P3KB 3B0DB 2Y2QA 3KWQB 1P3FD 5B33D 3TU4A 4Z2MG 1M19A 1P3GB 1P3KC 5B24B 2DF4C 4J8UA 3X1VA 4NE6A 4H9PB 3AZMD 4ZUXD 5AV8B 5G49B 5B40D 1P3GC 4WU8B 4R8PC 5F99D 5JRGA 5CPKA 3WKJB 1KX5A 3AFAB 5B1LA 4QLCA 1Z2CB 3C1CA 3KXBB 2FJ7B 5AV8C 5B31B 1U35D 2PYOB 3WTPE 5AY8C 3R45B 4WU8C 3WKJC 2JSSA 3AZGA 1WWIA 2YFWB 2FJ7C 3UTBA 5B31C 3X1UC 1M18D 1TZYD 2G5HC 5B0ZB 3KUYD 4J8XD 3W97B 3W96D 3W99B 3AN2D 3REKA 5AV6D 4WU9B 1P3IB 4XZQD 5B2JB 2AROD 3W97C 3W99C 3AV1A 2NZDD 4WU9C 4J8WB 1P3IC 2Y2MA 4X23B 3W98A 1EQZD 1P3MA 5B2JC 5CPJB 1P3OD 1AOIC 4M6BA 4H9QA 1ZLAD 4AWLB 1ID3B 4J8WC 1P3PB 2ZY4A 4CAYA 1KX3D 3WA9D 1BFMA 3LJAB 3AV2B 2Y2LA 5CPJC 4WNNA 3REIA 3AZHC 1T3UA 4UUZB 3LELB 4AWLC 3LJAA 1ID3C 3VH6A 3AZED 3P5JB 3MGPB 1P3PC 1M1AB 3AV2C 5BS7C 4Z5TC 3REJB 2CV5C 2F8ND 3B6GD 5B0YB 3AZIB 1P3KD 3AL0C 1M1AA 3VH5W 2BYMB 3MGPC 3REJC 2G5IC 5B0YC 1P3GD 2F8NK 5B24D 3AZFA 1ULYA 2ZY5A 2XD5A 5BNXB 4EO5B 1BH8B 4H9RB 5AV8D 3X1SB 5AV9B 4JJNA 3REHA 4YS3A 5C3IB 5AY8D 4WU8D 4UPKA 3WKJD 3RELA 1JFIB 4LD9A 3AZLA 2JE5A 1P3LA 2FJ7D 5B31D 5AV9C 3LZ0B 3LZ1B 3X1SC 2LY8A 5C3IC 1F66A 4XUJC 5B1MB 3MGSB 3NQJA 3LZ0A 2ZM5A 5AVBB 3NQUB 5CP6C 1TAFB 3MGRC 1S32B 3O62A 5B1MC 3MGSC 3W97D 3W99D 3AZJC 5DNMB 5AVBC 4WU9D 1P3ID 5GT0B 1S32C 4KUDB 3AZNA 3MNNA 2NQBB 5B2JD 1P34A 1AOID 5CPIA 5DNMC 4KHAB 4J8WD 1HQ3A 3IP4C 4H9OB 3B6FA 5GT0C 4KUDC 4X23D 5AV5A 1KX3C 5CPJD 2NQBC 4H9SA 5E5AA 4H9OA 2F8NG 3TU4B 1ID3D 5GXQA 3AZEC 1P3PD 3MGQA 1M19B 3AV2D 4Z5TD 2HIOA 3MVDA 3WTPA 5FUGA 5B2IA 2CV5D 4YM6A 3B6GC 4J8UB 1P3OA 3X1VB 3TU4C 3F6TA 3B0DC 3KWQC 3MGPD 1M19C 3REJD 5CPKB 5JRGB 3WA9A 5B0YD 4J8UC 1KX5B 3X1VC 3AZID 3UTAA 5B1LB 4QLCB 5B24C 3C1CB 1Q9CA 5CPKC 5JRGC 5KDMA 1KX5C 5B31G 3AZGB 5B1LC 4QLCC 2BYKA 3UTBB 3AFAC 4E45A 4WZSB 3C1BA 3X1SD 5AV9D 2PYOC 3KXBC 3REKB 3WAAA 4XUJD 3AZGC 3AYWA 4KGCA 4J8VA 4R8PA 3UTBC 3LZ1D 5CP6D 3B0CW 3MGRD 3REKC 3AV1B 5B1MD 3A6NB 3MGSD 5B0ZC 5AY8A 3AZJD 3AZKA 5GT3A 3X1TA 2VQRA 5AVBD 3W98B 1B6WA 4Z66A 1P3MB 3A6NA 1S32D 4H9QB 3EG5B 5GSUA 3X1UA 5AVCA 5DNMD 1P3AA 4CAYB 3W98C 1P3MC 4WNNB 5B32A 5GT0D 3REIB 4KUDD 2NQBD 4X23C 1P3BA 3KSYA 4Z2MH 1BH9A 1R4VA 3REIC 4DRAA 3LJAC 3EPLA 4NE5A 1KX4A 2Y2IA 3TU4D 4WJ3C 2Y2JA 3LELC 3KWQD 1H3OA 2BG1A 1M19D 5DNNA 1M1AC 3UT9A 3AZFB 4J8UD 3X1VD 3AZHA 3AZIC 4YS3B 4JJNB 5BO0A 3REHB 2J8PA 4G92B 1P3FA 5CPKD 5JRGD 2RIQA 3AZFC 3RELB 5B33A 2CV5A 1KX5D 2CWEA 2YFVA 5B1LD 3AZLB 4LD9B 2UWXA 4QLCD 1P3LB 1F1EA 4YS3C 4WV4B 4JJNC 3REHC 1F66B 3AFAD 4G92C 2L5AA 2RVQC 4EO5C 3B0BA 3RELC 2PYOD 3KXBD 3NQJB 3AZMA 4ZUXA 3AZGD 4LD9C 3AZLC 1P3LC 3UTBD 5B40A 5F99A 1F66C 3O62B 3REKD 3LZ0C 3LZ1C 1PZRA 4DQYB 5B0ZD 1U35A 1KU5A 1B67A 5BNVA 3AZNB 3MNNB 3O62C 3V9RA 1P34B 2FFFB 3H0RC 3KUYB 3AV1D 5CPIB 5JA4A 1HQ3B 1M18A 3B6FB 1A7WA 1TZYA 3KUYA 4J8XA 5AV5B 3W96A 3MNNC 3AZNC 1P3MD 3W98D 3AN2A 1P34C 1N1JA 5E5AB 5AV6A 5CPIC 5CP6A 3MGRA 3VH5T 5GXQB 1HQ3C 3B6FC 2Y2NA 4XZQA 3MGQB 3AZJA 2AROA 3MVDB 2HIOB 3WTPB 5FUGB 5B2IB 4G91B 2NZDA 4H9SC 5E5AC 4YM6B 3REID 1EQZB 1P3OB 3LJAD 5GXQC 2Y2HA 1W2EA 1EQZA 3VH6W 3MVDC 2HIOC 3LELD 3WTPC 1ZLAA 5B2IC 4G91C 3WA9B 4YM6C 3UTAB 2XD1A 1M1AD 2DQNC 1KX3A 2HUEB 4H9NA 3FDDA 5BT1C 5KDMB 3AZEA 3UTAC 2W8SA 3AZFD 2BYKB 2HUEC 4DRBA 2F8NA 3B6GA 3VH5A 3H0MC 3C1BB 4YS3D 4JJND 3C1CC 3REHD 1P3KA 3KWQA 4NE3A 3WAAB 2RVQD 3AYWB 2Y2OA 4KGCB 3RELD 4J8VB 4R8PB 2ZY3A 4LD9D 3AZLD 1P3LD 3C1BC 1P3GA 5B24A 1F66D 3WAAC 4E44A 3AYWC 4KGCC 2IO5B 5AY8B 4J8VC 4H9PA 3AZKB 5GT3B 3LZ0D 3X1TB 4Z66B 5G49A 5AV8A 4WU8A
chains in the Genus database with same CATH topology
3WKJA 3O62D 5GSUB 3X1UB 3AFAA 2IO5C 5AVCB 3AZKC 5GT3C 1P3AB 3X1TC 3AV1C 2PYOA 3KXBA 2FJ7A 2Y2GA 5B31A 4Z66C 3A6NC 5B32B 5B32G 3R45A 3AZND 3MNND 5GSUC 2F8NH 1P34D 3EPJA 5AVCC 5CPID 1P3AC 2YFWA 3VH6T 1P3BB 1HQ3D 2F2AC 3B6FD 1BH9B 5B32C 5B0ZA 3W97A 5AV5D 3W99A 3KFUG 5E5AD 1P3BC 4WU9A 1KX4B 1AOIB 1P3IA 5GXQD 1H3OB 5B2JA 2JCHA 3MGQD 1AOIA 5DNNB 2HIOD 2Y2KA 3MVDD 3WTPD 5B2ID 3UT9B 4YM6D 4J8WA 1KX4C 3AZHB 2Y2PA 4X23A 5BO0B 5CPJA 5DNNC 1P3FB 3UT9C 4Z5TB 5B33B 5BT1D 3H0LC 4HGAB 2CV5B 3UTAD 1ID3A 2YFVB 1HTAA 3EPHA 1P3PA 3AV2A 5BS7A 4Z5TA 4CSRB 1P3FC 4UUZA 1WWSA 3C1CD 3LELA 3B0CT 5B33C 4HGAC 3AZMB 4ZUXB 4CSRA 3MGPA 5B40B 3REJA 5F99B 5B0YA 3C1BD 3AZIA 3AZMC 3WAAD 4ZUXC 3AYWD 2BYMA 4KGCD 1U35B 4J8VD 4R8PD 4ZBJB 5B40C 5F99C 5BNVB 5CHLB 3V9RB 5JA4B 5BNXA 1U35C 4XUJB 1M18B 3AZKD 4ZBJC 1TZYB 5GT3D 3X1TD 1BH8A 4H9RA 4J8XB 3W96B 4Z66D 3X1SA 5AV9A 3A6ND 3AN2B 1N1JB 4XUJA 5AV6B 3A1IA 5GSUD 5CP6B 3X1UD 3MGRB 5AVCD 1M18C 1JFIA 1TZYC 4XZQB 1P3AD 3KUYC 3AZJB 2AROB 4J8XC 3W96C 3LZ1A 3AN2C 2NZDB 3EPKA 5B32D 5AV6C 5B1MA 3MGSA 5AV5C 2ZY2A 5AVBA 1P3BD 4XZQC 2AROC 3NQUA 4NFTA 1TAFA 1S32A 1ZLAB 2NZDC 3MGQC 5DNMA 1KX3B 1EQZC 1KX4D 1P3OC 5GT0A 4H9NB 1ZLAC 4KUDA 2NQBA 5DNND 3AZEB 3UT9D 3A1KA 3WA9C 4KHAA 3AZHD 2F8NB 3B6GB 1P3KB 3B0DB 2Y2QA 3KWQB 1P3FD 5B33D 3TU4A 4Z2MG 1M19A 1P3GB 1P3KC 5B24B 2DF4C 4J8UA 3X1VA 4NE6A 4H9PB 3AZMD 4ZUXD 5AV8B 5G49B 5B40D 1P3GC 4WU8B 4R8PC 5F99D 5JRGA 5CPKA 3WKJB 1KX5A 3AFAB 5B1LA 4QLCA 1Z2CB 3C1CA 3KXBB 2FJ7B 5AV8C 5B31B 1U35D 2PYOB 3WTPE 5AY8C 3R45B 4WU8C 3WKJC 2JSSA 3AZGA 1WWIA 2YFWB 2FJ7C 3UTBA 5B31C 3X1UC 1M18D 1TZYD 2G5HC 5B0ZB 3KUYD 4J8XD 3W97B 3W96D 3W99B 3AN2D 3REKA 5AV6D 4WU9B 1P3IB 4XZQD 5B2JB 2AROD 3W97C 3W99C 3AV1A 2NZDD 4WU9C 4J8WB 1P3IC 2Y2MA 4X23B 3W98A 1EQZD 1P3MA 5B2JC 5CPJB 1P3OD 1AOIC 4M6BA 4H9QA 1ZLAD 4AWLB 1ID3B 4J8WC 1P3PB 2ZY4A 4CAYA 1KX3D 3WA9D 1BFMA 3LJAB 3AV2B 2Y2LA 5CPJC 4WNNA 3REIA 3AZHC 1T3UA 4UUZB 3LELB 4AWLC 3LJAA 1ID3C 3VH6A 3AZED 3P5JB 3MGPB 1P3PC 1M1AB 3AV2C 5BS7C 4Z5TC 3REJB 2CV5C 2F8ND 3B6GD 5B0YB 3AZIB 1P3KD 3AL0C 1M1AA 3VH5W 2BYMB 3MGPC 3REJC 2G5IC 5B0YC 1P3GD 2F8NK 5B24D 3AZFA 1ULYA 2ZY5A 2XD5A 5BNXB 4EO5B 1BH8B 4H9RB 5AV8D 3X1SB 5AV9B 4JJNA 3REHA 4YS3A 5C3IB 5AY8D 4WU8D 4UPKA 3WKJD 3RELA 1JFIB 4LD9A 3AZLA 2JE5A 1P3LA 2FJ7D 5B31D 5AV9C 3LZ0B 3LZ1B 3X1SC 2LY8A 5C3IC 1F66A 4XUJC 5B1MB 3MGSB 3NQJA 3LZ0A 2ZM5A 5AVBB 3NQUB 5CP6C 1TAFB 3MGRC 1S32B 3O62A 5B1MC 3MGSC 3W97D 3W99D 3AZJC 5DNMB 5AVBC 4WU9D 1P3ID 5GT0B 1S32C 4KUDB 3AZNA 3MNNA 2NQBB 5B2JD 1P34A 1AOID 5CPIA 5DNMC 4KHAB 4J8WD 1HQ3A 3IP4C 4H9OB 3B6FA 5GT0C 4KUDC 4X23D 5AV5A 1KX3C 5CPJD 2NQBC 4H9SA 5E5AA 4H9OA 2F8NG 3TU4B 1ID3D 5GXQA 3AZEC 1P3PD 3MGQA 1M19B 3AV2D 4Z5TD 2HIOA 3MVDA 3WTPA 5FUGA 5B2IA 2CV5D 4YM6A 3B6GC 4J8UB 1P3OA 3X1VB 3TU4C 3F6TA 3B0DC 3KWQC 3MGPD 1M19C 3REJD 5CPKB 5JRGB 3WA9A 5B0YD 4J8UC 1KX5B 3X1VC 3AZID 3UTAA 5B1LB 4QLCB 5B24C 3C1CB 1Q9CA 5CPKC 5JRGC 5KDMA 1KX5C 5B31G 3AZGB 5B1LC 4QLCC 2BYKA 3UTBB 3AFAC 4E45A 4WZSB 3C1BA 3X1SD 5AV9D 2PYOC 3KXBC 3REKB 3WAAA 4XUJD 3AZGC 3AYWA 4KGCA 4J8VA 4R8PA 3UTBC 3LZ1D 5CP6D 3B0CW 3MGRD 3REKC 3AV1B 5B1MD 3A6NB 3MGSD 5B0ZC 5AY8A 3AZJD 3AZKA 5GT3A 3X1TA 2VQRA 5AVBD 3W98B 1B6WA 4Z66A 1P3MB 3A6NA 1S32D 4H9QB 3EG5B 5GSUA 3X1UA 5AVCA 5DNMD 1P3AA 4CAYB 3W98C 1P3MC 4WNNB 5B32A 5GT0D 3REIB 4KUDD 2NQBD 4X23C 1P3BA 3KSYA 4Z2MH 1BH9A 1R4VA 3REIC 4DRAA 3LJAC 3EPLA 4NE5A 1KX4A 2Y2IA 3TU4D 4WJ3C 2Y2JA 3LELC 3KWQD 1H3OA 2BG1A 1M19D 5DNNA 1M1AC 3UT9A 3AZFB 4J8UD 3X1VD 3AZHA 3AZIC 4YS3B 4JJNB 5BO0A 3REHB 2J8PA 4G92B 1P3FA 5CPKD 5JRGD 2RIQA 3AZFC 3RELB 5B33A 2CV5A 1KX5D 2CWEA 2YFVA 5B1LD 3AZLB 4LD9B 2UWXA 4QLCD 1P3LB 1F1EA 4YS3C 4WV4B 4JJNC 3REHC 1F66B 3AFAD 4G92C 2L5AA 2RVQC 4EO5C 3B0BA 3RELC 2PYOD 3KXBD 3NQJB 3AZMA 4ZUXA 3AZGD 4LD9C 3AZLC 1P3LC 3UTBD 5B40A 5F99A 1F66C 3O62B 3REKD 3LZ0C 3LZ1C 1PZRA 4DQYB 5B0ZD 1U35A 1KU5A 1B67A 5BNVA 3AZNB 3MNNB 3O62C 3V9RA 1P34B 2FFFB 3H0RC 3KUYB 3AV1D 5CPIB 5JA4A 1HQ3B 1M18A 3B6FB 1A7WA 1TZYA 3KUYA 4J8XA 5AV5B 3W96A 3MNNC 3AZNC 1P3MD 3W98D 3AN2A 1P34C 1N1JA 5E5AB 5AV6A 5CPIC 5CP6A 3MGRA 3VH5T 5GXQB 1HQ3C 3B6FC 2Y2NA 4XZQA 3MGQB 3AZJA 2AROA 3MVDB 2HIOB 3WTPB 5FUGB 5B2IB 4G91B 2NZDA 4H9SC 5E5AC 4YM6B 3REID 1EQZB 1P3OB 3LJAD 5GXQC 2Y2HA 1W2EA 1EQZA 3VH6W 3MVDC 2HIOC 3LELD 3WTPC 1ZLAA 5B2IC 4G91C 3WA9B 4YM6C 3UTAB 2XD1A 1M1AD 2DQNC 1KX3A 2HUEB 4H9NA 3FDDA 5BT1C 5KDMB 3AZEA 3UTAC 2W8SA 3AZFD 2BYKB 2HUEC 4DRBA 2F8NA 3B6GA 3VH5A 3H0MC 3C1BB 4YS3D 4JJND 3C1CC 3REHD 1P3KA 3KWQA 4NE3A 3WAAB 2RVQD 3AYWB 2Y2OA 4KGCB 3RELD 4J8VB 4R8PB 2ZY3A 4LD9D 3AZLD 1P3LD 3C1BC 1P3GA 5B24A 1F66D 3WAAC 4E44A 3AYWC 4KGCC 2IO5B 5AY8B 4J8VC 4H9PA 3AZKB 5GT3B 3LZ0D 3X1TB 4Z66B 5G49A 5AV8A 4WU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WKJ A;  3O62 D;  5GSU B;  3X1U B;  3AFA A;  2IO5 C;  5AVC B;  3AZK C;  5GT3 C;  1P3A B;  3X1T C;  3AV1 C;  2PYO A;  3KXB A;  2FJ7 A;  4Z66 C;  5B31 A;  3A6N C;  5B32 B;  5B32 G;  3R45 A;  3AZN D;  3MNN D;  5GSU C;  2F8N H;  1P34 D;  5AVC C;  5CPI D;  1P3A C;  2YFW A;  3VH6 T;  1P3B B;  1HQ3 D;  3B6F D;  1BH9 B;  5B32 C;  5B0Z A;  3W97 A;  5AV5 D;  3W99 A;  5E5A D;  1P3B C;  4WU9 A;  1KX4 B;  1AOI B;  1P3I A;  5GXQ D;  1H3O B;  5B2J A;  3MGQ D;  1AOI A;  5DNN B;  2HIO D;  3MVD D;  3WTP D;  5B2I D;  3UT9 B;  4YM6 D;  4J8W A;  1KX4 C;  3AZH B;  4X23 A;  5BO0 B;  5CPJ A;  5DNN C;  1P3F B;  3UT9 C;  4Z5T B;  5B33 B;  5BT1 D;  4HGA B;  2CV5 B;  1ID3 A;  3UTA D;  2YFV B;  1HTA A;  1P3P A;  3AV2 A;  5BS7 A;  4Z5T A;  4CSR B;  1P3F C;  4UUZ A;  1WWS A;  3C1C D;  3LEL A;  3B0C T;  5B33 C;  4HGA C;  3AZM B;  4ZUX B;  4CSR A;  3MGP A;  5B40 B;  3REJ A;  5F99 B;  5B0Y A;  3C1B D;  3AZI A;  3AZM C;  3WAA D;  4ZUX C;  3AYW D;  2BYM A;  4KGC D;  1U35 B;  4J8V D;  4R8P D;  4ZBJ B;  5B40 C;  5F99 C;  5BNV B;  5CHL B;  3V9R B;  5JA4 B;  5BNX A;  1U35 C;  4XUJ B;  1M18 B;  3AZK D;  4ZBJ C;  1TZY B;  5GT3 D;  3X1T D;  1BH8 A;  4H9R A;  4J8X B;  3W96 B;  4Z66 D;  3X1S A;  5AV9 A;  3A6N D;  3AN2 B;  1N1J B;  4XUJ A;  5AV6 B;  5GSU D;  5CP6 B;  3X1U D;  3MGR B;  5AVC D;  1M18 C;  1JFI A;  1TZY C;  4XZQ B;  1P3A D;  3KUY C;  3AZJ B;  2ARO B;  4J8X C;  3W96 C;  3LZ1 A;  3AN2 C;  2NZD B;  5B32 D;  5AV6 C;  5B1M A;  3MGS A;  5AV5 C;  5AVB A;  1P3B D;  4XZQ C;  2ARO C;  3NQU A;  4NFT A;  1TAF A;  1S32 A;  1ZLA B;  2NZD C;  3MGQ C;  5DNM A;  1KX3 B;  1EQZ C;  1KX4 D;  1P3O C;  5GT0 A;  4H9N B;  1ZLA C;  4KUD A;  2NQB A;  5DNN D;  3AZE B;  3UT9 D;  3WA9 C;  4KHA A;  3AZH D;  2F8N B;  3B6G B;  1P3K B;  3B0D B;  3KWQ B;  1P3F D;  5B33 D;  3TU4 A;  4Z2M G;  1M19 A;  1P3G B;  1P3K C;  5B24 B;  4J8U A;  3X1V A;  4NE6 A;  4H9P B;  3AZM D;  4ZUX D;  5AV8 B;  5G49 B;  5B40 D;  1P3G C;  4WU8 B;  4R8P C;  5F99 D;  5JRG A;  5CPK A;  3WKJ B;  1KX5 A;  3AFA B;  5B1L A;  4QLC A;  3C1C A;  2PYO B;  3KXB B;  2FJ7 B;  5AV8 C;  5B31 B;  1U35 D;  3WTP E;  5AY8 C;  3R45 B;  4WU8 C;  3WKJ C;  2JSS A;  3AZG A;  1WWI A;  2YFW B;  2FJ7 C;  3UTB A;  5B31 C;  3X1U C;  1M18 D;  1TZY D;  5B0Z B;  3KUY D;  4J8X D;  3W97 B;  3W96 D;  3W99 B;  3AN2 D;  3REK A;  5AV6 D;  4WU9 B;  1P3I B;  4XZQ D;  5B2J B;  2ARO D;  3W97 C;  3W99 C;  3AV1 A;  2NZD D;  4WU9 C;  4J8W B;  1P3I C;  4X23 B;  3W98 A;  1EQZ D;  1P3M A;  5B2J C;  5CPJ B;  1P3O D;  1AOI C;  4M6B A;  4H9Q A;  1ZLA D;  4AWL B;  1ID3 B;  4J8W C;  1P3P B;  3WA9 D;  4CAY A;  1KX3 D;  1BFM A;  3LJA B;  3AV2 B;  5CPJ C;  4WNN A;  3REI A;  3AZH C;  4UUZ B;  3LEL B;  4AWL C;  3LJA A;  1ID3 C;  3VH6 A;  3AZE D;  3MGP B;  1P3P C;  1M1A B;  3AV2 C;  5BS7 C;  4Z5T C;  3REJ B;  2CV5 C;  2F8N D;  3B6G D;  5B0Y B;  3AZI B;  1P3K D;  1M1A A;  3VH5 W;  2BYM B;  3MGP C;  3REJ C;  5B0Y C;  1P3G D;  2F8N K;  5B24 D;  3AZF A;  1ULY A;  5BNX B;  4EO5 B;  1BH8 B;  4H9R B;  5AV8 D;  3X1S B;  5AV9 B;  4JJN A;  3REH A;  4YS3 A;  5C3I B;  5AY8 D;  4WU8 D;  3WKJ D;  3REL A;  1JFI B;  4LD9 A;  3AZL A;  1P3L A;  2FJ7 D;  5B31 D;  5AV9 C;  3LZ0 B;  3LZ1 B;  3X1S C;  2LY8 A;  5C3I C;  1F66 A;  4XUJ C;  5B1M B;  3MGS B;  3NQJ A;  3LZ0 A;  5AVB B;  3NQU B;  5CP6 C;  1TAF B;  3MGR C;  1S32 B;  3O62 A;  5B1M C;  3MGS C;  3W97 D;  3W99 D;  3AZJ C;  5DNM B;  5AVB C;  4WU9 D;  1P3I D;  5GT0 B;  1S32 C;  4KUD B;  3AZN A;  3MNN A;  2NQB B;  5B2J D;  1P34 A;  1AOI D;  5CPI A;  5DNM C;  4KHA B;  4J8W D;  1HQ3 A;  4H9O B;  3B6F A;  5GT0 C;  4KUD C;  4X23 D;  5AV5 A;  1KX3 C;  5CPJ D;  2NQB C;  4H9S A;  5E5A A;  4H9O A;  2F8N G;  3TU4 B;  1ID3 D;  5GXQ A;  3AZE C;  1P3P D;  3MGQ A;  1M19 B;  3AV2 D;  4Z5T D;  2HIO A;  3MVD A;  3WTP A;  5FUG A;  5B2I A;  2CV5 D;  4YM6 A;  3B6G C;  4J8U B;  1P3O A;  3X1V B;  3TU4 C;  3B0D C;  3KWQ C;  3MGP D;  1M19 C;  3REJ D;  5CPK B;  5JRG B;  3WA9 A;  5B0Y D;  4J8U C;  1KX5 B;  3X1V C;  3AZI D;  3UTA A;  5B1L B;  4QLC B;  5B24 C;  3C1C B;  1Q9C A;  5CPK C;  5JRG C;  5KDM A;  1KX5 C;  5B31 G;  3AZG B;  5B1L C;  4QLC C;  2BYK A;  3UTB B;  3AFA C;  4E45 A;  4WZS B;  3C1B A;  3X1S D;  5AV9 D;  2PYO C;  3KXB C;  3REK B;  3WAA A;  4XUJ D;  3AZG C;  3AYW A;  4KGC A;  4J8V A;  4R8P A;  3UTB C;  3LZ1 D;  5CP6 D;  3B0C W;  3MGR D;  3REK C;  3AV1 B;  5B1M D;  3A6N B;  3MGS D;  5B0Z C;  5AY8 A;  3AZJ D;  3AZK A;  5GT3 A;  3X1T A;  5AVB D;  3W98 B;  1B6W A;  4Z66 A;  1P3M B;  3A6N A;  1S32 D;  4H9Q B;  5GSU A;  3X1U A;  5AVC A;  5DNM D;  1P3A A;  4CAY B;  3W98 C;  1P3M C;  4WNN B;  5B32 A;  5GT0 D;  3REI B;  4KUD D;  2NQB D;  4X23 C;  1P3B A;  3KSY A;  4Z2M H;  1BH9 A;  1R4V A;  3REI C;  4DRA A;  3LJA C;  4NE5 A;  1KX4 A;  3TU4 D;  3LEL C;  3KWQ D;  1H3O A;  1M19 D;  5DNN A;  1M1A C;  3UT9 A;  3AZF B;  4J8U D;  3X1V D;  3AZH A;  3AZI C;  4YS3 B;  4JJN B;  5BO0 A;  3REH B;  4G92 B;  1P3F A;  5CPK D;  5JRG D;  3AZF C;  3REL B;  5B33 A;  2CV5 A;  1KX5 D;  2CWE A;  2YFV A;  5B1L D;  3AZL B;  4LD9 B;  4QLC D;  1P3L B;  1F1E A;  4YS3 C;  4WV4 B;  4JJN C;  3REH C;  1F66 B;  3AFA D;  4G92 C;  2L5A A;  2RVQ C;  4EO5 C;  3B0B A;  3REL C;  2PYO D;  3KXB D;  3NQJ B;  3AZM A;  4ZUX A;  3AZG D;  4LD9 C;  3AZL C;  1P3L C;  3UTB D;  5B40 A;  5F99 A;  1F66 C;  3O62 B;  3REK D;  3LZ0 C;  3LZ1 C;  5B0Z D;  1U35 A;  1KU5 A;  1B67 A;  5BNV A;  3AZN B;  3MNN B;  3O62 C;  3V9R A;  1P34 B;  3AV1 D;  3KUY B;  5CPI B;  5JA4 A;  1HQ3 B;  1M18 A;  3B6F B;  1A7W A;  1TZY A;  3KUY A;  4J8X A;  5AV5 B;  3W96 A;  3MNN C;  3AZN C;  1P3M D;  3W98 D;  3AN2 A;  1P34 C;  1N1J A;  5E5A B;  5AV6 A;  5CPI C;  5CP6 A;  3MGR A;  3VH5 T;  5GXQ B;  1HQ3 C;  3B6F C;  4XZQ A;  3MGQ B;  3AZJ A;  2ARO A;  3MVD B;  2HIO B;  3WTP B;  5FUG B;  5B2I B;  4G91 B;  2NZD A;  4H9S C;  5E5A C;  4YM6 B;  3REI D;  1EQZ B;  1P3O B;  3LJA D;  5GXQ C;  1EQZ A;  3VH6 W;  3MVD C;  2HIO C;  3LEL D;  3WTP C;  1ZLA A;  5B2I C;  4G91 C;  3WA9 B;  4YM6 C;  3UTA B;  1M1A D;  1KX3 A;  2HUE B;  4H9N A;  5BT1 C;  5KDM B;  3AZE A;  3UTA C;  3AZF D;  2BYK B;  2HUE C;  4DRB A;  2F8N A;  3B6G A;  3VH5 A;  3C1B B;  4YS3 D;  4JJN D;  3C1C C;  3REH D;  1P3K A;  3KWQ A;  4NE3 A;  3WAA B;  2RVQ D;  3AYW B;  4KGC B;  3REL D;  4J8V B;  4R8P B;  4LD9 D;  3AZL D;  1P3L D;  3C1B C;  1P3G A;  5B24 A;  1F66 D;  3WAA C;  4E44 A;  3AYW C;  4KGC C;  2IO5 B;  5AY8 B;  4J8V C;  4H9P A;  3AZK B;  5GT3 B;  3LZ0 D;  3X1T B;  4Z66 B;  5G49 A;  5AV8 A;  4WU8 A; 
#chains in the Genus database with same CATH topology
 3WKJ A;  3O62 D;  5GSU B;  3X1U B;  3AFA A;  2IO5 C;  5AVC B;  3AZK C;  5GT3 C;  1P3A B;  3X1T C;  3AV1 C;  2PYO A;  3KXB A;  2FJ7 A;  2Y2G A;  5B31 A;  4Z66 C;  3A6N C;  5B32 B;  5B32 G;  3R45 A;  3AZN D;  3MNN D;  5GSU C;  2F8N H;  1P34 D;  3EPJ A;  5AVC C;  5CPI D;  1P3A C;  2YFW A;  3VH6 T;  1P3B B;  1HQ3 D;  2F2A C;  3B6F D;  1BH9 B;  5B32 C;  5B0Z A;  3W97 A;  5AV5 D;  3W99 A;  3KFU G;  5E5A D;  1P3B C;  4WU9 A;  1KX4 B;  1AOI B;  1P3I A;  5GXQ D;  1H3O B;  5B2J A;  2JCH A;  3MGQ D;  1AOI A;  5DNN B;  2HIO D;  2Y2K A;  3MVD D;  3WTP D;  5B2I D;  3UT9 B;  4YM6 D;  4J8W A;  1KX4 C;  3AZH B;  2Y2P A;  4X23 A;  5BO0 B;  5CPJ A;  5DNN C;  1P3F B;  3UT9 C;  4Z5T B;  5B33 B;  5BT1 D;  3H0L C;  4HGA B;  2CV5 B;  3UTA D;  1ID3 A;  2YFV B;  1HTA A;  3EPH A;  1P3P A;  3AV2 A;  5BS7 A;  4Z5T A;  4CSR B;  1P3F C;  4UUZ A;  1WWS A;  3C1C D;  3LEL A;  3B0C T;  5B33 C;  4HGA C;  3AZM B;  4ZUX B;  4CSR A;  3MGP A;  5B40 B;  3REJ A;  5F99 B;  5B0Y A;  3C1B D;  3AZI A;  3AZM C;  3WAA D;  4ZUX C;  3AYW D;  2BYM A;  4KGC D;  1U35 B;  4J8V D;  4R8P D;  4ZBJ B;  5B40 C;  5F99 C;  5BNV B;  5CHL B;  3V9R B;  5JA4 B;  5BNX A;  1U35 C;  4XUJ B;  1M18 B;  3AZK D;  4ZBJ C;  1TZY B;  5GT3 D;  3X1T D;  1BH8 A;  4H9R A;  4J8X B;  3W96 B;  4Z66 D;  3X1S A;  5AV9 A;  3A6N D;  3AN2 B;  1N1J B;  4XUJ A;  5AV6 B;  3A1I A;  5GSU D;  5CP6 B;  3X1U D;  3MGR B;  5AVC D;  1M18 C;  1JFI A;  1TZY C;  4XZQ B;  1P3A D;  3KUY C;  3AZJ B;  2ARO B;  4J8X C;  3W96 C;  3LZ1 A;  3AN2 C;  2NZD B;  3EPK A;  5B32 D;  5AV6 C;  5B1M A;  3MGS A;  5AV5 C;  2ZY2 A;  5AVB A;  1P3B D;  4XZQ C;  2ARO C;  3NQU A;  4NFT A;  1TAF A;  1S32 A;  1ZLA B;  2NZD C;  3MGQ C;  5DNM A;  1KX3 B;  1EQZ C;  1KX4 D;  1P3O C;  5GT0 A;  4H9N B;  1ZLA C;  4KUD A;  2NQB A;  5DNN D;  3AZE B;  3UT9 D;  3A1K A;  3WA9 C;  4KHA A;  3AZH D;  2F8N B;  3B6G B;  1P3K B;  3B0D B;  2Y2Q A;  3KWQ B;  1P3F D;  5B33 D;  3TU4 A;  4Z2M G;  1M19 A;  1P3G B;  1P3K C;  5B24 B;  2DF4 C;  4J8U A;  3X1V A;  4NE6 A;  4H9P B;  3AZM D;  4ZUX D;  5AV8 B;  5G49 B;  5B40 D;  1P3G C;  4WU8 B;  4R8P C;  5F99 D;  5JRG A;  5CPK A;  3WKJ B;  1KX5 A;  3AFA B;  5B1L A;  4QLC A;  1Z2C B;  3C1C A;  3KXB B;  2FJ7 B;  5AV8 C;  5B31 B;  1U35 D;  2PYO B;  3WTP E;  5AY8 C;  3R45 B;  4WU8 C;  3WKJ C;  2JSS A;  3AZG A;  1WWI A;  2YFW B;  2FJ7 C;  3UTB A;  5B31 C;  3X1U C;  1M18 D;  1TZY D;  2G5H C;  5B0Z B;  3KUY D;  4J8X D;  3W97 B;  3W96 D;  3W99 B;  3AN2 D;  3REK A;  5AV6 D;  4WU9 B;  1P3I B;  4XZQ D;  5B2J B;  2ARO D;  3W97 C;  3W99 C;  3AV1 A;  2NZD D;  4WU9 C;  4J8W B;  1P3I C;  2Y2M A;  4X23 B;  3W98 A;  1EQZ D;  1P3M A;  5B2J C;  5CPJ B;  1P3O D;  1AOI C;  4M6B A;  4H9Q A;  1ZLA D;  4AWL B;  1ID3 B;  4J8W C;  1P3P B;  2ZY4 A;  4CAY A;  1KX3 D;  3WA9 D;  1BFM A;  3LJA B;  3AV2 B;  2Y2L A;  5CPJ C;  4WNN A;  3REI A;  3AZH C;  1T3U A;  4UUZ B;  3LEL B;  4AWL C;  3LJA A;  1ID3 C;  3VH6 A;  3AZE D;  3P5J B;  3MGP B;  1P3P C;  1M1A B;  3AV2 C;  5BS7 C;  4Z5T C;  3REJ B;  2CV5 C;  2F8N D;  3B6G D;  5B0Y B;  3AZI B;  1P3K D;  3AL0 C;  1M1A A;  3VH5 W;  2BYM B;  3MGP C;  3REJ C;  2G5I C;  5B0Y C;  1P3G D;  2F8N K;  5B24 D;  3AZF A;  1ULY A;  2ZY5 A;  2XD5 A;  5BNX B;  4EO5 B;  1BH8 B;  4H9R B;  5AV8 D;  3X1S B;  5AV9 B;  4JJN A;  3REH A;  4YS3 A;  5C3I B;  5AY8 D;  4WU8 D;  4UPK A;  3WKJ D;  3REL A;  1JFI B;  4LD9 A;  3AZL A;  2JE5 A;  1P3L A;  2FJ7 D;  5B31 D;  5AV9 C;  3LZ0 B;  3LZ1 B;  3X1S C;  2LY8 A;  5C3I C;  1F66 A;  4XUJ C;  5B1M B;  3MGS B;  3NQJ A;  3LZ0 A;  2ZM5 A;  5AVB B;  3NQU B;  5CP6 C;  1TAF B;  3MGR C;  1S32 B;  3O62 A;  5B1M C;  3MGS C;  3W97 D;  3W99 D;  3AZJ C;  5DNM B;  5AVB C;  4WU9 D;  1P3I D;  5GT0 B;  1S32 C;  4KUD B;  3AZN A;  3MNN A;  2NQB B;  5B2J D;  1P34 A;  1AOI D;  5CPI A;  5DNM C;  4KHA B;  4J8W D;  1HQ3 A;  3IP4 C;  4H9O B;  3B6F A;  5GT0 C;  4KUD C;  4X23 D;  5AV5 A;  1KX3 C;  5CPJ D;  2NQB C;  4H9S A;  5E5A A;  4H9O A;  2F8N G;  3TU4 B;  1ID3 D;  5GXQ A;  3AZE C;  1P3P D;  3MGQ A;  1M19 B;  3AV2 D;  4Z5T D;  2HIO A;  3MVD A;  3WTP A;  5FUG A;  5B2I A;  2CV5 D;  4YM6 A;  3B6G C;  4J8U B;  1P3O A;  3X1V B;  3TU4 C;  3F6T A;  3B0D C;  3KWQ C;  3MGP D;  1M19 C;  3REJ D;  5CPK B;  5JRG B;  3WA9 A;  5B0Y D;  4J8U C;  1KX5 B;  3X1V C;  3AZI D;  3UTA A;  5B1L B;  4QLC B;  5B24 C;  3C1C B;  1Q9C A;  5CPK C;  5JRG C;  5KDM A;  1KX5 C;  5B31 G;  3AZG B;  5B1L C;  4QLC C;  2BYK A;  3UTB B;  3AFA C;  4E45 A;  4WZS B;  3C1B A;  3X1S D;  5AV9 D;  2PYO C;  3KXB C;  3REK B;  3WAA A;  4XUJ D;  3AZG C;  3AYW A;  4KGC A;  4J8V A;  4R8P A;  3UTB C;  3LZ1 D;  5CP6 D;  3B0C W;  3MGR D;  3REK C;  3AV1 B;  5B1M D;  3A6N B;  3MGS D;  5B0Z C;  5AY8 A;  3AZJ D;  3AZK A;  5GT3 A;  3X1T A;  2VQR A;  5AVB D;  3W98 B;  1B6W A;  4Z66 A;  1P3M B;  3A6N A;  1S32 D;  4H9Q B;  3EG5 B;  5GSU A;  3X1U A;  5AVC A;  5DNM D;  1P3A A;  4CAY B;  3W98 C;  1P3M C;  4WNN B;  5B32 A;  5GT0 D;  3REI B;  4KUD D;  2NQB D;  4X23 C;  1P3B A;  3KSY A;  4Z2M H;  1BH9 A;  1R4V A;  3REI C;  4DRA A;  3LJA C;  3EPL A;  4NE5 A;  1KX4 A;  2Y2I A;  3TU4 D;  4WJ3 C;  2Y2J A;  3LEL C;  3KWQ D;  1H3O A;  2BG1 A;  1M19 D;  5DNN A;  1M1A C;  3UT9 A;  3AZF B;  4J8U D;  3X1V D;  3AZH A;  3AZI C;  4YS3 B;  4JJN B;  5BO0 A;  3REH B;  2J8P A;  4G92 B;  1P3F A;  5CPK D;  5JRG D;  2RIQ A;  3AZF C;  3REL B;  5B33 A;  2CV5 A;  1KX5 D;  2CWE A;  2YFV A;  5B1L D;  3AZL B;  4LD9 B;  2UWX A;  4QLC D;  1P3L B;  1F1E A;  4YS3 C;  4WV4 B;  4JJN C;  3REH C;  1F66 B;  3AFA D;  4G92 C;  2L5A A;  2RVQ C;  4EO5 C;  3B0B A;  3REL C;  2PYO D;  3KXB D;  3NQJ B;  3AZM A;  4ZUX A;  3AZG D;  4LD9 C;  3AZL C;  1P3L C;  3UTB D;  5B40 A;  5F99 A;  1F66 C;  3O62 B;  3REK D;  3LZ0 C;  3LZ1 C;  1PZR A;  4DQY B;  5B0Z D;  1U35 A;  1KU5 A;  1B67 A;  5BNV A;  3AZN B;  3MNN B;  3O62 C;  3V9R A;  1P34 B;  2FFF B;  3H0R C;  3KUY B;  3AV1 D;  5CPI B;  5JA4 A;  1HQ3 B;  1M18 A;  3B6F B;  1A7W A;  1TZY A;  3KUY A;  4J8X A;  5AV5 B;  3W96 A;  3MNN C;  3AZN C;  1P3M D;  3W98 D;  3AN2 A;  1P34 C;  1N1J A;  5E5A B;  5AV6 A;  5CPI C;  5CP6 A;  3MGR A;  3VH5 T;  5GXQ B;  1HQ3 C;  3B6F C;  2Y2N A;  4XZQ A;  3MGQ B;  3AZJ A;  2ARO A;  3MVD B;  2HIO B;  3WTP B;  5FUG B;  5B2I B;  4G91 B;  2NZD A;  4H9S C;  5E5A C;  4YM6 B;  3REI D;  1EQZ B;  1P3O B;  3LJA D;  5GXQ C;  2Y2H A;  1W2E A;  1EQZ A;  3VH6 W;  3MVD C;  2HIO C;  3LEL D;  3WTP C;  1ZLA A;  5B2I C;  4G91 C;  3WA9 B;  4YM6 C;  3UTA B;  2XD1 A;  1M1A D;  2DQN C;  1KX3 A;  2HUE B;  4H9N A;  3FDD A;  5BT1 C;  5KDM B;  3AZE A;  3UTA C;  2W8S A;  3AZF D;  2BYK B;  2HUE C;  4DRB A;  2F8N A;  3B6G A;  3VH5 A;  3H0M C;  3C1B B;  4YS3 D;  4JJN D;  3C1C C;  3REH D;  1P3K A;  3KWQ A;  4NE3 A;  3WAA B;  2RVQ D;  3AYW B;  2Y2O A;  4KGC B;  3REL D;  4J8V B;  4R8P B;  2ZY3 A;  4LD9 D;  3AZL D;  1P3L D;  3C1B C;  1P3G A;  5B24 A;  1F66 D;  3WAA C;  4E44 A;  3AYW C;  4KGC C;  2IO5 B;  5AY8 B;  4J8V C;  4H9P A;  3AZK B;  5GT3 B;  3LZ0 D;  3X1T B;  4Z66 B;  5G49 A;  5AV8 A;  4WU8 A; 
#chains in the Genus database with same CATH homology
 3WKJ A;  3O62 D;  5GSU B;  3X1U B;  3AFA A;  2IO5 C;  5AVC B;  3AZK C;  5GT3 C;  1P3A B;  3X1T C;  3AV1 C;  2PYO A;  3KXB A;  2FJ7 A;  2Y2G A;  5B31 A;  4Z66 C;  3A6N C;  5B32 B;  5B32 G;  3R45 A;  3AZN D;  3MNN D;  5GSU C;  2F8N H;  1P34 D;  3EPJ A;  5AVC C;  5CPI D;  1P3A C;  2YFW A;  3VH6 T;  1P3B B;  1HQ3 D;  2F2A C;  3B6F D;  1BH9 B;  5B32 C;  5B0Z A;  3W97 A;  5AV5 D;  3W99 A;  3KFU G;  5E5A D;  1P3B C;  4WU9 A;  1KX4 B;  1AOI B;  1P3I A;  5GXQ D;  1H3O B;  5B2J A;  2JCH A;  3MGQ D;  1AOI A;  5DNN B;  2HIO D;  2Y2K A;  3MVD D;  3WTP D;  5B2I D;  3UT9 B;  4YM6 D;  4J8W A;  1KX4 C;  3AZH B;  2Y2P A;  4X23 A;  5BO0 B;  5CPJ A;  5DNN C;  1P3F B;  3UT9 C;  4Z5T B;  5B33 B;  5BT1 D;  3H0L C;  4HGA B;  2CV5 B;  3UTA D;  1ID3 A;  2YFV B;  1HTA A;  3EPH A;  1P3P A;  3AV2 A;  5BS7 A;  4Z5T A;  4CSR B;  1P3F C;  4UUZ A;  1WWS A;  3C1C D;  3LEL A;  3B0C T;  5B33 C;  4HGA C;  3AZM B;  4ZUX B;  4CSR A;  3MGP A;  5B40 B;  3REJ A;  5F99 B;  5B0Y A;  3C1B D;  3AZI A;  3AZM C;  3WAA D;  4ZUX C;  3AYW D;  2BYM A;  4KGC D;  1U35 B;  4J8V D;  4R8P D;  4ZBJ B;  5B40 C;  5F99 C;  5BNV B;  5CHL B;  3V9R B;  5JA4 B;  5BNX A;  1U35 C;  4XUJ B;  1M18 B;  3AZK D;  4ZBJ C;  1TZY B;  5GT3 D;  3X1T D;  1BH8 A;  4H9R A;  4J8X B;  3W96 B;  4Z66 D;  3X1S A;  5AV9 A;  3A6N D;  3AN2 B;  1N1J B;  4XUJ A;  5AV6 B;  3A1I A;  5GSU D;  5CP6 B;  3X1U D;  3MGR B;  5AVC D;  1M18 C;  1JFI A;  1TZY C;  4XZQ B;  1P3A D;  3KUY C;  3AZJ B;  2ARO B;  4J8X C;  3W96 C;  3LZ1 A;  3AN2 C;  2NZD B;  3EPK A;  5B32 D;  5AV6 C;  5B1M A;  3MGS A;  5AV5 C;  2ZY2 A;  5AVB A;  1P3B D;  4XZQ C;  2ARO C;  3NQU A;  4NFT A;  1TAF A;  1S32 A;  1ZLA B;  2NZD C;  3MGQ C;  5DNM A;  1KX3 B;  1EQZ C;  1KX4 D;  1P3O C;  5GT0 A;  4H9N B;  1ZLA C;  4KUD A;  2NQB A;  5DNN D;  3AZE B;  3UT9 D;  3A1K A;  3WA9 C;  4KHA A;  3AZH D;  2F8N B;  3B6G B;  1P3K B;  3B0D B;  2Y2Q A;  3KWQ B;  1P3F D;  5B33 D;  3TU4 A;  4Z2M G;  1M19 A;  1P3G B;  1P3K C;  5B24 B;  2DF4 C;  4J8U A;  3X1V A;  4NE6 A;  4H9P B;  3AZM D;  4ZUX D;  5AV8 B;  5G49 B;  5B40 D;  1P3G C;  4WU8 B;  4R8P C;  5F99 D;  5JRG A;  5CPK A;  3WKJ B;  1KX5 A;  3AFA B;  5B1L A;  4QLC A;  1Z2C B;  3C1C A;  3KXB B;  2FJ7 B;  5AV8 C;  5B31 B;  1U35 D;  2PYO B;  3WTP E;  5AY8 C;  3R45 B;  4WU8 C;  3WKJ C;  2JSS A;  3AZG A;  1WWI A;  2YFW B;  2FJ7 C;  3UTB A;  5B31 C;  3X1U C;  1M18 D;  1TZY D;  2G5H C;  5B0Z B;  3KUY D;  4J8X D;  3W97 B;  3W96 D;  3W99 B;  3AN2 D;  3REK A;  5AV6 D;  4WU9 B;  1P3I B;  4XZQ D;  5B2J B;  2ARO D;  3W97 C;  3W99 C;  3AV1 A;  2NZD D;  4WU9 C;  4J8W B;  1P3I C;  2Y2M A;  4X23 B;  3W98 A;  1EQZ D;  1P3M A;  5B2J C;  5CPJ B;  1P3O D;  1AOI C;  4M6B A;  4H9Q A;  1ZLA D;  4AWL B;  1ID3 B;  4J8W C;  1P3P B;  2ZY4 A;  4CAY A;  1KX3 D;  3WA9 D;  1BFM A;  3LJA B;  3AV2 B;  2Y2L A;  5CPJ C;  4WNN A;  3REI A;  3AZH C;  1T3U A;  4UUZ B;  3LEL B;  4AWL C;  3LJA A;  1ID3 C;  3VH6 A;  3AZE D;  3P5J B;  3MGP B;  1P3P C;  1M1A B;  3AV2 C;  5BS7 C;  4Z5T C;  3REJ B;  2CV5 C;  2F8N D;  3B6G D;  5B0Y B;  3AZI B;  1P3K D;  3AL0 C;  1M1A A;  3VH5 W;  2BYM B;  3MGP C;  3REJ C;  2G5I C;  5B0Y C;  1P3G D;  2F8N K;  5B24 D;  3AZF A;  1ULY A;  2ZY5 A;  2XD5 A;  5BNX B;  4EO5 B;  1BH8 B;  4H9R B;  5AV8 D;  3X1S B;  5AV9 B;  4JJN A;  3REH A;  4YS3 A;  5C3I B;  5AY8 D;  4WU8 D;  4UPK A;  3WKJ D;  3REL A;  1JFI B;  4LD9 A;  3AZL A;  2JE5 A;  1P3L A;  2FJ7 D;  5B31 D;  5AV9 C;  3LZ0 B;  3LZ1 B;  3X1S C;  2LY8 A;  5C3I C;  1F66 A;  4XUJ C;  5B1M B;  3MGS B;  3NQJ A;  3LZ0 A;  2ZM5 A;  5AVB B;  3NQU B;  5CP6 C;  1TAF B;  3MGR C;  1S32 B;  3O62 A;  5B1M C;  3MGS C;  3W97 D;  3W99 D;  3AZJ C;  5DNM B;  5AVB C;  4WU9 D;  1P3I D;  5GT0 B;  1S32 C;  4KUD B;  3AZN A;  3MNN A;  2NQB B;  5B2J D;  1P34 A;  1AOI D;  5CPI A;  5DNM C;  4KHA B;  4J8W D;  1HQ3 A;  3IP4 C;  4H9O B;  3B6F A;  5GT0 C;  4KUD C;  4X23 D;  5AV5 A;  1KX3 C;  5CPJ D;  2NQB C;  4H9S A;  5E5A A;  4H9O A;  2F8N G;  3TU4 B;  1ID3 D;  5GXQ A;  3AZE C;  1P3P D;  3MGQ A;  1M19 B;  3AV2 D;  4Z5T D;  2HIO A;  3MVD A;  3WTP A;  5FUG A;  5B2I A;  2CV5 D;  4YM6 A;  3B6G C;  4J8U B;  1P3O A;  3X1V B;  3TU4 C;  3F6T A;  3B0D C;  3KWQ C;  3MGP D;  1M19 C;  3REJ D;  5CPK B;  5JRG B;  3WA9 A;  5B0Y D;  4J8U C;  1KX5 B;  3X1V C;  3AZI D;  3UTA A;  5B1L B;  4QLC B;  5B24 C;  3C1C B;  1Q9C A;  5CPK C;  5JRG C;  5KDM A;  1KX5 C;  5B31 G;  3AZG B;  5B1L C;  4QLC C;  2BYK A;  3UTB B;  3AFA C;  4E45 A;  4WZS B;  3C1B A;  3X1S D;  5AV9 D;  2PYO C;  3KXB C;  3REK B;  3WAA A;  4XUJ D;  3AZG C;  3AYW A;  4KGC A;  4J8V A;  4R8P A;  3UTB C;  3LZ1 D;  5CP6 D;  3B0C W;  3MGR D;  3REK C;  3AV1 B;  5B1M D;  3A6N B;  3MGS D;  5B0Z C;  5AY8 A;  3AZJ D;  3AZK A;  5GT3 A;  3X1T A;  2VQR A;  5AVB D;  3W98 B;  1B6W A;  4Z66 A;  1P3M B;  3A6N A;  1S32 D;  4H9Q B;  3EG5 B;  5GSU A;  3X1U A;  5AVC A;  5DNM D;  1P3A A;  4CAY B;  3W98 C;  1P3M C;  4WNN B;  5B32 A;  5GT0 D;  3REI B;  4KUD D;  2NQB D;  4X23 C;  1P3B A;  3KSY A;  4Z2M H;  1BH9 A;  1R4V A;  3REI C;  4DRA A;  3LJA C;  3EPL A;  4NE5 A;  1KX4 A;  2Y2I A;  3TU4 D;  4WJ3 C;  2Y2J A;  3LEL C;  3KWQ D;  1H3O A;  2BG1 A;  1M19 D;  5DNN A;  1M1A C;  3UT9 A;  3AZF B;  4J8U D;  3X1V D;  3AZH A;  3AZI C;  4YS3 B;  4JJN B;  5BO0 A;  3REH B;  2J8P A;  4G92 B;  1P3F A;  5CPK D;  5JRG D;  2RIQ A;  3AZF C;  3REL B;  5B33 A;  2CV5 A;  1KX5 D;  2CWE A;  2YFV A;  5B1L D;  3AZL B;  4LD9 B;  2UWX A;  4QLC D;  1P3L B;  1F1E A;  4YS3 C;  4WV4 B;  4JJN C;  3REH C;  1F66 B;  3AFA D;  4G92 C;  2L5A A;  2RVQ C;  4EO5 C;  3B0B A;  3REL C;  2PYO D;  3KXB D;  3NQJ B;  3AZM A;  4ZUX A;  3AZG D;  4LD9 C;  3AZL C;  1P3L C;  3UTB D;  5B40 A;  5F99 A;  1F66 C;  3O62 B;  3REK D;  3LZ0 C;  3LZ1 C;  1PZR A;  4DQY B;  5B0Z D;  1U35 A;  1KU5 A;  1B67 A;  5BNV A;  3AZN B;  3MNN B;  3O62 C;  3V9R A;  1P34 B;  2FFF B;  3H0R C;  3KUY B;  3AV1 D;  5CPI B;  5JA4 A;  1HQ3 B;  1M18 A;  3B6F B;  1A7W A;  1TZY A;  3KUY A;  4J8X A;  5AV5 B;  3W96 A;  3MNN C;  3AZN C;  1P3M D;  3W98 D;  3AN2 A;  1P34 C;  1N1J A;  5E5A B;  5AV6 A;  5CPI C;  5CP6 A;  3MGR A;  3VH5 T;  5GXQ B;  1HQ3 C;  3B6F C;  2Y2N A;  4XZQ A;  3MGQ B;  3AZJ A;  2ARO A;  3MVD B;  2HIO B;  3WTP B;  5FUG B;  5B2I B;  4G91 B;  2NZD A;  4H9S C;  5E5A C;  4YM6 B;  3REI D;  1EQZ B;  1P3O B;  3LJA D;  5GXQ C;  2Y2H A;  1W2E A;  1EQZ A;  3VH6 W;  3MVD C;  2HIO C;  3LEL D;  3WTP C;  1ZLA A;  5B2I C;  4G91 C;  3WA9 B;  4YM6 C;  3UTA B;  2XD1 A;  1M1A D;  2DQN C;  1KX3 A;  2HUE B;  4H9N A;  3FDD A;  5BT1 C;  5KDM B;  3AZE A;  3UTA C;  2W8S A;  3AZF D;  2BYK B;  2HUE C;  4DRB A;  2F8N A;  3B6G A;  3VH5 A;  3H0M C;  3C1B B;  4YS3 D;  4JJN D;  3C1C C;  3REH D;  1P3K A;  3KWQ A;  4NE3 A;  3WAA B;  2RVQ D;  3AYW B;  2Y2O A;  4KGC B;  3REL D;  4J8V B;  4R8P B;  2ZY3 A;  4LD9 D;  3AZL D;  1P3L D;  3C1B C;  1P3G A;  5B24 A;  1F66 D;  3WAA C;  4E44 A;  3AYW C;  4KGC C;  2IO5 B;  5AY8 B;  4J8V C;  4H9P A;  3AZK B;  5GT3 B;  3LZ0 D;  3X1T B;  4Z66 B;  5G49 A;  5AV8 A;  4WU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...