3B6KA

Wrba from escherichia coli, benzoquinone complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
197
structure length
197
Chain Sequence
AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the NADH:quinone oxidoreductase WrbA from Escherichia coli.
pubmed doi rcsb
molecule tags Flavoprotein
molecule keywords Flavoprotein wrbA
total genus 65
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3b6kA00
4LTDA 4HEQA 4U7FA 4QOIA 3FVWA 3TE7A 3KAQA 1D03A 2XODA 1FTGA 4C76A 3L9XA 1AKRA 1FX1A 2RG1A 1ZWKA 4YAOA 4YAWA 5EAIA 4FX2A 2BPOA 1V4BA 3R6WA 1YOBA 3KEGA 3EDOA 4NULA 2FOXA 1NNI1 4PTZA 4ZVNA 5B3KA 1AZLA 1VMEA 3N3BC 1ZX1A 2FX2A 1KBQA 3W79A 1D04A 1F4PA 1JA0A 1YKGA 2R96A 3B6KA 3HR4A 4QOFA 3QFCA 1D4AA 5F12A 1AKVA 5FA6A 3QE2A 1SG0A 2F1OA 5LBTA 3U7RA 3F6RA 5F4BA 5FX2A 2HNAA 1C7EA 3K20A 4U7HA 3NHPA 3NHKA 2D5IA 3NHYA 1J9EA 1OFVA 1YDGA 2OHHA 4H2DA 4LA4A 5F51A 4DILA 3EYWA 5B3LA 3B6JA 2X2PA 3OWXA 3NHLA 4Y9RA 4FGJA 5EA2A 2FCRA 3NFRA 4H6PA 1E5DA 1CZKA 4QOJA 1AKUA 4GR9A 3FJOA 1CZLA 3NHWA 4LTMA 4QOHA 1AMOA 1YCGA 2M6RA 3NLLA 4ZVKA 4R81A 3LT5A 4DIKA 2FZVA 3U7IA 3ESYA 5LJIA 3OX1A 1C7FA 4YAUA 4N65A 3RPEA 1AG9A 4YALA 1H69A 4F8YA 2B3DA 2KQUA 1RLIA 1FUEA 1XI2A 1BVYF 4ICIA 4XDHA 5A4KA 1QHEA 3OJWA 3OVMA 4C14A 1FLDA 2V9CA 2FLVA 3P0RA 4ZVLA 3O73A 1OBVA 3ESXA 4C0WA 1J8QA 2FZ5A 1AKQA 2HNBA 3NHRA 5TGZA 3G5MA 3L9WA 2M6SA 2QMZA 5LBUA 2QMYA 3N3AC 2FVXA 2HPVA 2OHJA 3HA2A 4N82A 1XYYA 1YCFA 1WSBA 4OXXA 2ARKA 3O2NA 2Q62A 4ZVMA 1AKTA 2ZKIA 4CETA 1QBGA 1FLNA 3D7NA 3OWHA 1CZUA 2BZSA 4C0XA 1AHNA 1T5BA 4D02A 3TEMA 1I1OA 1DXOA 3GFSA 1T0IA 3ZHOA 1H66A 4N9QA 3GAMA 3OJXA 1BU5A 1SQSA 3OX2A 4BMOB 1QRDA 2OHIA 3OX3A 4ESEA 4PU0A 1RTTA 4U7GA 1B1CA 3GFRA 2BN4A 1CZRA 4GI5A 4J8PA 4DY4A 4FGLA 3ESZA 1J9ZA 5FUQA 5JROA 1FVXA 4S24A 3JSXA 3N39C 2QX6A 4FGKA 5NLLA 3TZBA 1XYVA 2Z9DA 3K1YA 4YAFA 5ULLA 1KBOA 2FAXA 1DXQA 1YCHA 3F6SA 2V5VA 2WC1A 1CZNA 3B6IA 3FX2A 2QX8A 2MTBA 2Z9CA 3KAPA 4QODA 2V5UA 5NULA 2BMVA 3S2YA 2XOEA 4LTNA 1JA1A 2R97A 2QR2A 4Y7CA 3SVLA 4Y9UA 3W7AA 5LLDA 2KLBA 3B6MA 5EMNA 1DX9A 4LAFA 2Q9UA 1CZOA 3F90A 1GG5A 2GSWA 1YRHA 2MWMA 3HLYA 2AMJA 3QFRA 2X2OA 3NHUA 4M0CA 3ES9A 3FW1A 4QOEA 3W78A 2N1MA 3KLBA 3NHFA 4XDGA 4BMPB 5LMCA 1TLLA 4GQIA 1FLAA 2Z98A 3LCMA 3UXHA 4CF6A 5BUCA 4HS4A 2QWXA 4YQEA 2OYSA 3UXEA 1RLJA 2MOKA 3GFQA 4QOGA 3NHJA 5LJLA 3F2VA 2QX4A 3NHSA 1WSWA 4PTYA 1FLVA 1AKWA 1TIKA 2A5LA 2BF4A 6NULA 1XT6A 3W77A 2Z9BA 1ZWLA 5LVAA 1X77A 2W5UA 2QX9A 1OBOA 2FDXA 2MT9A 3FNIA 4NLLA 1RCFA 1QR2A 1CZHA 1J9GA
chains in the Genus database with same CATH superfamily
4DB4A 2GF2A 1THGA 3VPHA 1D2AA 2MIIA 1CWUA 1UJBA 4HY3A 1EUCB 1VP9A 4URYR 2J07A 3G2PA 5JMPA 5IBCA 5LD2B 1PF7E 4PZCA 1T9KA 3ZDAA 1P72A 3OQBA 1ECJA 1N7IA 4OFZA 4O2BB 2FMIA 4KK3A 3G1WA 3FCEA 4PIVA 4OKIA 3WHKA 4CXMA 2JH9A 1KBQA 1WW3A 1GTZA 1FBTA 3V3TA 2P0YA 4I3GA 2OPHA 1ZGAA 3SEFA 1SG0A 3U4QB 4EI8A 3WQHA 3EGDB 4L4ZA 1PZFA 3DXYA 4ZGWA 1I6LA 3L8MA 4M1KA 3ZU2A 5EKTA 2MSDB 4ZYWA 1BQ4A 5IANA 4UE2A 4J0EA 5BNZA 1KYQA 5AJYA 5FNZA 1O4WA 1YMVA 1M6EX 5AHXA 1OH6A 3PJFA 4IXMA 2DTDA 4C01A 1BQEA 1Z36A 2SNIE 1M0SA 1CZLA 1FFWA 4O63O 3FFXA 1RE1A 1AGPA 2MU1A 1CUUA 4MYTA 5GJVC 2P8SA 2TMGA 3AR2A 2QVBA 3ANMA 3GJ8A 1FTQA 3BL8A 5AK5A 5L7WA 2D13A 4XD7A 4ZT2A 3RD5A 4YUAA 3KLOA 2GPNA 2JFUA 3ETJA 3AVYA 1HG1A 2XCLA 3WLTA 3ZQJA 4YV0A 2QLNA 4O2AF 1J4AA 1IG0A 1X8JA 3HBLA 1N5DA 1SWVA 2PUVA 1CR6A 3DOEA 5BSMA 1YRYE 4NYJR 1UC8A 5J2UA 2WWTA 3ZJVA 4HP8A 4ARZA 1Z75A 2PS1A 4Q9HA 4L8YA 1JG4A 3PR3A 1UQTA 3CIOA 3H0CA 3BA6A 2AC7A 4HDNB 3T9DA 2RK6A 4GSLA 5ADUS 3M1AA 1GPUA 2DRIA 3T3EA 3UTCA 5AVUA 2QY6A 2IZ6A 2GZ3A 1DV1A 3D4OA 3CLHA 2BT4A 5LZ9A 2JJYA 4WFKA 2J0UB 1DPGA 1YRQA 1V5IA 5FUMA 5AW3A 5K0NA 6ADHA 2WTUA 3NV7A 2FUG1 3MTDA 1D1PA 4DC1A 4DA4A 3V1LA 3GCZA 4RM3A 5IN5A 4P92A 5IJZA 3MCVA 2V97A 3N59A 4MUNA 2ID4A 4YMVA 5IYZA 3K96A 1YMUA 4HWKA 1YR2A 4MICA 1T3ZA 4JFAA 2H0AA 1P33A 1XTSA 4FK8A 4INOA 2QM3A 4LHEA 2J87A 2R6R1 4YLEA 4BZPA 4EMUA 4HAYA 3R5KA 2BEVB 5JVDA 1UJ2A 4ZDKA 3SSAA 1SXJC 1JA1A 2WTBA 5ESRA 1BEZA 3TO5A 5HIIA 1DX9A 1LPSA 2FWBA 1L3IA 4IUCS 1OH7A 4UNPA 1T3LA 2OT3B 1SKBA 1JJIA 2DY1A 1YS9A 3A9SA 3K09C 1CR2A 2HLHA 1UPUA 5J59A 4HZUB 4ZYYA 1I4DD 3HSYA 4MDFA 1SVNA 1U0JA 3QXGA 4TT3D 1N8SA 4D46A 4QYWA 5LDHA 2XMCA 3W9BA 4LBYA 5KTTA 1Q57A 1XRPA 3ORRA 1FDVA 1S8OA 5IVDA 4ACAA 2JGNA 1Z5GA 1PG2A 2DPXA 3KWJA 2XBLA 3N1UA 3N2GA 4G65A 1YNSA 4MR9B 4WNYA 3AI2A 3G6WA 4OXIA 3N07A 1AZSC 1NL3A 4GUDA 4RORA 4ZD6A 4E5VA 1KI2A 4Y1RA 1GAXA 1XKQA 3AEZA 4B76A 5JNWA 3X1KA 4RA6A 5C5IA 5IUJC 4QOIA 4F3TA 4EHFA 4RPCA 5FBHA 1ULHA 4TXMA 1D03A 3LXUX 4QXRA 1FTGA 4IXNA 1B8OA 4WKPA 5CT8A 3UCXA 3FTFA 1Y3AA 5EWMA 4U39A 4DCNA 3BHJA 1E6LA 2JJQA 2H08A 3HPQA 1E3WB 1QYVA 5BVHA 4H4DA 2NPIA 2C7QA 3CJRA 4IIJA 2J9FB 3DTTA 1GGMA 3OQVA 3UMJA 3OOWA 3FROA 1RQ2A 2I4LA 5JO9A 3PP8A 1W5AA 1ZVJA 4BKPA 4YUZA 3A58B 1GT91 3LFHA 3OD1A 3PX2A 5TVKA 5AVVA 2VPPA 1XEXA 3WK9A 2QN2A 1A04A 1L7EA 1A27A 1G3UA 2H1VA 3MD9A 2OXTA 5A5DA 4DIMA 3JQRA 4PZ9A 1CUSA 1JPUA 3VPCA 2J08A 2ZYUX 3H3JA 3U7IA 2HMVA 4I99A 3H9JA 3S68A 3RPEA 2ZIZA 5ICFA 3C3KA 4G2NA 5GY7A 4PWYA 4WPGA 3KOWA 1XK6A 1QH8B 4DG5A 2K2WA 5LQDA 2G6BA 1JQ5A 4TV9F 5KAMA 4BBAA 1KQGA 1IJEA 4YDHB 2ZZNA 2JAQA 1T1SA 1TJYA 2BGJA 2W11A 3MMPA 1YRAA 1R6UA 3I05A 4UOQA 4YRRA 3KJIA 3IUNA 4B4KA 1A1SA 4UEJA 1S2MA 3VSEA 4WBNB 2VHXA 3G79A 2F1RA 3EAQA 1YVUA 2W6MA 4PBSA 5I7VA 1SQ0A 1F0KA 2EKPA 3D6HA 2PXHA 5GOZA 3C97A 7AT1A 1VSQA 4KHZA 3EDCA 1RPZA 3HNRA 4XJSA 4C7OA 3K9QO 3VDRA 4BGDA 4E14A 2C7RA 2C58A 1L5WA 1VG0B 2ATEA 1NGSA 7GPBA 3KQTA 3SQXA 4W7IA 5CVDA 3SX2A 3UN1A 2PL5A 2H54A 3I0MA 4HFNA 2C3YA 5JMWA 4MRMA 4JGBA 4BQFA 1T34A 4GI3A 4K28A 2D0PB 3AF5A 4CQLA 4JLAA 1SUEA 4JC4A 2OV8A 1XP5A 2NQ2C 3PHJA 1M1NB 4K6FA 3WZ2A 3LDUA 4DR6B 5LQJA 1YKSA 2XF2A 4QUJA 2JGMA 3BHMA 4AL4A 1D2NA 1QE0A 4WOJA 3EPJA 3OA0A 1IN8A 1YQ9A 2Y93A 3KS9A 4MVJG 4TKUA 1AZTA 2YIDA 3LQ1A 3DPIA 2NYUA 5IT9A 4RY9A 3JAKA 2K4MA 2GXAA 1J1ZA 2H59A 3FW1A 4MPRA 3VHQA 1NX6A 3W6UA 1YR3A 2IE8A 2CCKA 1G21E 1XVTA 3EGDA 4KIGA 4TTAA 1RRFA 3CVXA 1KAMA 1VRCA 1OUMA 3VR2D 4P3YA 3R6DA 1WCYA 5EHNA 5C7OO 1JIUA 2VUUA 3FDJA 3JR3A 3KUUA 3NONA 3OLQA 4G2TA 4A2CA 1BN7A 4CV2A 3RS2A 4EKIA 2Y76A 4D6XA 2D62A 2E21A 2FSVC 3FJ1A 4FSDA 4YI3A 4YJ2A 1Z82A 3KR2A 3M6MD 4Y6OA 2XNJA 5AJUA 4PINA 3RVKA 4FHCA 3VNAA 1A98A 2RG1A 3RBAA 3I9KA 5CVVA 3C2QA 3GIDA 4EHBA 3I2HA 1M34B 4ZI3A 4I2NA 2QJTA 2GM4A 5AJHA 5JZSA 2XUIA 3HRIA 3KXLA 4QYMA 2WSYB 4ZYTA 1NP6A 4HAOA 3I01M 4H7HA 1T9BA 2JLSA 1SUFA 1Z3CA 1M10A 4TXJA 1LVGA 1X1AA 5JMTA 4GEKA 4MW1A 4CN9A 4EHKA 3EGOA 2UZ4A 1ZOSA 3I01A 4U2FA 1GG2A 1XRQA 3LK7A 1VE3A 3HTXA 4TYWA 1TGVA 1ZW6A 4E6PA 3NHMA 2XWJI 1L4GA 3S40A 3VH3A 1J8MF 4DUGD 2MR6A 3KYBA 1DVRA 1PGOA 3PTAA 3DOIA 1P9RA 5IC4A 1PSDA 1K5DA 3L4EA 4DMMA 3RT9A 2HYDA 4LX8A 2P0EA 3WFIA 1G5IA 5ELXA 2JGAA 1R5OA 2HB6A 1T5HX 3O1IC 1VDZA 1NUTA 3L8CA 3ZCXA 4JJFA 2V58A 3A1EA 3ESYA 4LZAA 5AJWA 3ZZUA 1P7CA 1P17A 1C3OA 3NM5A 3WWPA 3AV3A 4QU0A 2YHUA 4UHCA 5LKRA 5J2TA 1NLZA 1YA8A 1QHEA 2Z2KA 3KQOA 1GRCA 1LVHA 2D7DA 3WOVA 2WBLC 4QJBA 2W2PA 5DM70 2Z08A 2YMLA 3CNEA 1W44A 2OCIA 4RMHA 1B16A 3RBZA 2JJ2A 2PGJA 3I09A 3CX3A 3RASA 4M1TA 1Y6RA 3PRKE 5TXGA 3WBKA 2VHEA 2WICA 2G07A 3BPSA 5KPDA 5B1IA 4Z9FA 3DHWC 3LD9A 2B35A 3V48A 1PQUA 3TEFA 2NSYA 4MP6A 2A84A 5AM4A 2I1WA 5I9MA 1N0WA 2ZJ0A 4CUJA 1TYBE 1RHKA 4N9QA 3PXUA 4U7PB 3WX0A 5JXWA 2AW3A 3PE4A 2QMEA 4ZCSA 4PU0A 1GPMA 1SKYB 1RWXA 1MO3A 1PQPA 4DADA 4Q7QA 2B2NA 1AQJA 3AFNA 4U2KA 2A9FA 2VDWB 4D82A 1LBQA 1W5TA 3ZIUA 4NPAA 3V1MA 3AW9A 3DA8A 5BWNA 2E0IA 3L8ZA 3G3EA 2ONYA 3UEOA 3OIWA 3U1VA 3GXOA 4B9EA 2O5CA 1KK3A 5IWCA 1D07A 3K8ZA 1CQJB 1F0PA 1TM7E 3LPLA 4B0OA 4EHLA 1I3CA 3HDYA 1LXCA 2ZJ7A 4TUYA 3UWMA 2BZ0A 2P4QA 1FB5A 4DYHA 2AEMA 2MTBA 1DKLA 1MXFA 4DIOA 1CDEA 1E5XA 1JKXA 3KOUA 3ZW9A 3AHHA 1LK5A 3I76A 5JARA 5TMPA 4LJSA 2BBOA 1SUPA 2BHSA 3H0EA 3LUJA 4LV8B 3I4LA 3SHQA 3OQHA 4FMDB 4ZZIA 1A8PA 5ARBA 3VC3A 2JEZA 1J8DA 1XQYA 3BGSA 1SD2A 4BV8A 1UFQA 4WY2A 4LJRA 3PDIA 5A7FA 4KQIA 1N33B 4I1PA 1FW6A 1LGYA 3JD0A 3ED5A 3RUCA 4MI1A 5DIZA 2JFOA 2JHGA 3CR7A 2A9OA 4UXJA 4BQNA 4DDVA 1D0VA 2ZSUA 4BP1A 2IODA 3SR4A 3HR8A 3CNBA 5ADHA 2JLAA 3CSUA 4PSCA 1GGFA 2B94A 3JTMA 2B4YA 1AM4D 2GBIA 4LUCA 3GFVA 3VBCA 4G4SO 1TQ4A 3UJ3X 2Q49A 3SYMA 1DRUA 1SJ9A 4KR3A 1WS6A 1C29B 2YRWA 3ENZA 2NTVA 5KCMA 5IZ4A 3OPNA 3WK6A 1N36B 2DHDA 4IIGA 1V4BA 1Y7PA 3O4FA 2R2GA 4B2LA 5IKMA 2CXPA 3MS2A 3IBFA 1ZCFA 3WB9A 5AIAA 2I1LA 2OB2A 2XMPA 3F5DA 3ZZTA 4TSFA 1QS0B 3QTBA 2BFBA 2NO0A 2G76A 2RAPA 1BEEA 3BE6A 3R7BA 5JH7A 3KQWA 4LF5B 1XF9A 2B92A 2KYRA 4ZOLF 1FE8A 4Z49A 4I36A 1U11A 3RWBA 3FCYA 1I2AA 2BAGA 1DPFA 2P78A 4FJ0A 2W70A 4BQIA 4TQUS 4KFRA 4M49A 4DA7A 2QZZA 2VFAA 3FTCA 3GELA 5TF0A 1KAGA 3IP7A 1RBZA 4FGJA 5EWJA 4RBNA 3SMQA 1W94A 4BB5A 5B55A 2KBEA 4LVNA 4UBKA 4MWSA 1RU3A 5IUKC 2OM6A 1JYFA 4ANFA 4XYLA 4EKEA 1KDOA 1ZIYA 1JTVA 3BHNA 3EG5A 1G41A 3I72A 3WDMA 4Z7NB 1OFGA 1PHRA 3FOZA 3ECCA 3P20A 4CDRA 1SCNE 3TX2A 1IDOA 2OMKA 5BN1A 4JBIA 3EMKA 3D6MA 3P9QA 3MG9A 4RHTA 5BVHB 3KQKA 1JSCA 4E2XA 3RR2A 1Y9ZA 2J4CA 4FB5A 1Y6QA 1PQYA 5A2QA 5HFNA 3BK7A 1NA5A 4GX1A 1R0WA 2QW8A 4Z51A 1ZH6A 4W5QA 1NNLA 4P3XA 2QUJA 3WLQA 5FP0A 4MW0A 2Q3JA 2R7NA 3BD7A 3MWJA 2PDAA 5ENZA 4BRWA 4C4YA 4JLVA 4B5KA 3PIIA 1RRPA 3ETEA 4IUBS 2E4ZA 2VP2A 3OPVA 2FP3A 4RJIA 5KYYA 3JPWA 2ZREA 1K66A 1JAZA 1JR2A 4HAXA 4KRYA 1CEYA 5KC8A 4HGRA 1ZU4A 5E1DA 4DE5A 5MFPA 4E30A 4H7EA 1F12A 5BSRA 1M6YA 2FB9A 3PL5A 5CLFA 4X00A 4W99A 3WYDA 4XKJA 2DBVO 1KZYC 3EGVA 5GGXA 5F9FA 1D4FA 3U39A 4UVHA 2JJ1A 4J4TA 1K3FA 2GGSA 1P8AA 4GUAA 4L4YA 2A1UA 4BGIA 3BFVA 4OI2A 4GKJB 4QDTA 2XJ9A 4W1SA 2MSEB 5E7QA 3UMSA 1I0ZA 4PCLA 4QXAA 3P9YA 2GO1A 3O7MA 1Z2EA 2XT9A 5LZ8A 1YL5A 1W0CA 1VE6A 5SZJA 3P9NA 3AKYA 5A9TA 3EIEA 4EA7A 4MUBA 4MRNA 4P4UA 4UW9A 1OFIA 4ZT4A 4DNPA 2Y2UA 4ISBA 4UJ3A 3S2ZA 2HF8A 4Y1GA 4PXAA 1PU2A 3OM8A 1L7VC 3EXEB 3C4VA 1RAGA 3QVXA 5L3VA 3WLAA 2QQGA 1SKUA 4QOSA 2C7BA 3D7KA 3H16A 3LBHA 1P6QA 1NBMD 3H6HA 4H27A 3ZWOA 4RZXA 1YOVB 1FDTA 3RTDA 4EQZA 5C1OA 3M3DA 4OLAA 3HZZA 3RC2A 1CY7A 1M34A 1SR8A 1E6WA 3QE3A 3QVUA 4OHKA 1UANA 2QTAA 3AG5A 1AXGA 521PA 4I3HA 5F98A 4GM1A 5J9FA 1M1NA 3O4JA 5ALKA 4MGKR 3VTKA 5FOUA 4PR0A 1P5JA 3UC9A 4DR1B 1UPFA 1W2WB 1W59A 3R5TA 4KQ1A 4YJ2B 5EINA 3QBEA 5AOAA 4HNVA 4LQLA 3WLNA 4Z3OA 2B1IA 5A7HA 2O1XA 4IX1A 4WKOA 1BH6A 4KACA 4OHBA 5LWHA 1YB5A 4DPLA 2NW6A 4ZA2A 4DRXB 1B3BA 1RWKA 1S2NA 4J7UA 5LBTA 3QE2A 2IPXA 2G83A 2G1JA 2HRQA 3PPIA 1KY4A 1QJ4A 3RB8A 4FE7A 2B8NA 2WTEA 1QE3A 4Z4FA 3VA7A 3GGPA 5EL0A 1T0PA 3TM4A 1FFDA 4W5HA 3O8QB 1UK8A 1LK0A 3ABIA 1S96A 2B7CA 2D59A 3LZ6A 3K73O 4HLQB 4DV2B 4H6VA 1M5RA 3AJRA 3OTQA 3E7WA 3N74A 1C1DA 1HOTA 2IPMA 2HEIA 2P6UA 3IDAA 3ZCQA 3BXOA 1J42A 4J7CA 5B58T 1X70A 3T3HA 3VNRA 1I4LD 5DWDA 2AOVA 1KGDA 1CJMA 1RWPA 5AKKA 3NDRA 4G09A 3V4OA 4DOMA 2WWYA 4O0LA 2D8MA 1RLIA 1XI2A 3DAOA 5KHAA 4F04A 2H1OA 3GMIA 3I0NA 2G09A 2QE7D 3LCVB 4WCVA 5ALDA 4OREX 3HK2A 4BFYA 2WAMA 4D92A 4EFNA 4WLEA 2IUUA 4KQMA 2VRBA 4EJ6A 4X71A 4EO4A 4INPA 3COZA 3DE2X 1LEHA 1Q77A 1K7SN 1YU6A 1YUNA 3PNMA 3RTEA 1RAHA 1ZNWA 2XQKA 4E5KA 4EAAA 4FFPA 5IAGA 2FXIA 2C2KA 2LXNA 2QJFA 2R85A 2QMQA 4P83A 4DBVO 4F2GA 4ZK6A 3PHLA 2POQX 3RT7A 5KSZA 2KS6A 5SZIA 5K5EA 4IIFA 2JI6A 4JU9A 4RVSA 4W1QA 3VFDA 1C3XA 2BFAA 3KB8A 4TTQA 2H0RA 4OMFG 1EHIA 1R4NA 2EX0A 3GLIA 4MUEA 2F90A 3TKAA 1SO8A 4FGLA 3QUTA 4FLEA 1SBYA 3RSOA 3MK31 4RIEA 4DT1B 3L7CA 3T3IA 2F9FA 3PEVA 3RAJA 1JHPA 2Z3VA 3Q5DA 3RYCB 3OU6A 1Y7LA 1DXQA 4I6EA 3KEMA 1SUWA 2IHYA 3WTBA 4LNAA 1QCZA 3PI7A 5JSZA 5FRDA 3OP4A 4L0DA 3SZGA 1V3UA 3KUKA 2Y1WA 1CR1A 1P74A 3ZKAA 5D7BA 4HN9A 4EJ0A 1HQDA 1Z5UA 1WUYA 2H4XA 5AK4A 4KBFA 4AWXA 3GQBA 1IHXA 2NSJA 1S8AA 1SKQA 1GKYA 1OT3A 4BVKA 3QEMB 2WF5A 4XYGA 1FQOA 3FVVA 3FMVA 2ZRFA 2W0SA 4M1WA 4ZOCA 4D3FA 1BOFA 2Q0SA 1PEYA 2Z98A 3NDBB 4CLOB 5FLXA 3NVDA 3EASA 4WIAA 1RZVA 5JD3A 1T0UA 3B6ZA 4IZOA 3SC3A 4EY3A 4CQNA 2I4MA 1OMOA 8ATCA 2Q0HA 5CU7A 1PX2A 2XGMA 1O9BA 1XWFA 2QM8A 2X8BA 2E82A 4XA8A 3JWGA 4AY5A 4RTMA 2E87A 1YZTA 3PUVA 1BG6A 4KYIB 4ALMA 4OLHA 2WABA 1QR2A 3UWKA 4AXXA 2R6AA 4HDKB 3AHGA 4TLBA 1D1QA 1V7PC 2QN6A 4I9FA 2RHDA 4UM8B 4C0SA 1G64A 5LXTF 3AUKA 1LK7A 2HJ9A 3QJYA 4UJ5A 1EK2A 2C9DA 4YREA 2A35A 3K5PA 2MSNA 4X92A 3AX6A 1S1CA 3S81A 3EXIA 1D8AA 3E35A 3EEBA 2C78A 2MJLA 1Q0LA 4EG3A 4FMDF 3LZDA 2J9YB 2Z6QA 4WFJA 5JBIA 1PR6A 2WJGA 3WRYA 1EWKA 2ENUA 5JLJA 2CYCA 5J1SB 2QPLA 1NVTA 2ZRLA 4XIJA 2K7FA 1K5HA 1NQTA 3B3QA 5FR2A 1FFYA 5JH7B 3B38A 1H1LA 3AM4A 2PRSA 1BS1A 3HYSA 1G291 1RIIA 4RVCA 3MFYA 5B2ZA 2J3IA 4J7XA 4P36A 2AYZA 1R8XA 1E79A 1XRLA 1XNRB 3V7YA 3CH6A 4XDZA 1Z13A 1KDZA 2QZSA 1GTRA 4YJGB 4ND2A 1TEVA 1YXMA 2E6UX 1VJ0A 2ZU6A 3K2EA 5H68A 3HCPA 1LLUA 4K9QA 3HY4A 1Y3FE 4EUHA 4KXWA 2J8ZA 5K8IA 2JIDA 4TV9A 1P7YA 1Q16A 3HC7A 4CF5A 1UBKS 1MTOA 2DQYA 3B1ZA 4ZODA 1NVFA 1V1MB 4M9QA 1YI1A 1ZD8A 1ZITA 3GCWA 4O1IA 3D0RA 3O7WA 1RJDA 3PR1A 1DBVO 3KQYA 3EZ9A 4G63A 5CLIA 4AS3A 4CWAA 4X95A 4XVCA 5JEDA 1S01A 4QREA 2ZTSA 4FXOA 4C4TA 4DV1B 4N7BA 3TEMA 2QM0A 4NCJA 4LZJA 1QPZA 2P2GA 4Q3KA 4WNIA 2X13A 4RVDA 2QXTA 3P5BA 5G40A 3WV4A 1M2FA 3T5MA 1JECA 2HSJA 3A06A 2COUA 2OWEA 2R3SA 1U7TA 1V5WA 1I9GA 5HW0A 3CUTA 4C4ZA 2VF4X 3BAZA 1Y3HA 1FNCA 1MMFB 1YZLA 2CY0A 1XYVA 2HUPA 2M9MA 1RJ9A 1AKMA 2P5YA 2ZWAA 3AI3A 3KYIB 3NCHA 2YXNA 3ORQA 5KI6A 2EX1A 3VUEA 1GQSA 3GLTA 3IT2A 4IQ8A 4YRGA 2O2DA 1WHSA 1RZRD 4LK3A 1NR7A 1YZNA 2IYXA 1TIBA 3TW8B 4PAWA 4NCXA 3SHOA 3O26A 4B45A 1UBEA 1B2LA 2YHSA 4GRDA 1KDVA 1DQNA 4DB2A 3ZEIA 2B7LA 5BV0A 1C9EA 4Y6GB 3U49A 4MVJH 1SXIA 2CKMA 2ADMA 4G8DA 1HE1C 1NJ8A 5DF1A 4ZC1A 4WGGA 2A1UB 3K9FC 3DVLA 1R4MA 5B3AA 1YFJA 2D3WA 3QWIA 2QRJA 2NVUA 2D74A 1DJLA 4BTVA 3GFQA 5CAEB 4G0VA 4PGHA 1E9RA 3ER8A 4WLFA 1QXSA 1I80A 5JZBA 3H1AA 1S8NA 4B87A 2I34A 3N6RA 1P45A 2AFHA 2GD1O 5HYVA 1FVOA 5G02A 4AJ1A 1YZYA 1SXJA 4OM8A 3OF3A 3CT4A 4BPRA 1NR5A 3ODPA 1TTTA 2J0QA 4G0XA 1XZKA 3C3EA 4KW7A 3U4AA 1ETHA 3UKOA 2AMYA 3WKDA 5HS4A 1QIEA 2QG4A 5ALUA 5HCUA 4AKIA 2BUBA 2R4TA 3NVAA 3ED1A 2ATXA 3TLJA 4G85A 1IAQA 4RTLA 2P9FA 1OU0A 3FUXA 4RK5A 3AR6A 2AZMA 1AHIA 1IMOA 3DL4A 5B1EA 1I14A 3Q87B 2PVCA 3EIXA 4H7IA 5JJIA 4NZMA 1U3WA 4ZC8A 4P0TA 3HVJA 3RVOA 1TMKA 2HC9A 5MGBA 1AQYA 2BFMA 3ZCVA 1YJQA 4DCOA 1MXHA 5ESXA 1DHRA 3ZDFA 1IWPB 2Y3IA 4MR7A 4Z0HO 4CL8A 2JCYA 1FQKA 3D8SA 4P3PA 1G8JA 1YE5A 5ENVA 4HT3B 4G9EA 4RGBA 4CM4B 1E7SA 1IHUA 1II8B 2JC3A 4DLAA 3I2KA 3Q5GA 3U3JA 4DIKA 1FNNA 1WUIS 2RAFA 2PV0A 3GFFA 3MINA 4MS1A 3GH3A 1Q6ZA 4U02A 1X3LA 2V7VA 4EPVA 4CLHA 5HRUA 3I5YA 1E2FA 2WTXA 3F67A 1KIAA 1A2BA 1T4DA 3Q7EA 2F7SA 5P21A 1LI5A 3IEVA 1MJHA 4DRZA 3JRNA 4FYYA 1NU6A 2W90A 2WHQA 4ZEXA 4YXWA 4C0WA 5HBRA 1AKQA 2PLFA 3ABZA 2VDQB 5BY2A 2B5WA 1RCTE 5K6AA 1N2SA 1D2RA 2H1LA 2QMYA 4ITVA 5CIWA 3RHSA 3ZWCA 1GXSA 5FUYA 4YIHA 3A6DA 1G19A 1WDMA 2CLMB 2GTPA 2Q9AA 1NVMB 4I4CA 5FUBA 3TOSA 1NMYA 1BE6A 1XQWA 4NIMA 4ZPJA 5CCBA 1E7WA 3WO1A 4DLLA 1EE2A 1E0KA 3ET4A 1AKNA 1ENYA 2CJYA 2L2QA 2M98A 3CT6A 3C1AA 3Q15C 3T61A 5C37A 3M6XA 2ZI7A 5HEKA 3C7AA 1USVA 2UXDB 3QUQA 2FW8A 4ZQCB 3TG2A 5JAZA 1PJBA 1GQOA 4BS9A 5NLLA 1YNOA 4HXFB 3R7FA 1CQZA 3B48A 1C14A 3EDMA 3TI7A 4IYJA 5AVRA 1VL1A 1Y9DA 2P62A 3IP3A 4KEAA 2XX3A 1HZZC 2YY5A 3E70C 3NBMA 3OY2A 4FD3A 4J0CA 2VWPA 4KMOA 4D9NA 1JFRA 5CLJA 2Z3ZA 1AUQA 4BDTA 1NMXA 1U0OC 3GN1A 4YROA 1B0UA 1ZI9A 3VR1A 2F3PA 3UC5A 4LCEA 1AMUA 1YGPA 4NBRA 2RGYA 5E8RA 4FMBB 1JN0A 3FG9A 4MARA 4JLJA 2IX3A 1WPQA 5HKKD 4LYYA 5A0TA 1A5TA 2Q7OE 5CA0F 4YAGA 3K1AA 3RUPA 4DY6A 1LD3A 1VMKA 5C34B 1T26A 4IH4A 1DCTA 4NWIA 4CI0B 2V3CC 3REOA 2PGDA 3GRKA 5IZCC 2WUEA 2JIRA 3FPHA 4ZKDA 3H5IA 3LQFA 2PL9A 3LPCA 2G0TA 2ECOA 1IY1A 4RJLA 4AJNA 1AKWA 4PXSA 5IEJA 1TU3A 2PBZA 3KQPA 5HUQA 3FMPB 1XA0A 1HT1E 1D0IA 1DAMA 1J9GA 4W9NA 1OLXB 5HOEA 1VHDA 3D2CA 3U1BA 1JHMA 1GAQA 2ZBUA 2N9UA 1I7NA 3ZWQA 2IY9A 4DLVA 4YMTA 2C00A 1NPDA 2LVBA 4R6XA 1N9GA 1JLRA 1ZNXA 2O48X 3DEYX 3TNDA 3QVOA 2AT1A 1OY1A 4K6OA 1P5HA 3U3RA 3W8RA 4H0FA 1ZX1A 9MHTA 2YJ5A 1QQ6A 4L2IA 2UZ3A 5HZHA 1P44A 5C8YB 4P4SA 3MTQA 1T1RA 3KQVA 4FR0A 1CS0A 1A2KC 1A9XB 2PBLA 1M8FA 3G85A 3UFXB 3L1VA 1PDVA 2ORYA 3NUQA 1DINA 3EE6A 2W83A 3CZ5A 2WIKA 3WWDA 4ALIA 1Y3BE 5KOHA 3AP1A 4IGEA 2JFXA 2P9TA 3LX6A 2NTEA 1W5SA 3BIFA 3CLVA 4CM9D 5IJXA 4CIXA 4NBTA 3BWYA 4OP2A 1TQ8A 3OM1A 5ICGA 1XQVA 1J06A 1R00A 1XJ5A 4DDKA 4QU5A 3CVJA 3VI4B 4LF8B 1FCJA 3C41J 1M34E 2WE8A 1T1IA 3BH7A 1PAUA 4HYEA 1JEYA 4CIDA 1I4OA 5DZSA 5EWMB 4AJHA 4JX8A 4OCZA 4AB1A 1JFSA 4AQ7A 2IBSA 1BFKA 1SKYE 2OGTA 3ZWYA 4YJGA 3NX4A 1FTNA 2AOUA 3A32A 5CD9A 4N6GA 2G08A 4GSKA 4EY6A 2VF5X 3DLPX 2FQ1A 3N5KA 4X41A 1KC3A 2J5QA 1NFRA 2ZQZA 4N3CA 3THYA 3WGIA 4RO0A 6ABPA 1ECBA 2C94A 4XIFA 5A4IS 5I4CA 3G8CA 1PJLA 2GJ9A 4J9UE 3OAAA 5ILQA 1G21B 3SYLA 4ND1A 4DHEA 4PSAA 3PDIB 5CVCA 4KPEC 3LE8A 2V7XA 4NR0A 4TMVA 3K1JA 5DFAA 3LCRA 1Y1RA 3QX9A 3JQQA 4G0MA 4LC0A 5CYOA 3SSOA 3RTCA 1E2PA 4GKVA 4YQFA 4EENA 2KHZA 4FZRA 5E0OA 1MVOA 4FXPA 2IF0A 5AVJA 2UYQA 2NUTB 3DO6A 4JBGA 4ARBA 1TJNA 2ZXFA 4B40A 3V7UA 5IDYA 1E3DA 3ADDA 2OBMA 4W5OA 3EVGA 1GPYA 3P27A 5L4LA 1JDNA 2XXAA 4ZOQI 3C6KA 3CIFA 2W22A 5EJFA 4PZPA 1DC8A 4C3OB 2DE0X 1ISFA 3NNSA 1POXA 3GZTB 4GR4A 4K6MA 4C0QC 1T4MA 3GD7A 4LHVA 4HQRA 4B8WA 2HRZA 3QQPA 5DN6A 1TC1A 2ZTVA 1I94B 3FPKA 2YUIA 2AMJA 1LDBA 1NDQA 3DMDA 3UIEA 1DHTA 4AMVA 4HH3C 4WOPA 2XB9A 4W7HA 1LRKA 5JEEA 5FOWA 2P9EA 1U2ZA 4I4TA 4FZJA 4UZFA 4Y2XA 1I10A 4KQCA 2DJIA 7ABPA 1V6CA 5KQRA 4RULA 1FNDA 1R0YA 2C3OA 4L5YA 2R87A 3JAKB 3DLBA 2HWWA 1I3MA 2TMDA 1XBTA 2KJQA 4JYCA 4HAUA 3BWCA 2O05A 4TMZA 5K3CA 1BMFA 1L9XA 2DWQA 4OAQA 3T7KA 1T2FA 1Y1TA 3WMGA 1X1EA 4L57A 3IUMA 2AHOA 2YFYA 3K0AA 1KFCB 4NBLA 2WV7A 3ME5A 5T41A 1JEQA 3FIUA 3NYWA 2CHVA 4CLEA 3AJDA 4LRQA 3GLIE 3BEOA 5CHYA 3ZU3A 4PO1A 2YXEA 2DKOA 3RYTC 5E9JA 1NM5C 3GLKA 4R54A 4QGGA 1RBQA 2Y1LA 5IT5A 4JCCA 4PZLA 1G2QA 1AS3A 2NZXA 4ZVPA 2L0XA 2C2MA 1SWWA 3QBTA 2ZGVA 3ZUGA 1O0BA 4O4JF 4J3NA 1VLZA 2D5IA 3CN9A 3MTEA 4UATA 3I2YX 1QWOA 3DMTC 3EW9A 4NV3A 2HJGA 1PFWA 3WB0A 4Q4AA 2JEOA 2Z8ZA 5K3DA 3V55A 3NBAA 4FFWA 1JBKA 1F2UA 1YDHA 2GCGA 4D0SA 4EFMA 4JC0A 3E1KA 3UHJA 4LISA 4F3KA 2GLXA 2G67A 1KJWA 4IDGA 3HFGA 5FO1A 3H5NA 3RRBA 2V7UA 1SHJA 1LWNA 2HIGA 2RGAA 3OIUA 3GUUA 3F49S 3MJSA 5CX4A 2VDNB 2FN4A 4WCFA 3IR6A 5AI8A 4DWJA 1VPVA 2RGRA 4WBNF 1JHVA 3OLZA 4R16A 4CV0A 2FWMX 2PSEA 5I9BA 4KTTE 5JC1A 4GG1A 4U00A 1GNQA 3FHTA 2EV9A 2GZ1A 2J9FA 2IYUA 3R20A 1B0AA 3DCIA 4G6ZA 3CX8A 2EP7A 3HNPA 3IAS6 1FSGA 3KJZA 1T2VA 4N7MA 4MZDA 3RVJA 5A4DA 5TT0A 2PKYX 2Q6KA 4YDSA 1D6SA 1SXHA 3TRFA 3AVOA 5TY0A 3H1GA 3X1ZA 2AZDA 2QP4A 5KYGA 1HR0B 3SBDA 2BRUA 1O58A 1RYHA 4KP7A 3F0TA 3ZHOA 5CTAA 4JR2A 5AXBA 1PJ4A 3IAHA 3QOWA 4A8JB 4E03A 3OOSA 4Q1CA 4GKKB 4MS3A 5BYBA 5EHXA 2OCLA 1VHLA 1FZQA 4IGAA 5DOVA 1ZKDA 4Q4JA 2VYFA 4L6AA 3NHAA 1F7UA 4EB8A 3U17A 1FP1D 1FDIA 2I29A 4RTQA 4LY9A 1JTEA 1SVLA 5JAPA 2V3WA 1QZ3A 3DTYA 2ISSD 4HN4B 4I19A 3IP5A 2BZ1A 3ZHQA 4F6CA 2HWXA 1HWYA 3DTVD 2WKPA 4R9SA 3SXJA 2X9QA 5C5CA 1RI4A 4CF3A 5FORA 4GM4A 4BEVA 2H1WA 4FNAA 4WAUA 4AZ0A 3L4KA 4DUYB 2AVNA 4LVCA 3EZFA 1KI1A 4YN3A 1YI0A 2BEKA 2IY8A 4BLOA 4F2PA 4ZJZA 2V4MA 2N1MA 4JLUA 1Y6ZA 1XTUA 5HMLA 1L5QA 4BMSA 3JY6A 1SBZA 3V4RA 1XCPA 1PLJA 1Q1ZA 1US8B 3ICVA 2Z2JA 3PI6A 3LCCA 9LDBA 3K70B 3PBKA 1OYVA 2CFCA 4I46A 4X1YB 2GPYA 3FKSD 4NV1A 3OPMA 4E3WA 3M6WA 1WNFA 2WMYA 3ISJA 1MO2A 1DX4A 1U3GA 3OPYI 4RHYA 5C1BA 2ZAIA 2QNIA 1XRRA 2I62A 2YWXA 3BERA 3IBCA 4IRXA 4L22A 4QUKA 4I7EA 4W7SA 2FOIA 4ZOBA 5JATA 2VRNA 3AKEA 3JQGA 4JLOA 2NYAA 3OFJA 4WLUA 5EAIA 3EPLA 3SE7A 3WIUA 1E0AA 1M1YA 1ULZA 1CJVC 4JL6A 2JRLA 1E2HA 3QSYA 1ZISA 2JVIA 3CU5A 4TTPA 2YYYA 4NFSA 4PAGA 3R8XA 4XQ0A 5JWOA 3BT7A 1UK9A 1J6UA 1CUYA 1L4FA 2G6TA 4ILKA 4R05A 4DIFA 1MOSA 3VYUB 3TZLA 9LDTA 1G9XA 3ACCA 3MAAC 4WNCA 4WEOA 2A59A 4Q19A 5A9SA 5ADVA 4HMQA 2IQIA 3BD8A 4J1TA 1JLKA 4K1LA 3ECSA 3GB9A 3IIIA 2LP4Y 2JD0A 3S7TA 1K9SA 3LKVA 1KF0A 1Z5WA 2FCRA 3RFTA 3RRYA 3DHNA 3W5VA 4C1BA 3KZMA 3L6EA 4GOJA 3C6XA 4HFRA 4JJIA 1NW9B 2PYDA 3CLTC 1QUFA 3DH0A 1UOEA 2JI4A 5HJ2A 3HADA 1OGJA 3FY4A 3HWSA 4DCSA 1W2HA 2FZVA 2GZMA 2R4QA 4F97A 1PYGA 1R8YA 1CB0A 3A27A 4Q4HA 3GLFB 4Y7DA 3V2GA 2XA9A 2ZBGA 2NUTA 3PVCA 1X9HA 4ZCIA 4HADA 3TRDA 2ALJA 2QU7A 5ECWA 1SBNE 2FWPA 4R01A 4AKGA 1RXCA 4P08A 3NTOA 5A4KA 2DG2A 4Q4LA 1P3JA 3FLAA 3OCXA 5I5GA 2Q2OA 1UAYA 2JFYA 3CZQA 1JKFA 1G16A 2JASA 1J8QA 1ZEMA 2CBGA 2X0KA 3DWEX 1SZDA 4NZZA 5BVGB 3THWB 2WJVA 3GLVA 2V6JA 5EZQA 2HPVA 3P2KA 4UDOA 3N9IA 1Y7HA 2OZVA 1XL0A 3C1OA 3ZY6A 3HDGA 3IO5A 3L7LA 2DB3A 1Y98A 1YJAA 1COWD 3O2NA 2JLUA 5U9CA 4FW8A 2V59A 4JYMA 4LC1A 2SCUB 1BWRA 2Y1GA 3DV0A 4DZRA 1P81A 1T5BA 2IXFA 2OGUA 4ENWA 2WIJA 1ZQ1A 1MZPA 2XVYA 1OWOA 4WESA 2XVXA 5B57C 1CF9A 3TE6A 4GMXA 4F1JA 5H8WA 2O8DA 3W2IA 1S7GA 3NANA 2BGKA 3SR3A 2QL7A 4JELA 5LQNA 4TUYB 2YH2A 1RJWA 1RWWA 1UC5B 1ZMXA 2E5FA 1T10A 2OVBA 1G5FA 1AUXA 2AC4A 3LI2A 1JDUA 3P0JA 2P68A 4ZOAA 5G4LA 1YCHA 1F20A 4I5FA 3ROQA 3WKCA 1SXJE 5H9VA 2WC1A 1N5RA 3TN7A 2VHTA 3IGFA 1WSAA 4W5RA 3FZEA 1AUPA 2C3PA 3UPDA 3PQ8A 4C7MA 4HRVA 4FFRA 5E1BA 1BVUA 1F4LA 4XTRA 1KO8A 4C04A 1TC2A 5DMXA 2AJBA 1NLYA 5EMKA 2NP7A 2H06A 1KA9H 4KTVE 4QFBA 2WVHA 4ARCA 1HYHA 2NO1A 1ZZGA 1V9LA 3ETDA 4WLNA 1WWKA 1G3MA 3JASB 3QPVA 3R9WA 1C4OA 1CT9A 2EQ5A 1VKZA 2IYLD 2NM0A 3IPLA 3OE7D 4GXRA 5CG2A 3L46A 4WCFC 1VLHA 4MUFA 4LXQA 5F78A 5HRCA 3QENA 4B31A 4DV5B 4ZHSA 1ILWA 1KXZA 3SX4A 5TC4A 1UMDA 1LTKA 1MR3F 5TNXA 3B5JA 1CHNA 4OHZA 1XALA 2XNCA 3DVQX 5ENDA 3ZX5A 2VHCA 1E8MA 5AK0A 2J67A 1E4EA 1MB9A 3ZZ1A 1OBOA 3KE8A 4GMKA 1E60A 1Y5NA 3MT8A 1JWAB 3O8OA 3D2LA 1S02A 2H92A 4J49A 2G72A 2QI9F 4L3WA 2XYRA 4U2CA 2E37A 1UDWA 3OFVA 4R1NA 5DGDA 3ZH9B 5D2CA 2VXBA 4WH0A 1YOBA 1KTVA 3E81A 3LDHA 1N4DA 5DM60 5JYDA 3R9XA 4AROA 2G5PA 1YQGA 4H35A 1QZTA 4GYWA 4KYTA 4K9DA 3OC6A 3HBAA 3PUWA 4MVJM 2I2CA 4RK6A 2CL5A 1THZA 2JFVA 1U81A 1LPBB 4P34A 4DYVA 1E6UA 1G8FA 1PR3A 3IAUA 1C7QA 3CVYA 4YT5A 2DFVA 1ONOA 2AI3A 3WS7A 3GT3A 4YIKA 4UNRA 3TTYA 1ODLA 3B6JA 1DB3A 3NHLA 3QLVA 4N6OA 3T7JA 3V80A 3U4QA 1PJQA 3RS4A 4KH1A 2FN8A 1Z06A 2GYVA 5HJEA 5BYJA 1NJ6A 1UZLA 1WXDA 4J91A 5K6TA 3M5DA 1OTHA 1R4ZA 2WM2A 3PPWA 1G7TA 4CU5A 5K05A 1FSPA 4IQGA 4OQFA 4PYMA 1K92A 2JFFA 3IEKA 2C61A 3TLBA 1F1BA 1XZQA 2CNLA 4ETWA 4LNUA 2B1RA 2XVZA 4GLBA 4Q4JB 3W3AA 5KVCA 1TL7C 4E5PA 4KG7A 3PPXA 1W8IA 5F64A 5JUWA 4C6RA 3ND7A 3NAGA 5AH0A 2OV2A 4YACA 3INTA 2XB4A 1RJEA 4ZVLA 3R4VA 3VU1A 1L7OA 1UBHS 2QHXA 2QJRA 2WUVA 2ZT5A 4MKIA 4XQEA 2WA1A 5ALQA 1A4IA 4ZV9A 1I2DA 1U9IC 3HP7A 2WJAA 5CYGA 1N7JA 4XVQA 2P69A 4PX5A 3SHVA 4DARA 1WDWB 2VNAA 2OOKA 4Q15A 5K0LA 4QECA 2FJ0A 1WY7A 5DRTA 3U7QA 2QTLA 2ISCA 1MIOA 3J81A 4LCBA 3QU9A 2P75A 2Q1SA 1JMVA 1P9NA 2OHVA 3GJZA 5T5QA 4BLUA 1NYRA 3HJGA 4HFMA 4AZWA 2NV2B 3ZWDA 2WSIA 3GLRA 3G1UA 4OJTA 3UOWA 1H23A 4ZQEA 3IA2A 4PSKA 2EYUA 3JD2A 1FRVA 1FMLA 2CZCA 4BB0A 4CRWB 1PVVA 1L3CA 3PQ3A 1NHWA 2NPOA 4MGZR 1DELA 3LECA 3IPRA 5DK4A 2RGNA 3IP6A 3JALA 2BHLA 1LSOA 1WPRA 3ZDYB 1AD2A 2FMUA 4IP0A 4RHEA 2J6CA 2VJNA 5HS6A 3EG9B 1JJBA 5F52A 3SHFA 4DCGA 1BDIA 3DT9A 3BFKA 4TGLA 3ERCA 5L51A 1ZQ9A 1RPJA 3OE7A 1ADFA 3F90A 1CZOA 2XMQA 2VA9A 3VH1A 5LU9A 3FGOA 1C7ZA 1A5SB 2GEJA 4KR6A 2NZ8A 4O1HA 2BISA 1RP7A 2W2QA 4JI1B 1X94A 4L5BA 2IS1A 1KZ6A 1RWOA 3K5WA 3WA7A 4CF6A 4RWZA 3VHRA 2TMKA 2QM7A 4BGUA 1BX1A 1XZGA 3GUZA 2W6JA 1ECLA 1YJCA 3OZBA 2FSIA 4HEA1 3FDFA 3T7SA 5FOVA 5AKGA 4OHUA 3OA2A 1ZD5A 3AJEA 4FUQA 5FWAA 3KJFA 2WF7A 2ODWA 3N2IA 1DKMA 1QYWA 2FWAA 1PFKA 4TMWA 4TLMB 1R9GA 2B5VA 3LBAA 2O5VA 3OM0A 1N9KA 2PG3A 2ZR8A 3EY4A 3OFKA 4MHOA 4EYOA 4WSOA 2ZBEA 1PWYE 1GYPA 1PUIA 4G0UA 3F2IA 4FM9A 3VJMA 3NATA 1WQ1R 4UFPA 4KITB 2VYNA 2CXRA 4KVGA 5A1JA 3TH5A 1UFOA 4D56A 4DWOA 1P1RA 1C0LA 2VHWA 1TDJA 1ZUNA 4I50B 4YMGA 2QTGA 1IN6A 4ZREA 3THWA 4A5SA 1TT5B 4DBZA 4UAUA 2GRUA 4PIPA 4FUTA 4NBWA 1CF2O 1K4YA 1WULS 1YZQA 3QG1A 1ZW1A 4M0UA 1ZHOA 1O5TA 2RI6A 4BE4A 2IH5A 3JVIA 2W8BB 3LWBA 3NGLA 4LJ8A 2J45A 1XPOA 1S89A 4HV4A 4NJOA 4YRIA 2PMFA 5DVZA 5IC5A 2IOHA 4Q4HB 1IDN1 3KQMA 1Q3KA 4AO7A 4XWWA 2X42A 4FJ1A 4NENA 13PKA 3Q9SA 4UMVA 5IVHA 4FFBB 1ZNZA 5AM0A 1EXNA 4XCQA 2X77A 3FPLA 1JKJA 1XMSA 2H4FA 3OLWA 3NAQA 3COPA 3M3HA 4ZRNA 5L4NA 5DO9A 4XI9A 3DFZA 5AKJA 1SUCA 1Z5OA 2V0CA 1ZCZA 4OQMA 1PR4A 3O4RA 2IW3A 5DTRA 1U63A 3CS3A 3KVOA 5JAHA 5C4IA 1AQUA 5B64A 2WWVD 1OPXA 4QVGA 3M6UA 2YBEA 1M6HA 4FGUA 3KWMA 1SOUA 2FKAA 5LBUA 6Q21A 3CINA 1HT2E 1XMPA 2I66A 2XPCA 3AWDA 3B5IA 3LO5A 4JZKA 2C42A 4H0CA 3RSGA 4CI9A 4R71A 3HXQA 2J0UA 3GRAA 3O0TA 4DM7A 1GR1A 2PSDA 4PRZA 3EMBA 5CFPA 2PRIA 3K1AB 2GS9A 1G8SA 4HYYA 3H04A 5T4FA 5IWAB 1ISJA 1IY0A 4JBNA 4D1YA 1IHPA 1RYZA 1NVBA 5LYJB 2OHIA 1EVQA 2BFFA 2G4LA 2R48A 2ZUVA 3AUXA 3ZU5A 3UGQA 3ANXA 1KO7A 2XMBA 4GKAA 4HFJA 4NI5A 2IZ0A 3RUIA 2DUMA 2IZ1A 1G9SA 3I04A 5LOVB 1XVUA 2VJKA 3C5CA 3DKRA 3H4TA 3X43A 2W48A 3K1YA 3ZWAA 4AJOA 4BLVA 1PWEA 3PXDA 4H4CA 2RBKA 3E5MA 3SNKA 3OE4A 3T7TA 1IHOA 4JR1A 4NU6A 5DTIA 1EFTA 2IP1A 2OPBA 4WA7A 1B43A 4ALJA 4I1IA 2C1XA 2YHIA 3MBIA 4PQEA 5D8DA 1NRWA 3HKBA 3W7AA 3X1XA 1ECCA 2HMUA 2XNHA 2JLZA 2B37A 2PX5A 4AY3A 5A4MS 1IJKA 1NP3A 4YONB 4V2UA 5T4BA 2QZJA 2QR5A 1ZD3A 4TWRA 3K8QA 2I3GA 2NU9B 2K6GA 4AMBA 2AFVA 4TRRA 2I7VA 2R79A 4B7ZA 2ZLBA 1V1RB 2VO1A 5G0UA 2X7XA 1PQ4A 4KGDA 1NXVA 3OIDA 4H7JA 4XXHA 1FFCA 2A33A 1SK8A 2J31A 2TS1A 2VQDA 3NHSA 2Y92A 4ROSA 1JWLA 4PTYA 3SU8A 3UJDA 1EJ2A 4MP8A 2CW5A 2NU7B 3E9EA 4XOIA 3QEAZ 1L5SA 2AE1A 4L85A 4M9UA 5DCWA 3T15A 3UHFA 4YCMA 2YS6A 1V3VA 5KWJA 1XIVA 3F71A 1RACA 3JQ7B 3MTGA 3QKUA 4PYQA 4Q3EA 5AOBA 3U9TA 3HACA 1C3OB 4YAOA 5J4LA 2Z56A 3HJRA 3EYAA 2O50A 2ZWIA 5F76A 1ZSNA 1WZCA 2FJUA 3ISTA 1N2CB 3L7YA 3BMOA 3CONA 2XRYA 4QGHA 4LMAA 4P86A 5FOXA 1KYVA 5E4FA 1LQUA 1U3UA 1K6MA 4WN3A 2R96A 3KTAB 4ED9A 1SNYA 1E2DA 1VG1A 5CDSA 2FA9A 2H52A 5A1TA 7ADHA 2JIPA 1VB5A 4LHYA 3ND6A 1MA3A 1EK5A 4G8JA 4FEGA 2XVMA 4HCJA 1GYQA 3CW9A 5B1HA 4EW2A 2IYQA 2DWPA 1EIWA 4J0JA 2CMKA 3SS7X 1HDYA 4LF6B 1FPMA 3R1IA 1W0KA 3EQ2A 1XTKA 5FOTA 2ZYGA 2BR4A 1IPHA 1YJXA 3IHKA 4DR3B 5GOTA 3PQ7A 1P5RA 3RYIA 2QTRA 1WXHA 2I4IA 1E99A 4HXGA 1ELOA 2G63A 1PI3A 3ROZA 3ENVA 2G0NA 2PR7A 1ZRSA 3AOEC 4D57A 3AR3A 1USWA 3KKEA 1FFAA 2KQUA 4L15A 2QG9A 2X9LA 2X22A 1ZN7A 1N5MA 1VMAA 4RCZA 2EFGA 4Y67A 3MJDA 1SB9A 3O95A 1PNVA 4ZKEA 2HNBA 2YVQA 2G28A 3G5MA 1I4WA 1NW6A 4FMCB 5AI5A 2EHDA 4JBYA 2DPLA 1LPOA 3F5SA 4K05A 4ARAA 4QWMA 1T91A 1AE1A 4MRSA 5T64A 4D6PA 4TWJA 2PZGA 3TUJC 1UXOA 3VVCA 4N18A 4MKGA 1GXSB 4P35A 1DXOA 4IYRA 4NC9A 4N8EA 4FDTA 4OI1A 5I4KA 2ZUEA 4LE0A 2SKDA 1LI4A 4B1FA 4EUFA 4MSUA 3IFSA 3ZHBA 2RGXA 4BASA 1IOVA 3PQ4A 4YCAA 4YUXA 1Z62A 2XUZA 1XMOB 4MVJP 4L73A 3E84A 4E4YA 5EJ4A 5HJ7A 1FFEA 4CQLB 2Z5GA 2JH3A 1K4MA 3FWNA 5EZYA 4DZZA 2ABWA 2P67A 1YDWA 1R5JA 1I3LA 1XRSB 1NQVA 1GFZA 1YS6A 2H2FA 2PLWA 4GLOA 1UM8A 4KQEA 5EXDA 3UY4A 1OWLA 1JB1A 1VIYA 3OEED 2IP2A 4HB4A 3V8PA 1RLUA 2C5HA 1KDYA 4LF7B 2GXQA 1Z7GA 2QTTA 3H2IA 3Q3JB 3RUDA 2QW0X 1BQ3A 3WNZA 3BWEA 5FT9A 3N6XA 3SF0A 1W36C 2LR0A 4LPSA 2NACA 3GBVA 2UUBB 1IE3A 1E66A 4R2XA 4X8HA 3AT1A 4YQZA 2W6QA 4V0ME 1JZSA 3K35A 1QHGA 5KTKA 1XU7A 4DRXA 4TZ0A 3ADCA 2KMLA 2NX2A 5FL7D 2N75A 4B6GA 4QYIA 3LCMA 2VBIA 2IZ5A 4HLCA 1NVUQ 3BDAA 1XAIA 4Q3AA 3BJIC 2FE1A 1NUQA 1H05A 3PD7A 4J0IA 3L1UA 4XX0B 5HFAA 5F1KA 2RKOA 2A9RA 1HNWB 4S3MA 1EFCA 2WOOA 3ND5A 4DEVA 4LXIA 5BUQA 4O08A 4AJEA 3VKWA 5KNBA 1U2DC 4U7TB 5JNSA 3QG5A 4LMPA 4JLPA 4EKGA 4HBGA 1W34A 2Q8QA 3GJSA 2P77A 1WCIB 3GT4A 2VDLB 4J6EA 3QVKA 3IRUA 4R84A 2C84A 2VUSA 3EDOA 3HI4A 3SDZA 4ZAXA 4B3HA 4ZVTA 3RDPA 4PXYA 3FPAA 4TZTA 4ZOEA 1BDHA 4TXHA 2XE7A 2NXEA 5EWLA 4OB6A 2DWUA 2XNDD 4WZBA 1XNHA 4XFJA 1QIJA 3WBBA 1T6YA 3G7UA 3H8WA 3I61A 2W4MA 2IXTA 3ADBA 5FV4A 1ST3A 2O2EA 2VYQA 1ZVQA 3VOTA 1KYIA 1RI5A 3GXBA 3MW8A 1C9DB 5LIRA 1RZRA 4ZOLB 1JVSA 1KDTA 4FFBA 4YYEA 3C5EA 5D00A 4QASA 1DTSA 2IBTA 4EQ6A 2FZWA 3I6QA 2HLDD 1XZCA 3CCBA 3FNFA 3PNPA 4UCWA 2J0SA 1IEVA 1NVVR 2WKQA 3FJYA 5EWJB 4DS3A 1NI4A 4G89A 1TT7A 4Q9LA 5CA1B 3GLIB 4MUJA 1NWCA 3M5PA 1NBOA 3LSTA 4N5IX 1TUEA 4AYXA 4BC0A 2HRCA 3W5HA 3G5UA 3EISA 5DYNA 4DL9A 1DS6A 5AXAA 3KCQA 4ZVSA 4C76A 5EEHA 5CLHA 2O8BA 4BMCA 2HSGA 2HRDA 2F67A 3GLHE 3H5WA 3ESXA 1KI7A 3GDHA 4Q93A 1JU3A 3SJUA 2YHIB 3SQNA 4ZQHA 4TL6A 4ZI7B 1DX6A 2QGZA 2ZRAA 5DI9A 2XEDA 4DCCA 5C52B 3NHZA 1GU0A 1KQPA 1RP1A 1PK9A 1J2UA 1XZMA 3QGMA 4KWIA 4OQDA 3HCRA 2XUJA 1LPMA 1W75A 3PQFA 4D9EA 4U1RA 4WXHA 1CERA 2DWOA 3DZHA 1I1OA 3TLCA 1PT6A 1W9MA 2MYPA 4B0PA 4KAXA 4C5CA 4MQ6A 5AKEA 1DZ3A 2Z57A 1T35A 3PICA 1GPAA 2C2XA 5FL3A 2AEFA 5I4IA 4RDHA 3K53A 4IIHA 1G6HA 2QUZA 4AKHA 3E48A 3QPWA 2E48A 2HDOA 3ZJTA 1CP2A 5MF6A 1DBRA 4FYHA 2QP3A 1KBOA 1DCMA 2X4GA 3X1MA 2W98A 2YWBA 5FNVA 5K3AA 5JSUA 2XCSB 1XEAA 1Y0BA 2Y67A 4HXYA 1PL6A 1UDAA 5LQUA 4M9XA 4LRSB 3UJNA 4Y8VA 4RD4A 1CYEA 2ORVA 4O0MA 4PYKA 3TW0A 2E4YA 3PIRA 5F3RA 1FQWA 2YNMA 1VCNA 3B13B 1I13A 4YP6A 3FNGA 1GG5A 4UMDA 1MAHA 1Z2PX 1O9GA 4JL8A 4E22A 4UAGA 2PLRA 2PWBA 5PNTA 4WKGA 2GA9A 2XIJA 4AX8A 2EDAA 4IVRA 4ND6A 1Q3HA 4Q1AA 5K4AA 4QFCA 4FI3F 5CIQA 4J2OA 3STYA 5BVGA 1P80A 5CTJA 1QVZA 3IPAA 5T6MA 4XX1A 2REQA 4F2WA 4RTNA 1IBRA 1I0IA 3O4HA 3IILA 3ITNA 1A50B 4BX2A 3B6EA 4BKRA 1LF0A 1RXYA 4FFLA 4X6LA 3AH8A 3C87A 3ZS8A 3D59A 1RBYA 2ZANA 3ROXA 3STUA 1RABA 4KQWA 4OG2A 4UBIA 1NVXQ 3QTLA 1PGPA 4HGOA 4YGYA 5AUNB 1QQ7A 2VHQA 3ICQB 4JB2A 1Z0ZA 3DB2A 1A88A 2LD4A 2RHGB 3DOUA 4RC9A 1MAAA 4G5HA 2BPOA 5JYBA 1IN7A 1R0BA 3PRJA 1C50A 2WJIA 2Q3HA 2VNJA 3KELA 5L3ZA 2XVAA 4PQGA 1EG2A 4ZJPA 1KE2A 1Y3DE 1YA4A 5FOSA 5B4TA 4LRUA 5IM4F 3S7ZA 2JCVA 2P9CA 3UAOA 4R9VA 1U31A 3HA7A 4MPPA 4ZAVA 3WMEA 4E3ZA 1ZUWA 5J1TB 3L7DA 4RV5A 4KC0A 3WB1A 2B98A 3IT0A 4P22A 3ZHVA 2JGJA 3K4QA 1K5GA 4XGIA 3MT9A 3AEYA 3HO6A 4LECA 5CK5A 4YNBA 1GGJA 2NLOA 2F43A 4RVUA 3W2GA 4GVLA 5IH3A 2ZRHA 4GP6A 1UBMS 4RACA 3KK0A 1AXRA 1XWIA 3E4CA 5EZSA 2QYHA 3DOHA 1QFZA 4M1YA 3UJBA 3M6LA 1BMTA 2BUAA 1A5AB 3LC7O 3WXBA 3R2JA 1Z9BA 4QQRA 3RIYA 1U7WA 4F84A 1TF2A 3MYYA 1JQBA 3VOBA 1ODIA 3KHTA 1VYUA 4M0DA 5K1ZA 3DMTA 2GCOB 4OMCA 3R9IA 3ZV6A 1E20A 3R3VA 4X3PA 1GCOA 3PENA 1YVRA 2NO4A 2DBQA 5BN3A 1E1NA 3WWCA 3AR4A 1GOTA 4LHWA 1T9DA 5E1OA 2HCTA 4YMUA 1IQUA 1GNSA 1I1QB 1PSWA 3TFQA 2J9RA 5AW7A 5LP6A 1OGYA 1I6MA 4LPKA 4OM7A 4YAFA 3TLEA 3TTVA 4C5AA 1QF6A 4JB8A 3T7AA 5A3RA 1VGRA 3EIHA 4ENUA 3IERA 1BRTA 1O57A 1CIVA 2H00A 2IU3A 4M8SA 2RGBA 4IH1A 4CV3A 4ONEA 2QTVA 1QIFA 1P1FA 2W2NA 4I1SA 1YDFA 2VBGA 3EF0A 1E0SA 1CZRA 4R51A 3O83A 3FHCB 1N34B 4MIEA 1Z83A 1NJ1A 2TYSB 4CT4B 3HYCA 2OD7A 3EQ7A 2Z9DA 1TK9A 4JYAB 4WV3A 121PA 5BV8A 4LOLA 2I6TA 3L7BA 3E3LA 4I08A 4AICA 1XTTA 4ZANA 2VF7A 4OHCA 2M6LA 4DLKA 3KAPA 1DUVG 2LKCA 3BEDA 4E4TA 4WZ6A 5B2FA 2AYYA 1BA2A 2QDXA 3H75A 2ODEA 4NU8X 4UZSA 3IMKA 3LUHA 4NCIA 1ICIA 3R3JA 4F7WA 3KZKA 4WW0A 4LBZA 4P9NA 3CWQA 3QFSA 4W1RA 5ITZA 5J43A 1DG3A 3ES9A 3KLPX 3RKUA 5K6RA 2QSYA 3V42A 5K8LA 3R74A 2BY4A 1GA4A 1DQRA 1NU8A 2QROA 4N54A 1U7DA 2W6IA 3HVRA 4AS2A 2NU7A 1CY0A 2O4CA 3DQQA 3R44A 2Y1CA 3GBPA 2R6HA 2JGEA 1T8PA 1Y8QB 3PFKA 1XNGA 1VJ1A 2A5YB 2L19A 3DR3A 1XT6A 1RI1A 4FZVA 1JAHA 2IIQA 3QPAA 3RSSA 1VFPA 4P8RA 2JPDA 1PT9A 3RODA 4IIEA 1PV4A 4LK2A 3I23A 3KKLA 2ES4A 4MOWA 3RS9A 2NVBA 1YS4A 4OV6B 3EZ6A 4RD6A 5A3QA 1FUYB 4V1CA 4FZ5A 4AJ9A 1PL8A 1XZFA 1GNLA 3A3KA 4NYMR 2ZJ3A 1EGMB 3LUDA 1H1TA 3PWZA 3IEIA 1WCIA 2OXFA 3PVZA 3QLJA 1IBSA 2HT6A 3LTEA 1ISSA 4KO8A 3TCNA 5BQFA 2R8ZA 3H1TA 4RK7A 4X1KB 4B75A 1O96A 4RPLA 3HEMA 2EWVA 4GAEA 2Q3LA 3RYFB 3ETHA 1AGNA 1RC1A 1YB7A 1O8BA 5BR1A 5FWDA 4MEAA 3JYNA 1KNXA 3GO4A 3BQ9A 2HWYA 3DW3X 4ALNA 4Q7LA 2ZSJA 1EP2B 3E03A 4MB6A 4OGFA 3NHWA 2COEA 5JT1A 3A31A 4AW9A 3P2IA 3P32A 4BAZA 3W9YA 3C8DA 4XH9B 1USUA 4QRDA 4V3BA 3ICOA 3RVQA 3RKRA 3U40A 1HDRA 3AU9A 1JFFB 1JHZA 2CNWA 4PPFA 5ANRB 1Z07A 3E2MA 4MJLA 3WGKA 3ZGXA 5ALPA 5JISA 4N8DA 3W8FA 1P1IA 5BSVA 1QE5A 4JMPA 2G0AA 3QLEA 4F5ZA 4HWGA 2RHMA 3CRMA 1G55A 5DTQA 3LL4A 3ESQA 4M0EA 2FPPB 1T4CA 1EUDB 2ODQA 3B8HA 1I36A 3MSCA 5DGIA 5BSTA 3H8SA 3M83A 4HWOA 3F5FA 3KU4A 1LNSA 2ZWVA 3CLUC 4GQBA 4A2QA 3Q8KA 2IHNA 5AUQA 1F8XA 2QP9X 2R86A 3I9NA 4ND3A 3UK7A 1EK6A 1U1GA 4YDQA 4ZDWA 5IVKA 2GB4A 1AKTA 2HA3A 2PIDA 2I4NA 4J0QA 4Y6SA 2ZUTA 4F12A 5FLYA 2C8LA 1UKVY 3GQVA 4JNKA 4BBPA 3KU1A 1UEJA 3KPUA 4C03A 1Z6PA 3L02A 2FE4A 2Y2VA 1T43A 3AU8A 3AIMA 3MEQA 3FXAA 3LVFO 3DDZX 4QU8A 3RVPA 1GG9A 3KJQA 5CEEA 3CUVA 1YF3A 4NG4A 5KYWB 3KQLA 1EEHA 3ESDA 1XC7A 2JFWA 2VJPA 4FC6A 2NZJA 4CL0A 4OJMX 2X9NA 1DQYA 2WZQA 4PRLA 4RVFA 4X3OA 5AMXA 5B6JA 5CFNA 1OI4A 2AQKA 3LFTA 1BSVA 4K1XA 3QFTA 4LG1A 2FSHA 3BJZA 1VCOA 3F3SA 5BWOA 3NPAA 4URVR 1GGVA 2ZXUA 2CNKA 3ONVA 1T6NA 3BDVA 4NZYA 3UMMA 1O94C 3M6IA 4FYMA 4IIUA 3FMGA 4Y9UA 3WK8A 2B30A 3JALB 1ZHHA 2PUFA 1IQPA 2CYAA 1OTYA 2VSNA 3RS0A 3QEBZ 3RH0A 2ETVA 3EG9A 3CLRD 1Y82A 3DHVA 2DBZA 3IOCA 3BK2A 3MWLA 4PQYA 1CRZA 3DBRA 3ZHZA 2BIFA 3E18A 3SOZA 5ES3A 5CDTA 2G40A 2AXQA 5LD2C 3H1PA 4G5YA 1TMYA 2GKGA 5KQMA 4C4AA 1DO2A 1WXIA 2CDCA 1PJ2A 1JP7A 2A6PA 3K72B 3OAAD 4K9MA 3W77A 4QC2A 1KGSA 4S04A 2PJZA 2VNHA 1GNVA 3DAFA 4ER6A 3I64A 1TO2E 2X5NA 2FZLA 1QFSA 1XDBA 4S1WA 3M81A 1P2FA 5GINE 1WXWA 3Q7QA 4I1RA 4DUZB 3SQDA 3QUAA 2A92A 4M22A 2OO5A 5L9AA 2OZLA 2GKOA 3WLSA 4OHFA 5CM9C 5LBIA 3DZGA 2QXYA 3BMQA 5HSGA 3ZS9A 1R2QA 2JFZA 3KXDA 1TADA 3LX8A 5KHOC 1OTXA 4JI8B 2P9YA 1DG1G 1C7EA 4U7HA 1NMSA 4GF5A 2XHEA 2C2OA 4H2DA 4CM9A 1EB9A 2D5LA 3KPWA 3AVTA 2L18A 3A6HA 4K87A 1USKA 1ZJ4A 3OJ0A 2BM0A 4DQKA 3Q5EA 3R0XA 4D80A 5LYYA 4GPBA 2R84A 2VXOA 4QBIA 5FIUA 5A5FA 1RT9A 1LSSA 3BTUA 2EKLA 1ZIOA 3NORA 1QZZA 1JJ7A 4NK4A 1AIPA 3JD4A 5TEVA 3UH1A 2R8BA 4YJFB 5EQTA 4EPYA 2I2FA 4EI9A 5JCOC 2NT4A 2DFKB 3CKLA 1FFGA 3L7KA 3OX1A 4JVNA 3AEQB 1V4VA 5DU2A 2B69A 2ZR9A 3N8HA 4WOKA 1NUUA 1E59A 1W25A 3PE6A 3MS7A 3VPFA 4XLTA 4G07A 3VPAA 4ATNA 3LRXA 2J5BA 2D1YA 2IH2A 1TJ5A 4KIWA 3C3YA 2X3UA 1YH3A 4DANA 4HB0A 2C5BA 2OY0A 2NTNA 4HLUC 5JZ9A 1B14A 3IO3A 4Q7EA 1AO0A 2Z6AA 1N2HA 2O2YA 3IKTA 1Z63A 1I30A 2GZRA 3N53A 2P27A 3PQDA 3MWDB 3Q3CA 5FTLA 3EQ8A 4JJGA 3SF8A 3O8DA 1II8A 1NMEA 1A1VA 3GRFA 1PWXA 4MRAA 1XOIA 4QEZA 3EXEA 3T41A 4FFMA 1GV0A 1NVKA 4UCFA 3GFRA 4WXRA 5CR9A 1MJFA 1OZAA 2WSSA 2XXJA 1GKIA 5IBPA 3BCRA 3ELDA 5BQOA 4MS1B 1ZCJA 5TGTA 2W58A 2VDJA 3G8YA 4IRUB 4XRGA 4JJ6A 2B5OA 1QX4A 3FETA 3OPYA 5E6RB 1L0BA 3T34A 3VR5A 2W71A 2V5VA 1M6WA 4Z7QB 2CCGA 2N0SA 3FX2A 1JR3E 1QNLA 4R8RA 5DBOA 4MK4A 2ORWA 4R9NA 1VSVA 3HB9A 3TF5A 4KLNA 4C7VA 3F6PA 3ITEA 5CLLA 1L7QA 4TWZA 3CA8A 2PT5A 2WWHA 2O2XA 4FGSA 2ZM5A 1JILA 4I1VA 3AESA 4A8PA 3H9QA 4JUFA 3T6KA 3HV2A 4KAFA 4OYYA 3SJ7A 2V6MA 4GPTA 1BS9A 3HZRA 4N01A 3D4IA 1ICEA 1Q22A 1V1JA 3EPKA 4LJ7A 2YS7A 3FWZA 4G5XA 1I2ZA 4E33A 5CA0B 1GUBA 1HPLA 2C3MA 2VJYA 4GX0A 3WMWA 1Y63A 1NBIA 3DGEC 1LB1B 1CV2A 2AIRA 2R1VA 1IOZA 2P9JA 2QL9A 4IJKA 4PYIA 3MPOA 2HIAA 3FYUB 4B7AA 1IB0A 1SIWA 4TS3A 1Y4UA 3NUZA 2BLLA 4ZHQB 1BRMA 4N3NA 1ZI6A 4XCVA 3UB3A 1QB8A 2VKTA 3URMA 3NOQA 4KDRA 4TWBA 1JQAA 1ZUNB 1EQUA 4I50A 5LLSA 1JQEA 3K8OE 1Y6JA 4L9RA 5LA6A 2JBWA 2EAUA 2W2KA 3QBVA 3KCNA 2AOUB 2B78A 1Y9JA 3KEQA 4RMJA 3R3WA 1Z8FA 1ZK0A 4EVSA 5U1PA 4XZ3A 4RK1A 2GJKA 2J7PD 2IWRA 1KJJA 3BICA 4DKXA 3DLHA 3OTWA 4PR3A 2VJBA 4Q3CA 1MW8X 3K2QA 1DMSA 5LUBA 2NXJA 3V3KA 3IE0A 2FFQA 1Q1QA 1JIQA 3O74A 4AF6A 5CT9A 2WIBA 4EX6A 1NJ2A 2DPYA 4I8IA 1UEXC 3TBKA 2RHTA 3DUFA 5B7PA 2X1HA 5DNUA 3EIUA 1SC1A 2AXPA 3O4GA 3DEHA 4RAQA 3M49A 3ROFA 1C0PA 5L53A 1Q92A 4M6WA 1EJ6A 1FTSA 3TX6A 5KTPA 3M4NA 4BBJA 1R0KA 4K9NA 4G8CA 421PA 3PC7A 4OY3A 3VR6D 1P4RA 5LJIA 2PUJA 5LN1A 2ZOSA 4B71A 1CRQA 1AZWA 2QTHA 3P2OA 3TQRA 5COQA 5TQ0B 1E98A 1YULA 4Z7JA 1RFGE 3AUSA 4A6PA 4BNHA 3TDMA 4C4OA 2GILA 1WKVA 4L2IB 2C5FA 4DR2B 1WV1A 4KIFA 5I7OA 2XGSA 2ZIUB 1N5KA 1UKAA 4D44A 1EP9A 1MOPA 1X2EA 1XLUA 2YHAA 2DERA 3RJTA 3GBSA 1HDGO 4HATA 4YAJA 5EUCA 4BJ1A 2IEGA 3T35A 4YAIA 2WF6A 3A1TA 3LY7A 1X1TA 3FD8A 3LBYA 4LE2A 4RE5A 2PPVA 3IEPA 4D3YA 2PCLA 1NXOA 2HU5A 1Z5PA 5KNCA 2XYQA 3OO1A 1V45E 4RD2A 5L4SA 3P2MA 3Q2KA 3TL6A 3DL0A 4XUEA 4YR9A 3CUWA 1AV6A 4C3VA 1DGQA 2VAPA 1B1CA 5G2OA 2BN4A 2JJ8A 3ONEA 2ONKA 4GI5A 4OLFA 1JYSA 3ESZA 1RPAA 3LHDA 3PJEA 4RKWA 2YR0A 4S05A 2NXWA 1FDOA 3GAZA 4HDMB 1QV6A 3V1YA 3I1YA 3C3XA 3CZRA 4M86A 5JS8A 2CB0A 2XTZA 1T8RA 2OR3A 2YXDA 5TQJA 4E13A 2A7XA 4J9VA 2FN3A 4HB2A 3U4DA 4RVGA 2ID8A 3JQGB 2POCA 5EG5A 5B4UA 4M8KA 3VXKA 2OV1A 1GQFA 1YRBA 2BF7A 3JQFC 2NPFA 3SG0A 1WMAA 5JJBA 2D4HA 4Z53A 4RYDA 3CNOA 2BMEA 4YGXB 3WYBA 4HDQB 5IS2A 5M7EA 4M0PA 1Q0TA 4MRRA 4R7GA 1TE2A 2HA5A 3B9BA 3LSYA 3QXCA 1EVLA 2XHZA 4Q00A 4B81A 1ZL2A 4B83A 1YOVA 1E2IA 1U8YA 1KEUA 3O2SB 4ZGGA 3G2MA 2QT9A 4YRDA 1DO0A 2FFAA 4BCCA 3L0ZA 2RHHA 1B26A 2YC2C 4Q3OA 4X7MA 5AKHA 2WWRA 2ZE6A 3N8DA 4YWJA 3WLEA 4BJ5A 3PXXA 5AW6A 2GESA 1S2OA 2I80A 3CRRA 4GOMD 1G4HA 1RXEA 4LGCA 4C0LA 4GNKA 1D9ZA 3SJZA 3WZLA 3ZDEA 4EA9A 1HZZA 1UCFA 4F72A 3SPXA 4GU5A 2VJAA 1SAYA 4OHOA 5CNIA 3GLFE 3EC2A 4Q02A 3NWJA 3UK6A 4UBNA 3WLLA 4RNCA 3FPGA 3MRSA 3Q10A 4CT5A 2HNKA 4NOJA 2J7KA 1DBWA 3U9LA 4ZRMA 2K5UA 3TPCA 2A58A 4UMEA 3WQQA 5JAIA 5IM4A 1X42A 3IULA 3HSKA 4EO9A 4MITA 3IVAA 4C4XA 1MEEA 1IMJA 4HDOB 2JVKA 1EM8A 2B36A 2BH9A 2OCYC 2QEQA 4MWEA 2H1IA 4C2AA 1U80A 5DTJA 3LYUA 2R6CA 4Q9KA 3VVBA 4RD3A 1WZ2A 1UKZA 4V0NA 4URHA 2A0KA 3ZHUA 1ARZA 4DCJA 3N7AA 3JQFA 1TF7A 4ZT6A 1AN9A 4H3VA 4KQ9A 2FFHA 1DDIA 4C2UA 3A1WA 2GYWA 3H42B 3ZE2B 1TVKB 1EFAA 5BSKA 3NVMB 1XN4A 1Q0QA 5H4GA 2PUGA 3ZE1B 1J0AA 4J3JA 4PW0A 1TJ4A 1C30B 3D8TA 2NV0A 3W2HA 1A9RA 1Z4PX 3O93A 2DFLA 2QMZA 1XE3A 2HU7A 3WRWA 3A25A 3L8HA 3PYLA 4PNPA 1R0SA 1NE7A 3QVTA 3SX0A 2IF2A 1ZOOA 5AESA 1MB4A 3BUSA 3H2BA 3R77A 2PH3A 2DBYA 2GI4A 5CNKA 4AP5A 5UKDA 4EJ2A 1G17A 5K8UA 1UP4A 2IELA 2XJ4A 3AUTA 4Q4AB 5AUPB 4EFLA 2CDAA 4WKCA 4BAUA 1QHYA 1U2QA 1JHXA 1P9OA 4FONA 4OP3A 4F86A 3CPHA 3WRXC 1SH7A 2QS9A 2DHEA 3H18A 4RGYA 1QFMA 1BHQ1 3WL4A 4BQOA 1DBIA 2TECE 4YCDA 3VZPA 2CLHB 2I33A 4HRYA 4KXVA 3TZBA 1EBBA 3ST7A 3STTA 1U65A 3DTVA 1UKCA 4C0AC 1CF4A 1YHYA 4DAOA 1J23A 4BLQA 4KQXA 1LW6E 1EVZA 2ZUUA 5AK3A 2PAFA 2JIZD 2PRZA 3PC2A 1GHTA 3WLRA 1WMEA 1IUKA 4HI0E 5TMEA 4WXYB 4JXZA 2OOSA 5EHZA 3LF2A 3HMQA 4GBMA 1Q1BA 1FRFS 1AKYA 2CVHA 2R7MA 5JRDS 4DCMA 2V1XA 4PBRA 2HLDA 3EVFA 4V0LA 3NWEA 4MB0A 5F7JA 1WZNA 1A7JA 3NNNA 4OQNA 1BH2A 4RKFA 4L4SA 1IZ8A 1H1DA 2V4UA 3B2QA 5IK2A 1H4VB 2OFWA 2UV8A 1PQWA 1RLJA 3KKNA 2DHRA 5AFSA 2ECQA 2HQBA 4N39A 4KFUA 4Y1EA 4GWLA 1CE8B 1XEXB 4P58A 1BXZA 1RQLA 1DJOA 4LQCA 3BXHA 5HE9A 5SY4A 1AQ6A 3KZXA 3RVRA 4MAAA 2RGDA 4KRFA 1R64A 5DH9A 4BZQA 4BRSA 3I1IA 1UMCB 5T8KA 3E9RA 3PVSA 2BKXA 4ON9A 1NQUA 3V97A 4RTKA 5D1NA 5DI3B 5TQ2A 5EEGA 3VV2A 4MX8A 1UF9A 1TTQB 2WJZB 4H16A 3RV4A 4W5NA 1J56A 4DLXA 1NF8A 2Q5HA 4QQKA 4EW6A 5A62A 1TUGA 1WLSA 2XW6A 3I2GA 4J07A 4KJZA 5FJIA 4R41A 2IYOA 1FNMA 4ZVQA 3ZDRA 1O08A 4AUNA 3DFMA 3CH4B 4OYHA 1EDBA 4ZZ3A 2V7TA 4G67A 3D1JA 4K9KA 2NO9A 1JDJA 2BGNA 2VTDA 3HEBA 4PZ0A 3JAWB 3ZVKA 4KN5A 5JTTA 5IKXA 5SYNA 3QXJA 5GONF 3GEEA 1HX7A 5BT9A 4MKFA 3I4FA 5IBQA 3FYTA 5JAQA 2IVZA 4E88A 4EPRA 3AL3A 5JMOA 3G2KA 4X20B 2WQ6A 3K94A 4N49A 3S1AB 4EUEA 3FBWA 1C9KA 2W8ZA 4ZHQF 1FP6A 4KFSA 5L3QB 1QPBA 2BHRA 2C5LA 3LUGA 4P32A 4AVYA 3O8BA 4LRWA 3K6SA 4WZAE 1ZUD1 4OQYA 3TNLA 3PC4A 3FZGA 1O54A 1KAEA 1ML4A 3IL2A 2RGNC 3BMOB 3OVMA 3WGZA 1NT2A 3WGJA 4YMHA 4Q1DA 3W6OA 1P29A 7MDHA 4A0FA 3RC3A 1YT5A 2DKFA 3LQRA 1N32B 1N0IA 4XWGA 2F3TA 2ILVA 3T1OA 5IDWA 1GZVA 5KNDH 1TO6A 3DKIA 4F2DA 4KVAA 1U4NA 4W8OA 4V0MA 2X3FA 3HR7A 2ZPTX 3R3XA 4JX9A 5FI1B 2O8DB 3PQ6A 3GD5A 3IJRA 2V54A 3IAS1 3NBUA 2PU7A 3W3AD 2AG0A 3PLAE 3C4QA 4Y1FA 3HYRA 4BE7B 3PEFA 1QRDA 3WRYC 2BKVA 3HFSA 2WDPA 2SCUA 4LJ9A 2BDTA 4NAVA 4U7GA 2RI0A 3E58A 1GY8A 3N75A 1JKIA 1KI4A 1SUIA 2VDUE 3DDHA 4E5DA 3HJTA 5I01A 1L4LA 4J0HA 1Z16A 1OSNA 4PYNA 2OKGA 1DADA 2QENA 2ST1A 3WGUA 4HDSB 3CF4A 3K0FA 3AONB 4AYWA 4PHTA 2DULA 3F5MA 3T0FA 3RVLA 1VXRA 1BW9B 5KYTA 4M38A 1QC5A 4D9KA 3EZ7A 1E63A 4M0LA 1W5EA 1Q44A 2PZLA 4ZV7A 3VR3D 2WSSD 3H9GA 4IHQA 4XJVA 1NSTA 4D5EA 1ZA2A 4COKA 5DV9A 4WNAA 1EAMA 3FNRA 1WVMA 1NXWA 2VP4A 5JI2E 3MA0A 1N2CE 3IR5A 1RRVA 2EBUA 4L16A 3TI9A 3SZUA 1NQ5A 3WB2A 5KOJB 1M8KA 2C20A 3N7TA 1QVRA 5JDCC 2I4OA 2VPZA 2VNKA 4Q34A 3K9NA 4TM7A 4Q9IA 5FBWB 5JJCA 4IMIB 4FP9A 3EHDA 2OZPA 3U6KA 4L6CA 3ZPXA 4FLMA 1FYWA 1U0BB 1E5QA 1AU9A 1M73E 3L49A 3IBGA 1E1CB 2ASEA 2RDMA 3HDTA 1CE8A 3NTRA 4K6GA 4XPZA 5D3ZA 5ALJA 5A3SA 1ONSA 1PJCA 1TGYA 3IIEA 2ZDQA 4MVCA 4TVOA 3DGFC 5BN5A 2OO5C 3FVQA 4MUHA 1GUAA 4X60A 4P5PA 4PTLA 4C7KA 4D8XA 4EEKA 1JVBA 2W2MA 2QVZX 3RF6A 1EQ2A 3EIOA 5A3JA 2J7PA 5LL6P 4Q0MA 3HI6A 1D04A 3GCXA 5BRNA 3SCZA 1TCAA 4ZTUB 3S6JA 1AKVA 3T52A 1V6AA 3DE3X 2IBMA 2IJGX 4EB6A 3GP5A 4NY1A 1J99A 1NDUA 2BFDB 2KBFA 2CV0A 4JOCA 4BHTA 3PYXA 2IV2X 1AA6A 2KI5A 3RCBA 1Q0SA 4YT4A 3FOEC 2YDYA 1H5UA 3FJOA 1THMA 3M3PA 5I8ZA 3NGXA 5K0JA 4D9FA 3QWFA 1XXLA 1GA1A 4MR7B 2CGEA 5JCJD 5HWSA 2HF2A 1JEDA 3R7LA 1CC1S 4AO8A 1CNEA 4IIVA 3V8RA 3ETCA 1QCYA 3LYLA 3PGKA 1CR4A 4GMGA 3UV3A 4AX4A 4JYPA 4ZO9A 3MXTA 2CNOA 1SK9A 1NFQA 2WAOA 3HCBA 3QMWA 4P31A 4MI3A 4QAJA 2C88A 4FGWA 1PWHA