3B6KA

Wrba from escherichia coli, benzoquinone complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
197
structure length
197
Chain Sequence
AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavoprotein wrbA
publication title Crystal structure of the NADH:quinone oxidoreductase WrbA from Escherichia coli.
pubmed doi rcsb
molecule tags Flavoprotein
total genus 65
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3b6kA00
4QOIA 2QX9A 3K1YA 1DXQA 3F2VA 3L9XA 4CETA 3KEGA 1C7EA 1H66A 4QOJA 3G5MA 2FCRA 3ZHOA 1I1OA 3NHKA 1YDGA 1AKTA 1KBQA 1FTGA 4C0WA 3GFSA 1RCFA 3ESXA 3B6MA 1BVYF 1CZNA 1JA1A 1SQSA 3OX1A 3KLBA 1AZLA 2Z9CA 4C14A 4GR9A 2X2PA 1D03A 4QODA 3F90A 1AKQA 3NHJA 5TGZA 4R81A 3K20A 1FLDA 2BN4A 3TZBA 1H69A 3W78A 4C76A 2Q62A 3W77A 3QFRA 1CZLA 3B6KA 3S2YA 4DY4A 1GG5A 1FX1A 5F12A 2QX8A 3P0RA 4ZVMA 3NHWA 2QWXA 2GSWA 4OXXA 3HR4A 2QR2A 2RG1A 2M6SA 4YQEA 4D02A 5ULLA 5EAIA 2QX6A 1QBGA 4Y9UA 2BZSA 1OBOA 2FAXA 3ESYA 4N9QA 4J8PA 2MWMA 2R96A 5LBTA 2QMYA 1RLIA 3FNIA 1DX9A 3D7NA 3F6SA 1YCGA 4BMOB 2FLVA 3N39C 5NLLA 4ICIA 3L9WA 4N82A 2A5LA 2Z9DA 2AMJA 2R97A 2QX4A 3FVWA 3O2NA 4YALA 1QRDA 3KAPA 4PTYA 4GQIA 4LTNA 1JA0A 2MTBA 5LJIA 1OFVA 1YCHA 3B6IA 1F4PA 3KAQA 3NFRA 2BF4A 1TLLA 6NULA 1SG0A 3ESZA 2N1MA 1J9ZA 3FJOA 1C7FA 4ESEA 5F51A 1KBOA 3FX2A 1CZOA 1QR2A 1FLAA 3F6RA 1CZRA 2MT9A 3OJXA 5NULA 1FLNA 2FOXA 1AKWA 4H6PA 1AMOA 1D04A 1YKGA 4BMPB 5BUCA 3FW1A 1AKRA 4U7HA 2ZKIA 2V9CA 3EDOA 2BMVA 3NHYA 1XYVA 3NHSA 1AKUA 3HLYA 3LCMA 3SVLA 1RTTA 1X77A 1CZKA 2D5IA 3NHLA 1FUEA 3JSXA 1XYYA 1YRHA 4YAOA 2M6RA 3RPEA 2OHJA 3QE2A 4YAUA 4QOHA 5LBUA 3OJWA 1WSBA 1AG9A 4LA4A 3NHPA 3UXHA 4FX2A 4U7GA 3U7IA 4NULA 1BU5A 2V5UA 3TE7A 1CZHA 1T5BA 3OX2A 4LTDA 2V5VA 4ZVLA 1DXOA 3NLLA 1B1CA 3U7RA 4DILA 1ZWLA 1FVXA 5EA2A 3B6JA 4DIKA 2MOKA 2FZ5A 2ARKA 5FUQA 3GAMA 4XDHA 3EYWA 2F1OA 5FX2A 1XT6A 2HNBA 3QFCA 1XI2A 5B3LA 4QOFA 3O73A 1J9EA 4QOGA 4S24A 2OHHA 4Y7CA 2OHIA 2KQUA 1FLVA 4C0XA 2HPVA 5LJLA 4GI5A 1NNI1 4U7FA 3OX3A 5LVAA 4FGJA 2X2OA 4FGLA 3W79A 3LT5A 2BPOA 1WSWA 3N3BC 3N3AC 1TIKA 4Y9RA 5EMNA 1V4BA 3W7AA 3OWHA 2OYSA 3NHRA 3NHUA 4HEQA 5LLDA 1OBVA 3OVMA 1T0IA 1ZWKA 1QHEA 2XOEA 1RLJA 5B3KA 5JROA 2XODA 4CF6A 3GFRA 4M0CA 4FGKA 1D4AA 2B3DA 1YCFA 2FDXA 2FX2A 3GFQA 4LAFA 2FZVA 1E5DA 4YAWA 2Z9BA 4XDGA 4F8YA 5F4BA 4H2DA 3HA2A 4ZVKA 1J8QA 3R6WA 4N65A 1ZX1A 3OWXA 3ES9A 2QMZA 1VMEA 1J9GA 2Q9UA 2HNAA 3TEMA 4ZVNA 2WC1A 2W5UA 4PU0A 3NHFA 4QOEA 1CZUA 3UXEA 4YAFA 1AKVA 5LMCA 2KLBA 1YOBA 4NLLA 5A4KA 4LTMA 4PTZA 5FA6A 2Z98A 2FVXA 4HS4A 1AHNA
chains in the Genus database with same CATH superfamily
1TVKB 2IXBA 3MB5A 3NFYA 4L9RA 3AWIA 3GELA 2EDAA 3EUFA 2QP9X 4DL9A 1U31A 1U4OA 5CDUA 3Q3VA 4M37A 3BE8A 4FIDA 4WK6A 4HDMA 4UKDA 2NIPA 4CUZA 5JNRA 4LMPA 2DHCA 2E0IA 4XIYA 4QRIA 4OFXA 4OQPA 1JLMA 1JECA 3WDSA 2CYAA 2OQ2A 1KOFA 4ZODA 4XQEA 4ZU1X 4ZOEA 4PC3A 6Q21A 5HR5A 4MKRA 5LXTB 1W36B 4ND8B 5I51A 1Q1EA 2AD1A 2R5WA 4HADA 4KK4A 1NLMA 3QLVA 1EAYA 3IJRA 4TKVB 1FMCA 4N8EA 1YL7A 1FQOA 2EZ4A 2H31A 1Z2NX 4FE3A 3LHSA 1SQ6A 4U0KA 1W46A 1WV1A 3GFSA 5CYOA 4BX3A 4N03A 1KRHA 1MABA 3T7RA 5LIRA 1GAQA 3ESXA 2C4TA 3N2GA 4NESA 3T99A 2X5XA 5JDIA 1E1NA 4V03A 4M0MA 3SNKA 9MHTA 2A2ZA 3THRA 2H0RA 5BV8A 5K5EA 5DGIA 2V0NA 2JBAB 5BWBA 2ORED 4I1OA 2B6NA 3T95A 3NUGA 4ZZ3A 3LXRA 4YECA 3O90A 5AH0A 3T4XA 5SZHB 3ZHZA 4B5LA 4GR9A 3WWCA 1UEXC 3GRYA 1ATIA 1HNWB 2BT4A 1IXZA 2ZUCA 3FPAA 3MW8A 1DKQA 4DIFA 5IBCA 1PJAA 4L5JA 4N0PA 1P33A 2ODEA 3MBOA 5AM5A 4NSNA 5FV7A 4IJKA 4ZOCA 3IVAA 2CE7A 3NPAA 4ZJYA 2QTZA 4BQEA 1D2HA 5I4BA 2FPGB 1DT3A 3JQFA 4PAQA 5JCOC 2IV2X 4A0SA 2HA7A 1FLDA 3U0VA 4AX4A 4C6HA 4DPKA 2C20A 2PH3A 4EY8A 4DLVA 1U2EA 2ILVA 2XT0A 5AUPB 3WLHA 3OZCA 1N5DA 4H7FA 3IQHX 3C3JA 4UUOA 2C58A 2FUKA 1TU0A 1O2DA 2NXWA 2Y0EA 1E3LA 3PE3A 1R2QA 3RCBA 1H9BA 1HE1C 4NZPA 2GKGA 4Z0NA 2BY4A 5LQKA 4UNQA 3QUAA 2AE1A 3JZMA 1Y8RB 3CO0S 4P4SA 2EZTA 1LCIA 3IVXA 3E0XA 3IT3A 3FRJA 2B36A 3O3NB 4F6RB 4N5IX 1BJRE 1Y3HA 2N1BA 3F6BX 1EFKA 1YMVA 3H4VA 4L5IA 4Y2VA 3MT7A 5F2EA 4Q3CA 2P9HA 2ZJ8A 4JVLA 5LQRA 1J0EA 5CK5A 1T0HB 4PX9A 3QMWA 4ON9A 1M34E 3AUKA 5AVXA 3KV1A 1UXKA 2HCBA 4C7JA 2GEKA 3PGXA 5LDDC 2QU8A 1SAYA 2IY9A 1U8FO 1GPJA 1W19A 4Q7JB 4R1PA 4D79A 4RK6A 4DLWA 1MKYA 3BJZA 4E30A 1O58A 1Y8AA 1U6KA 2XDWA 3HRKA 3IV7A 1LA2A 4U2FA 1OWNA 1YJ5A 2ANCA 3IA7A 5A3QA 3EZXA 5JHHB 3DUFA 4RLSA 2CBZA 5IMSA 2HX1A 2UZ1A 1Y42X 4JY7A 5LNK1 3BIWA 1QG2A 2BFDA 3MCUA 3ZXIA 1MXFA 3IL2A 1J49A 5CT8A 2BZSA 1VLQA 4TS4A 4WZ6A 2LKDA 3IDZA 3PEWA 3X1MA 1CDOA 1N8SA 1NF8A 4EBBA 3I9LA 1LPNA 1UQTA 1XOIA 4FFRA 4GBED 4H18A 2QKYA 5EWMA 4ZCSA 4EY7A 1U0EA 2R6R1 4E4TA 5G3ZA 2W6PA 4CR8A 1WCIB 3IHLA 3FPEA 4YMWA 5HMLA 2V58A 1AH2A 3MJCA 1GL7A 1TCBA 2WHXA 3O38A 4F5YA 1KAHA 1ZK1A 4RTLA 1D2MA 3E5HA 1USVA 4FOSA 1RM0A 4X1YA 5CYPA 3N7TA 3JYNA 3FPHA 4KXYA 3SR0A 1FDIA 4E5SA 4B43A 1AA9A 3AB8A 4C3ZA 1XEXB 1UJ5A 2WUVA 1VDMA 2XYGA 4ZMRA 1A4IA 4JSTA 4EMSA 1NXPA 3AI7A 1FP7A 1SVLA 3CR8A 4LXTA 1WR8A 3VHRA 1F7VA 1IPHA 1CUUA 3MT0A 1XTKA 3HNRA 2BMAA 3MCAA 4M1MA 2GEJA 5IM5A 2GD0A 1ONOA 4F6LA 4HI0E 1TGYA 2VBFA 3IB6A 1E1QD 1Z4NA 4GXNA 4AAYA 1IJEA 3DV9A 4E21A 3W3AH 3GF4A 1V8PA 4INOA 3TW4A 1K8QA 1QHSA 2P9YA 4MPTA 3A9SA 1CU1A 4XUGB 3VU8A 5AW3A 1A88A 1BZYA 2AE2A 1QS0B 2XLCA 1TLTA 3A9RA 3V33A 5IUNC 1D1SA 2Q1SA 4XB2A 1AD2A 1AMUA 1YFLA 4LY9A 1IG3A 5JEEA 1E5VA 2BKVA 3DVQX 4I46A 3UXMA 4WZZA 1P7ZA 1QSGA 3D6NB 1RWMA 3Q5EA 4JLKA 5ECGC 3RI3A 5INTA 1VI5A 2FR1A 2R6JA 4JEIA 1SUWA 2OYCA 2PR7A 2LR0A 3WBFA 1VJRA 1SKBA 4DN6A 1VHJA 4JQSA 1UP6A 1CSEE 2AOTA 1BJKA 2XUKA 2ZWIA 1ZW6A 2X0KA 3HBMA 2CLLB 4UM5A 3TIIA 3ZX4A 1BDHA 4D4MA 3NFRA 3HC7A 5CA0F 4HEA6 1NVAA 3BD8A 3PA6A 2QW8A 1PKXA 1ZGBA 2PX0A 3LW8A 4TL8A 2JJMA 2Y2VA 4V2IA 5FBHA 4MMXB 1QZ3A 4YUVA 4EIWA 3D4OA 4Z9AA 1KI1A 2ZT8A 4LGYA 3WIVA 4JBXA 4UTRA 4UEJA 1C8KA 2WSBA 2TMDA 2YDYA 3FTEA 1FMFA 5K3OA 5ITWA 5AJHA 2BTQA 4F1KA 5JXGA 2N1MA 5JMWA 1T5HX 1H4SA 4BP9A 2GXUA 5AW8A 1HX7A 2Q21A 1KBOA 4C6TB 2NV6A 2HIHA 2ZBRA 4M9XA 3RRXA 3E7FA 2HA2A 3HZRA 4J16C 4RW0A 3P9XA 3WRYA 4UBKA 4K2HA 4L3OA 3I37X 1MFPA 2OD9A 2X86A 2XYVA 5SY6A 2Q5JA 2FEOA 3BG5A 3ZXSA 1CZRA 1HTWA 1MH9A 2DUJA 2MT9A 4N40A 1JWLA 3WZLA 2O06A 2B21A 1ZL0A 2P9BA 4LSGA 5T8KC 4DSUA 3VSBA 2JGRA 3REFA 5G3YA 3WL3A 4EUFA 2VKTA 4OSPA 2IKQA 3B5EA 4R05A 1W6RA 4YAEA 5FLYA 1W93A 4L3VA 4FB5A 2B9EA 5D3KA 2ZIUB 1JFTA 1FRFS 4PXAA 1MAAA 1NBME 3GFBA 3WNBA 1LDGA 2H4XA 4G5FA 4Q1BA 2FP4A 2JFPA 5FTWA 3GFGA 2H4HA 2R1ZA 1OC2A 3RDPA 3RIGA 3I04M 4AUMA 3R7AA 2AFIA 2PX4A 1XNGA 4RQAA 4YDHB 3UMMA 4KBYA 4XEUA 2AJCA 2YICA 1KI9A 4RD6A 1NXOA 1WLSA 4EAAA 4PCVA 1TYZA 4L73A 3ZWCA 2BEKA 1IK4A 1TRHA 3AOGA 3AI1A 4DQUA 1E79A 1Y4ZA 3ZOKA 3NKLA 1MTZA 4OLHA 1L7AA 3JZFA 1G0NA 4YY3B 3EMDA 1NURA 2XVZA 1DUSA 2X0IA 3Q7EA 4HAYA 4ZVTA 3BXZA 2O8EA 3GG2A 4FUQA 4JC4A 5K0CA 4NMLA 2VG8A 4UFOA 3SK0A 2BRUC 1B3BA 1ZOIA 3ZU3A 2AUTA 3KR1A 3P1JA 2P6UA 4CM4B 1OREA 2IHVA 1FUEA 4GT1A 1UUFA 1YRHA 2IEBA 5FOVA 5C4MA 3P7MA 3K1TA 2RB4A 3C3WA 3N5CA 1V6AA 4WN9A 4YQYA 1YD7A 2NT4A 2XZTA 4IV8A 5G0TA 4UEOA 1ZUNB 2W6MA 2RGWA 3RSCA 4DM4A 4QYIA 2ZVJA 4ENTA 3B8HA 3HJAA 4OA5A 4ZCIA 5AJYA 2FUCA 3W3AD 5ENVA 4NHEA 2D2IA 3SBDA 1PX2A 1KR5A 4ND7A 4X00A 5K3DA 4ENRA 3EPLA 1OB5A 2QRUA 3PFKA 4LK2A 2NX2A 2G8LA 3H8WA 4BO9A 3STUA 1WSBA 3TL3A 1QGYA 1XVTA 3Q11A 3AVVA 1YI0A 4HAIA 4DW8A 5BP7A 3ZY3A 5J4HA 1OT5A 4UPDA 4TXJA 4JUDX 5HOEA 2FN7A 3BSSA 3ZXXA 4F04A 1W4BA 1Y6RA 2XTAA 3AVWA 3BGSA 4NPCA 3TCKA 1JU9A 3HN2A 4IRMA 3FR8A 2E2WA 2HB6A 3JWGA 2PXXA 3TKYA 3IKJA 1OLXB 4E4RA 1IRIA 1ZOSA 2XJ4A 3WIBA 2Z6AA 2J1LA 1D5CA 5DN9A 5EKUA 4PYLA 3EIEA 3PHIA 4JI5B 1QYCA 5CX1A 4Q9HA 3TRKA 2OKCA 3F6PA 1NYQA 2C2YA 2G5CA 2V4UA 1DT5A 1RAHA 2G36A 2XUFA 2BFPA 3ADKA 4PPNA 4DV3B 3CH4B 4J1QA 5E2BA 3N8GA 5FLKA 4HEA1 2C3UA 4AY6A 1KZ9A 3RYHB 1ZR4A 1LSUA 3UT5B 3ACBA 1I6LA 2IEAA 1JAZA 1K9VF 4ER5A 4FYWA 2JLXA 3TNDA 3EQ2A 3HKBB 1RS0A 2VP4A 3GEIA 4INZA 5G4KA 4C2TA 3KB6A 3V8PA 3ND5A 1CR6A 1YJXA 1F8XA 4EVSA 1XZIA 3QBEA 5KYYB 4WCVA 2O8NA 1P9NA 4L6IA 2XYPA 5SY4A 4AO7A 4N3GA 5K8VA 1T6NA 1UWKA 3EYWA 3G85A 4GLOA 2HN9A 5D6NA 3GNLA 5EE0A 2ZE6A 3DW3X 4H3SA 1Q14A 4MP3A 3RYIA 4AROA 1JWBB 1Y1PA 4X63A 3C5EA 5B37A 3MT9A 3H8JA 2GUGA 1B6RA 1M1YE 4ZXPA 5KJ1A 1TMGE 1SCQA 1G8KA 2VVTA 3EIXA 3H9GA 1EE1A 2CLKB 3R3VA 5DULA 2CXQA 5DX8A 5DZSA 5JS2A 2WE7A 2QQ5A 4A2WA 3IP1A 3MT8A 1WDWB 3O21A 1GGVA 3OHSX 4NBNA 1S89A 1PFVA 1ZH8A 3CIFA 3N5KA 2YVLA 3UMBA 3L3BA 4M0UA 1TEHA 1IPEA 3ROFA 4FR2A 4Y2YA 3M0EA 2AG8A 3QKRA 2X8BA 3WGZA 4RVCA 5D6OA 4GI5A 3WNDA 3FI0A 3VNQA 4JC8A 5F7JA 4C3OB 5HPYB 2MMCA 5CM2Z 1NVXQ 3OUUA 5CYGA 3EXG1 1G9TA 4IO0A 5BSKA 2ADOA 4CM7A 2GM3A 4MKIA 4BNYA 4R1SA 1SVSA 3VNUA 3MK31 1QQ6A 2DBVO 2PXAA 1GQYA 2C7VA 1T9AA 1K8ZB 5IAKA 1H3NA 3SLGA 1T1IA 3CZ4A 5LZ9A 2H7VA 2QROA 4ZV9A 1GNQA 1WMFA 1V4BA 4ADSG 1JUDA 3MOIA 3GFTA 2CSXA 3OWHA 1NATA 5F2KA 1IDOA 1CQZA 1KERA 5B1EA 2OYSA 3NHUA 3WYFA 1MT3A 1VHLA 3RT9A 1LEHA 4Q9KA 1PVOA 1CVIA 3C16C 1OCEA 4BS9A 1D09A 3DDHA 5K8CA 5DP1A 1ZMXA 1ZWKA 4KLRA 5AVUA 3F1KA 1PHPA 4FZ5A 3PD0A 5EPUA 4OQ4A 3JRWA 4UBOA 3CZ5A 4NTZA 1E60A 3NEPX 2O8DB 1XCBA 1OROA 4MWCA 1HORA 2C98A 2D5BA 2FF5A 2ONZA 5EIEA 2DAPA 4MS4B 3C3BA 4BXOB 4Q3AA 1WP9A 3DM5A 3MPOA 1AQNA 2NUAA 1ZNZA 3AVYA 2AS0A 1JQDA 2HEIA 2NOAA 1YK1A 3UATA 1WXWA 4DWVA 5JS7A 4JIGA 4LF9B 4Y9DA 3E82A 2WJ6A 3C3YA 1WL8A 1VL6A 1EUZA 5F76A 2ZPAA 1I4WA 1L9XA 2EQBA 3P27A 2C7PA 3EY9A 3EUWA 2GN2A 2P2LA 3ENQA 2GASA 3S1SA 2XNDA 4PHHA 2ZSEA 1LDYA 1USIA 3P9RA 4HNTA 1V5WA 2V8OA 5DTMA 4X65B 1XZJA 1MDBA 2HJSA 1I4EB 2RBKA 1I1QB 3KKEA 5K7SA 2I67A 5JQWA 3DFMA 4BVAA 3O8RA 2IH5A 2V4MA 2C94A 2HK9A 1FFXA 3DKIA 3CSSA 3D1LA 2XE6A 3GRRA 3PF9A 4U6QA 5IU6A 1PD1A 3OPVA 3SYMA 1EH5A 3KHSA 1UEJA 5KI6A 3AR4A 4KJXA 3UUEA 3DCYA 5EVCA 3OT1A 4AJPA 4I1VA 2J6CA 4FVTA 2OV8A 4OB8A 5LD2B 2WJHA 2IUYA 1SKMA 5GJWC 2E4AA 4O25A 2CCJA 2VWGA 2OA0A 3FMVA 4B74A 5KVCA 2BEVA 3QPAA 2XRFA 1W25A 4WBSA 1W4ZA 3TS1A 3IDQA 3HYNA 5BVGA 1Z0FA 3QRWA 4EP1A 4HYYA 1OF1A 1SKAA 4ZOLF 4G0MA 2YJ6A 5BVHB 2WSSD 3QOXA 1NC3A 5KJ6A 2R1UA 3V8MA 3ZDEA 2WJZB 1T1JA 1H5NA 4G4SO 4OY3A 2OZPA 2VSFA 5AICA 3DVRX 2AN1A 2AOUB 4N18A 1R4NA 2HLHA 4Z51A 3JQ8B 2QE7A 1Z6QA 5A4KA 1Y4DE 1NW8A 2YQ4A 4ZYUA 1P4HA 5DGHA 1E1RA 1ECPA 1BHJA 1G8PA 2FH5B 1EA7A 4Q1VA 4DUGD 4EA9A 4ZYZA 1FZTA 1RYBA 1KQOA 1GAXA 1K4MA 4RXTA 3RVPA 4DRZA 5B36A 2LIVA 1T9CA 2G63A 1CQPA 2G82A 1P1HA 4IEIA 3EE6A 1U2GA 3KDPA 2JG3A 1NVVR 4YA6A 4LOIA 5A0TA 2EP8A 1PUXA 1XJCA 2R66A 1ECLA 4BO3A 2IXDA 1JIUA 1J24A 3DD5A 1GZDA 2DBRA 3L6UA 4M55A 1GPMA 4Q6BA 3NVDA 3FB4A 3QTTA 4Q7EA 2WK1A 1R8XA 3E9DA 4C1NA 4MUMA 4D4LA 4EJ6A 1R10A 3NAGA 4XJXA 1R88A 5TPWA 1WU8A 1ZRNA 3K8QA 3ET4A 4AY5A 1G2QA 2PWZA 1W34A 4XM0A 1YB7A 4Z8YA 1M54A 1P7VA 3NWOA 2OB1A 1XQYA 2WIDA 3D4IA 1Z18A 2DM6A 3E03A 3H84A 4JK3A 4O2RA 4P0TA 3RYCA 2AC4A 3C3KA 1TKCA 5DTQA 5GIOE 4ENWA 1M5RA 3EDCA 5ALHA 4I9FA 1HY3A 5JIBA 5J63A 1JA1A 4IXDA 2GEBA 4EHKA 2H2AA 1UP7A 4CIAA 3P9KA 5FUVA 2F1JA 4H4DA 2ZGVA 3EJWA 2XCQA 2A7QA 3LC7O 4GVLA 4F4CA 5HRCA 1Q1GA 1P74A 1ABFA 2YJ3A 4OSOA 4ZAZA 4LRQA 1L5GB 3RC3A 2X2PA 1G19A 3VHLB 1E9VA 1XVUA 1OD6A 5J5CA 3TOSA 4UPVA 2ZBVA 4RIHA 2Z83A 4BLWA 2JLCA 3QOFA 5B12A 2BGNA 3K9QO 2VJOA 4XW2A 2DWQA 4CKXA 1HR0B 2IA5A 4ZT2A 1JB1A 2V8BA 5C9ZA 1E6EA 1HRKA 1LPMA 2RI1A 4HH4A 3W7VA 1NJFA 5KWIA 1K6XA 3M34A 3AEZA 4GE3A 4WWHA 3ZWYA 3ZHVA 5BV1A 3F5MA 1NM5C 3OZ7A 1QYRA 4RKRA 3WMEA 4Q18A 1FFEA 3CX8A 3IOMA 3NI2A 2P8SA 1SRRA 4LC9A 4P4TA 5IANA 4OHPA 2QVLA 1IHDA 4MR9B 2O8FB 3AM4A 5CEFA 1P6UA 3IQWA 1ECJA 4X3PA 3GLFE 3ZY5A 1NVMB 1YBVA 2GHQA 1KO7A 2YOGA 2OBMA 2XQIA 4YP5A 3RG8A 3I72A 3UBTA 3C8MA 3EXFA 3FFWA 3QUBA 2XZLA 3HLKA 1W88A 3C43A 4PQGA 1G3QA 2I3AA 1PTJA 5ES3A 3TMYA 1OLUB 3LY8A 3LBYA 1MOQA 4KACA 4TVBA 3W4IA 3BRCA 1JE1A 1NR7A 2GSWA 4WVFA 1MRZA 2I9KA 1BW9A 4GZ5A 1UDBA 2V6JA 4HTAA 4NY1A 1Q0SA 3GCGA 4Z99A 5TEWA 2QRKA 3HR4A 1W2WB 4RC9A 4MS1A 3SXUA 4CF3A 1C1HA 4CCWA 1TEVA 2B8WA 4U8GA 4FW9A 3NAMA 5ALLA 4NFSA 2G4LA 3DE3X 2NUTA 2AX4A 3CRVA 4WKCA 3EIOA 3AVTA 2ZBEA 1QP4A 3M70A 2ZUSA 2XUPA 2QX6A 1W0CA 1T9GR 5E9JA 2WWVD 5DXJA 3URMA 2P0EA 4C3UA 2YHUA 4E5KA 4Q3KA 4GXTA 5EIAA 1DV2A 3CNBA 1O4VA 3DG9A 2HRRA 2V7PA 4MI9A 4TLCA 1UK9A 2BP7A 4H1UA 5H3HA 1T6XA 2OXFA 3ZDFA 5FA5A 3GFOA 5JRJA 4U2BA 4NZOA 3I4LA 4OPMA 4P7FA 4R1UA 5BSEA 3DOUA 3OO0A 3UANA 2IYVA 1HQCA 3DBOB 3MB8A 5JAOA 2MWMA 2R8RA 1TYDE 2BONA 3EXEB 4ZZ1A 5KX5B 1ISRA 1VHWA 1U28A 1KF0A 4KFCA 2IYPA 4TV9B 5K1ZA 3GJXC 3VAYA 1SCAA 3X2SA 1JAIA 1J1ZA 1Z2PX 4WKOA 5FPKA 4NEQA 2EFEB 4UD6A 5KNLA 5C3MA 4O5OA 3WK8A 2AMFA 1IVSA 1ZVKA 3QOWA 1OGIA 2P30A 3UAVA 4TS9A 4C06A 1YIDA 4EI9A 4LQDA 3PXGA 2BMFA 3GT0A 4Y67A 1RPAA 2ZVPX 1ZAYA 4MLPA 2Q1WA 1ESCA 2KYRA 1EM8B 4D3SA 1P7CA 2JZOA 4CEIA 5FA8A 2FW8A 2BGWA 4CQMA 2D13A 3BXXA 4YUYA 1Z3CA 3I52A 4JC0A 3U1BA 1Z0DA 1CKEA 3JVDA 3K0AB 5BOVA 3KEOA 4YMHA 4S1NA 2FRDC 2YUIA 2WTMA 3NEAA 4LGCA 1II8A 2Z4SA 2HTFA 3EGXA 3BK7A 4HNUA 2NO1A 2P65A 2A58A 2YHSA 1PZMA 3CZCA 3GLHB 1XVIA 1EFHA 2GH1A 2XJ9A 1JALA 2XWBF 2FK7A 1EEHA 3RSSA 5C1DA 1P45A 3AKYA 3PI7A 2BFEB 2YQ5A 3KSZO 4L4ZA 2ZB7A 3V4PB 4AO8A 1Y82A 2OM2A 2XZDA 4XDZA 5EJ2A 4YT8A 5KQPA 2X4IA 4K9QA 2B30A 5LKAA 3L41A 2ZFUA 1KZ1A 3THSA 3I1FA 1X2BA 3CNLA 4TT3A 5HF5A 3IELA 3RSOA 4N5HX 4CIVA 4MR7B 3VOTA 2PUGA 4YEDA 1FW6A 3KUCA 4EPTA 3GP5A 1SG0A 3ORHA 1YA4A 4KW7A 4DA8A 5BQ5A 3FE2A 3ZIDA 1NP3A 3KKOA 1J9ZA 4F4HA 3NTUA 1GTVA 3ZDQA 1SBQA 1R5BA 1TOAA 3TG2A 4O2LA 4CM9D 1QB7A 3QWHA 1RJEA 2WLTA 2WB4A 1WLYA 2ZJYA 4MX8A 4PZLA 5EVJA 4A8JA 1JPNA 4IPTA 4C21A 4RH0A 4NOKA 2E6UX 4LJSA 1C3XA 1Y8QB 4C9BA 1Z4KA 2VF8A 3OIVA 4Q19A 1LDEA 2AYZA 3HBJA 4C4XA 4F72A 3CO5A 1JHYA 5KKNB 3CA8A 1JIKA 4Q93A 4E2YA 1GRQA 1M10A 1TZCA 1DC7A 2IP2A 2OFPA 3BBPA 3K9BA 3JSAA 4IX9A 4Y6QA 2CXTA 2ZCJA 1XTQA 1P31A 1EGHA 3CMMA 4YI5A 3NJRA 4DG9A 1VPVA 1E7RA 1L8XA 4M4SA 3L49A 5AI9A 1A04A 2QF7A 1AKWA 4H6PA 4UUBA 2OOSA 3OCWA 1TCCA 5DH9A 3G6WA 3PQEA 5BRAA 1DAPA 4OF4A 4KRFA 1B41A 4AZ3B 2G7ZA 2NZUG 4FONA 4ZVOA 4WBNB 4TMWA 4FX5A 2A5DA 1FVHA 3T0GA 2HIAA 5HKKA 1TQDA 3RSLA 3KB1A 4Z4EA 1K08A 5H3CA 3VBCA 4EF6A 4CIXA 5CU7A 1OIVA 5CJ2A 5AHRA 1UPXA 2O7RA 1F2DA 2G5PA 1CUFA 4WXRA 3EDOA 4RHEA 3BWVA 1Z4IA 4OBEA 5IJAA 2BMVA 1Y9AA 1YU9A 3CUEF 1A50B 5FLXA 1W76A 5DBOA 2DLNA 3W4KA 2JAQA 1KP2A 3E27A 2IBSA 5EJ7A 2GLTA 3CUWA 4F4IA 3TCXB 2WQZA 4QJ4A 3LCMA 3OQJA 2CYCA 5C51B 4F4UA 5J4YA 1LLUA 1KFKB 4PO9A 2IYFA 4BMNA 4DF3A 1EFUA 3ZDAA 4WIAA 4K1XA 5I48A 2JHAA 1H0HA 1RWXA 5IK2D 2V3CC 1VSUA 4RL6A 4D41A 5KB3A 1I5EA 5T6BA 1AKMA 1SVOA 2DBYA 3D1JA 3DZ8A 2WOOA 2Y68A 1GZ4A 1Q57A 3X43A 3LRTA 3CC8A 4ED9A 4J49A 4EHBA 1JPJA 2H4WA 3MGGA 2PZMA 3B52X 3N28A 1MORA 3HUDA 3O4FA 4RZIA 5CJJA 4KMOA 3VNAA 4UHEA 5ALSA 1W96A 1Z35A 2Q29A 1BS2A 3KPJA 2BW0A 5DMXA 1NMYA 5DHUA 1TO6A 2IDZA 3ZHRA 1YTUA 1DKUA 1ZXBA 2ZT6A 4BQRA 4FYHA 4JJAA 5MFPA 4CEJB 4KTVE 1ODSA 3LTEA 4D80A 3RSHA 4FMCF 3RJZA 3AIOA 3HB7A 3O8OA 2R6HA 4MCIA 1AQJA 1CRZA 3RF6A 5I4KA 3V8VA 1C41A 4RF4A 5L7WA 1W5TA 2PVSA 5IBQA 2PNFA 4DIDA 3ZU6A 1E61A 3I1IA 3OJWA 2WU1A 4GX5A 1EWKA 2ID8A 3UIEA 3GA5A 3DEIA 2VUIB 4ZO9A 1HDGO 1LC3A 5DTRA 4YXWA 4BZWA 1JZSA 3GB9A 3TUIC 1QIIA 1RP7A 3LQ4A 3T5GA 3LH5A 3UUFA 4LG1A 5ALZA 2ACVA 1LBSA 3SX2A 3TGWA 1R9GA 1DBWA 3TJRA 2IXTA 4D97A 5EJ5A 3CVUA 4OX9B 1MOZA 1ZH0A 2DGDA 4JLSA 4RV4A 1CJTC 5G0UA 4CUKA 1DEXA 4DLNA 5L40A 1DBPA 2GUWA 1QDUA 2V1XA 3T94A 1DJQA 3KOWA 3EULA 3S6JA 2IYSA 1GPLA 2TS1A 4HZIA 4JKIA 1DXOA 5KYVA 1HLPA 1K8YB 1KQNA 4BGDA 4D9JA 1CFJA 1RAAA 3BMCB 3RB8A 1EFTA 1NQAO 2Y6UA 3AG6A 4HNGA 3TNYA 4CHGA 4XJVA 4DR6B 2BI7A 3KAJA 5A03A 2Q0HA 2VWPA 3E9YA 4MV9A 2I66A 5ALFA 1CUDA 3ZWMA 2C4VA 3Q0EA 4B17A 2TSYB 1T9KA 2JEZA 3HWWA 2H1VA 5D86A 3D3WB 1QHIA 4X9XA 5I9BA 4TTPA 5B5SA 2EQAA 3L0CA 3PSAA 2EP5A 1RRCA 4BWFB 1X80B 2ZJ2A 3FPJA 1XR3A 1LFDB 4J90A 2DKFA 3L6OO 1KDOA 4RWEA 3O82A 5I9MA 1PVVA 4H6XA 3ICPA 4G8DA 1XT6A 3GA7A 2C5GA 2YHIB 2IXFA 3DS8A 3RTDA 5IM4A 2QB5A 3DOFA 4ALLA 3RIYA 4DA9A 1JLHA 4WJLA 5TMDA 1K98A 3L8MA 2VAVA 4DDMA 1QGUA 3DNPA 4UBMA 4RULA 3OJFA 5HF8A 2QAGB 3DYVA 1MB2A 2MYUA 3ZK9A 2AMVA 4B84A 4IRXA 4PNEA 1EWQA 4Z7NB 3X0DA 4DUZB 3HU3A 4PQYA 1MC8A 1JYSA 1Q0RA 5DHFA 5AESA 1KS9A 3KCNA 1Z63A 2XA9A 2DBZA 1NNI1 1UZAA 3NIFB 3PJDA 3L4JA 4FXOA 2PZBA 2BFBB 3FF4A 1P19A 2ZUBA 1X7YB 4M88A 3B3QA 1RXWA 4NXNB 2O2DA 1H2WA 4YRIA 5IEJA 3ZW8A 4JUIA 4Q48A 5ALGA 1JMYA 3QI7A 2UZ4A 4MW4A 3VU9A 2ZQYA 2PD4A 2X2OA 5H82A 4N0DA 1UK8A 3ZW7A 4G5SA 5JAQA 3SICE 1O89A 1VP9A 4DM3A 5JBNA 2MR5A 7ADHA 1G6HA 5AVZA 3A4IA 3VO9A 2XUJA 3JVIA 2AJLI 3DP7A 4JYBA 2NSYA 5HNKA 3ZLJA 5C7LO 2PDAA 1S02A 1KZYC 3HBFA 3B9QA 1NKVA 3O8QB 5E0KB 3I9OA 2BR5A 4C2AA 2Z8ZA 5MN6A 2RJNA 1Z33A 1XQ6A 521PA 1IJBA 1Z62A 4GM1A 3U9TA 4O29A 2ORYA 4CIDA 4KGZA 5H9VA 3P9QA 2Q3FA 1JJAA 1M2JA 2FDRA 4IV5A 2LCQA 4F60A 1DCKA 2ZU6A 3V4RA 1XF9A 4ZKDA 2WYUA 2B98A 4N76A 5JSFA 5B1YA 2PZGA 3MGKA 1MAWA 4WQMA 3U44A 4B3MB 2ANBA 2W0SA 1ICEA 2V7GA 2DUMA 4B7UA 3AFIA 2PG3A 3GK3A 1JLKA 2I4MA 1PCXA 4KQGA 2P1DA 1CEYA 2IS6A 1K92A 4FMDF 1MJFA 5KKCA 4R98A 3QEKA 2X4DA 4L0MA 3U7QA 5EERA 2PJRA 5ICGA 3GMIA 5CDHA 3PGA1 3J7TA 3P9PA 1TUBB 2XMDA 3QU7A 3LOUA 4DSTA 4JR1A 4TTRA 3WLPA 3M5CA 1U81A 5HFAA 3STTA 3UTCA 3QPCA 4WXEA 3BMOA 2NTNA 1V5EA 4RKYA 1QRSA 1O6GA 1RXYA 3A27A 4ZVKA 5M29A 2G5TA 4NVRA 4KIJA 2GCPA 3G1TA 3HM9A 3U09A 4RJ2A 1SU8A 1Q0ZA 2O52A 4NHOA 4GP9A 4P5EA 3KAKA 2IH2A 1LX7A 2B0CA 3H9UA 2Z2ZA 3LI2A 1W7AA 3GWGA 1JDZA 1QHHB 1TVKA 2VJLA 4RIIA 1CK4A 4FC7A 4PSVA 3WR5A 2WNHA 5FF9A 1TK2A 1KEVA 3QELB 4WNAB 1U2QA 2GK7A 4C0AC 2GGSA 4L95C 4Q4CA 1KJZA 1YUMA 3PNYA 4ZAYA 1ACMA 1QKJA 3H5TA 3UY4A 1I1NA 4NR0A 1CUWA 5FOSA 2EATA 5TDHA 1LNZA 1M7GA 4GOMD 2CNOA 4H16A 4MROA 5LXTA 3LKZA 1PBNA 2RIRA 1NUTA 4ND8A 3KC2A 1XWFA 2Q0QA 3O1JC 3GT4A 1H22A 3GUUA 5KU1A 1E9CA 2JLYA 4PCUA 5B7QA 4TKVA 4PYRA 4M7WA 2F48A 4YAFA 5D00A 1NONA 1QOZA 1QMPA 1ZCAA 3U3ZA 2H1FA 1T3TA 3WJ1A 4YP1A 1G21B 3VI3B 4LJ6A 1ZU4A 2BR3A 1GQRA 1YOBA 2HMAA 3EBLA 3L7BA 1EWYA 1QK3A 3CQ9A 3ZC3A 4R9VA 1B6TA 1I5RA 4TROA 1PQYA 2Y8EA 5EE3A 1P9OA 4QFMA 5IVPA 1NQ5A 2Z98A 2FVXA 2KE5A 3UJDA 5J23A 4P3PA 2AOXA 2HMWA 2H0QA 4OXRA 2JBAA 2OFFA 1DAMA 3TIGA 1MC5A 4IDOA 2G0NA 5U4QA 1TQ6A 5J2TB 1E2UA 2J3IA 2UZ3A 1WBJB 1DXQA 1KJJA 3OPQA 1K5DA 4EVIA 2FLKA 3KQKA 4TSKA 4D82A 3V46A 3FCAA 4GL4A 4QDTA 4X8MA 3RT7A 1J0DA 3NTOA 1GZ7A 1XFAA 3BCSA 2WG2A 3FSRA 4TXMA 1HE5A 4V39A 5A2GA 3BWXA 2BHTA 1AS2A 1PQPA 4G1UC 4LXGA 2FPGA 2OM6A 5JYCA 3VTFA 1W59A 4E15A 4RTOA 2I2BA 4K6KA 1JEEA 1KPIA 2JNWA 2OAGA 4L8GA 3UUWA 4AL4A 4ZCTA 2GM5A 2ZTMA 3DFUA 3AV0B 1YDWA 2QQGA 1LI5A 1M6YA 1PSWA 1BOFA 2WP8J 3ENVA 4H1HA 5C5IA 1BIFA 2IXAA 5EUQB 4KL8S 1S7GA 5FO1A 3KT3A 5FEMA 4B3XA 1PLLA 2GM4A 2PKXA 2V7UA 3WGLA 4TLEA 1SU4A 4Q1DA 1V71A 3AFOA 2M6LA 4DBLE 2E55A 4PG8A 1PX0A 1Z2EA 4MI3A 4C6SA 1MJNA 3LFTA 1GKYA 2ZUTA 4YYZA 4ZVPA 1Y8RA 4B7AA 1HE3A 1CV2A 4MVJH 4PO8A 5ALQA 4FFSA 2W2PA 1WUYA 2MSDB 4BFVA 3GGDA 4F6RA 2XB4A 1FFHA 1Q3KA 2ODNA 3QFFA 5LU8A 1E3SA 1T4DA 5D8DA 3R8XA 5JYEA 1QM5A 1U6JA 3JW8A 3NIGB 1BKSB 3H1PA 3ZIAD 4Y2UA 4MWOA 1UMKA 4L6CA 4X5OA 1Y1TA 4UEKA 5TGZA 3NX4A 5EE1A 4B4UA 1ZSVA 2ECQA 1W5BA 4A4DA 1FSPA 4NCIA 3ZDCA 1RDFA 3ESDA 3L07A 2HXGA 3H5NA 1MQAA 1KJQA 1XJWA 3TZBA 4KPFC 2Q3BA 1ZUHA 1VPLA 3FPCA 3B48A 4A92A 3S28A 4G86A 3WHKA 4YP6A 3KJHA 3I3SR 2XA1A 4J4HA 2F8SA 2FZCA 4EMBA 5KHLB 1BXRB 1MC4A 2VK4A 2VYNA 4Y1GA 1EE2A 1YZNA 4M9QA 4LSMA 2ZP1A 5JQGB 2ATCA 1DEAA 1YJCA 1L4EA 2JIMA 3ECCA 2C1XA 4C2BA 1YU6A 4HGOA 3LOQA 1MTOA 1U6IA 4D8XA 4FINA 4KTTE 3ZY2A 1MV5A 1V25A 4Z9YA 4QTZA 2WTBA 4NZMA 2K5UA 4P4NA 1KC3A 4MGYR 1E63A 1WCIA 4D9HA 1PQ4A 4UAGA 3COJA 4EY4A 3OAAD 3QVSA 5BT8A 3HXKA 1YMUA 2Q7OE 5EKSA 3UM9A 3B7PA 4MRRA 1PWEA 1NE2A 1K7YA 1GPBA 1MZVA 3N59A 1XNRB 1QUEA 4S05A 4TQGA 1LRKA 1XEXA 3FKQA 2B4YA 3H3JA 3KU1A 4AJKA 1U4NA 2DT5A 4B44A 4UTNA 5JAUA 1N1GA 2IIBA 1FX0B 1WSDA 3D2BA 5FR2A 2ZDQA 2Z2YA 1VL2A 1TTHA 1C9MA 3ESRA 1DRUA 1RU3A 4H0FA 5FI0B 1JVBA 1TMYA 3KWMA 4V0SA 3ZI0A 4Y9UA 2JFNA 5JCXA 3AR3A 1BGXT 1EU1A 1UMBB 1F6BA 1IZ8A 1O87A 3BL5A 1CUYA 1ESNA 3DE2X 3ETEA 4M38A 3VAZA 1PN3A 4JEUA 1SB8A 3SHFA 4E1VA 3D4NA 3D7LA 4BYMA 1H3EA 4XYMA 4C5CA 4KAFA 3DT6A 4Q02A 4X97A 1DC8A 2QMYA 5P8WA 4DC1A 3AF2A 4YN3A 3JWHA 1XRSB 3OZRA 3FNIA 2OV3A 1G8AA 4QPJC 1AS0A 3W2IA 3LTNC 1SHTX 2GAJA 4TWBA 3NT2A 1EJ2A 1ZD4A 2HLDA 3JD3A 1L4MA 2VNIA 4ALJA 3OOSA 1PR6A 1D07A 1GQOA 4B3IA 1VECA 4I5EA 1Y89A 2FPKA 2P1RA 2H7CA 2X3FA 2Z3WA 4N82A 2PJZA 1J22A 5HBGA 1ZM2A 1XZLA 2E6KA 5HTKA 1NR5A 1H2HA 1ULTA 3DJFA 1UODA 1KA9H 1WP4A 3AX6A 3ETHA 2GI4A 4B45A 3W6PA 7GPBA 2P2DA 2AN9A 2J5KA 3NYWA 1FP1D 1N1MA 7ABPA 4MR8B 1DEOA 2A0UA 5KYTA 1SOWA 3VC2A 3COVA 3GEGA 3EY4A 2QQFA 4C6TA 4JXZA 3L0IB 1U3FA 3GUVA 4IJ5A 1IUOA 4YAJA 4DZRA 1XEWX 4HP8A 5C46F 3FNHA 4PLHA 3BF8A 1D2GA 3DOEA 3DOHA 4Y0VA 4B0OA 1S3FA 1VB3A 4E5UA 5KTYA 3UHJA 1P4AA 3N07A 5EPOA 5COBA 3K1JA 2NO4A 3NBZC 4YAKA 1HFJA 4MVJD 2QSJA 3WO1A 1P0FA 2Q8NA 2AXNA 5CXXA 3K9GA 1G3UA 1OUMA 3TR0A 5A5DA 4U1RA 3IUPA 3SHVA 4ZGWA 1N78A 2LGJA 1FS4A 5FUBA 2B8NA 5H68A 4DLYA 1E9EA 1WCXA 5GADl 3PUVA 2B3TA 5G1OA 3OUZA 1WTCA 3RBVA 3EZNA 5D3MA 3BWDD 1BEZA 3UG6A 3M4NA 4M22A 4ZYXA 3DMHA 3IBSA 3BFPA 1CE8B 3IUYA 4MVJI 3AI3A 1UFRA 5A5FA 1FDSA 2GRUA 2Z1NA 4RBNA 4PFQA 3GX1A 3PXCX 2VHWA 1LDMA 5DN6A 1VBNA 1CUEA 1WW2A 2CUZA 1T8TA 1CZOA 2I78A 2P67A 4P5DA 5JZSA 5TS3A 2O5CA 5FQNA 4WNIA 2I2FA 3E6AA 4MSUA 4JOBA 5ENZA 4DNXA 3C3EA 1CY1A 1NVFA 2I3ZA 3C3XA 4IIXA 4II7A 3RVSA 3ZD8A 3I45A 1NVVQ 2EJWA 1OFUA 2VN8A 3HVUA 4O02B 4S0ZA 5C7IO 3L7MA 2ODWA 2GILA 3WB9A 1NQOA 3L4EA 3LUBA 2HSEA 2JW5A 2NSHA 2VAXA 1R6XA 4LJ5A 3VVBA 4EG7A 4MUFA 5LUAA 1V8DA 4EKDA 4TMXA 1C29B 3AHDA 2W4QA 3FAKA 5EP3A 4OA8A 2C9MA 3A9UA 1OKKD 4LDNA 1AQUA 4PNZA 3A10A 3IUQA 1M6VB 3EEYA 3TLAA 3RKUA 4CM4A 3I3OA 1ECCA 4ZVSA 4A6XA 4B5KA 4O4HB 1QCZA 3EN0A 1EZ1A 3LBAA 2YZ2A 4K5QA 5DI9A 1JG4A 2H2DA 3JATB 1ILEA 2B8EA 4B1FA 2C3OA 4YRPA 2SNIE 4FR0A 1GXSB 1UPTA 3W7BA 4URXR 2V9CA 4XWAA 3KKLA 5JANA 4AMUA 5ICFA 2X5OA 1M8FA 5FOQA 1ZUNA 3IP7A 3G2JA 3NHYA 4M9CA 4H3KB 5CVJA 5LN1A 4FWTA 2PT5A 2R2GA 2JA1A 4AF8A 1RMYA 4R9UC 3P0FA 5D5PA 2VWHA 3JAKB 2R1TB 2PEZA 3T9CA 3WLJA 3JD0A 4OKSA 5A7FA 5GTDA 4I55B 4QYWA 1XN4A 4GBGA 4KPUB 4RFSB 4YJ3B 2L17A 3D59A 3R7FA 3RWBA 4QKQA 2XUDA 4Q15A 4V0ME 3GUHA 1GFIA 3SBOA 1JMVA 3H9QA 4BMXA 1B6SA 5EJ9A 4AKGA 4O0LA 3WBKA 1A4XA 2RI0A 3N2NA 1E1MA 3IAXA 3PA8A 3LPCA 4JSRA 4XWTA 1CT9A 3FZYA 2ZQZA 3VPGA 4JJIA 3C7AA 3OTWA 1FRQA 1XZFA 1V3VA 3OOHA 1PNVA 1BEEA 3WHPA 2BDTA 4I19A 4PLCA 4C7KA 4JOQA 3REGA 2HF2A 5DCUA 2GQ0A 1FSGA 5B4UA 2UZ0A 1VRWA 2OHJA 2ZI9A 3HDVA 1SHKA 1IBRA 5JHGB 4RMJA 1O6ZA 1BROA 3R0ZA 3ZTWA 1VJDA 4ZOAA 3RYHA 1D6SA 2QVYX 1YL6A 2P4EA 3IAFA 4GZLA 1ZONA 2IU0A 3UT5A 2PUEA 1TAUA 3V8EA 2B1QA 3Q6IA 2PANA 4L8FA 2EDCA 3HKBA 121PA 1WUTA 4M7PA 4Y9TA 1JKJB 2JGIA 2YVQA 3BQ9A 4KSCA 4QXMA 3WA6A 1M2KA 5KYYA 4W1QA 1LZLA 1Q2UA 2ZSDA 2QTBA 3I6BA 3R8CA 4HAOA 3LUJA 4IXNA 1JQKA 1IOLA 5L3QB 1CEQA 1M6NA 1QFMA 1RI1A 2OORA 3QXCA 3KOXA 4PPQA 1TJ4A 2OSVA 1TM1E 3H8VA 5HCUA 4BB5A 2QV0A 4LTDA 2VF7A 2Y1FA 4DLKA 3C8HA 2PZLA 3CZQA 3RM3A 4P36A 1P62B 5THXA 1K1EA 3HY4A 5KNCH 3JY6A 4J76A 4PZPA 2YFHA 3ASYA 4M46A 1U1FA 3AERB 4IWNA 2D7DA 1CLUA 4BVLA 3K70C 2PT7A 2A88A 1OQAA 1Z2CA 1FVXA 1ZWLA 2R751 2V54A 2NYVA 3VPCA 3W2TA 1AB5A 1ID1A 1E2DA 3B2NA 3C2QA 3KO8A 2C3YA 3VTKA 3F8WA 3HYTA 5K45A 2GRJA 5CMLA 4FT4A 3GLGA 1K8XB 4RLFA 3CJQA 2OWDA 2F64A 3U17A 5KNDA 3HA3A 1NY5A 3IAM6 3FMPB 3EGCA 3HADA 3HK2A 1M76A 3CW2A 1PJ8A 3ZJ4A 5FX2A 1C3EA 3R74A 3OPNA 1T2EA 2HK8A 5WRFA 1RACA 3AY6A 4MRNA 4YACA 4YRMA 1LPAB 2QVBA 2YV3A 1FL9A 3F3SA 1M1XB 1G291 2BDUA 1DLIA 5AKYA 2QJOA 2XQVA 2CL7X 1HM5A 3R6TA 3G5UA 3LO8A 5G0SA 1GZ5A 4Y7CA 4BO2A 2FZWA 1KAEA 3KM0A 1LH0A 1KGDA 1XDUA 3AF3A 3K30A 3LKDA 3RR2A 1E3IA 1WZCA 4CCYA 4YCAA 1XDSA 2W6ZA 3G9XA 2BJHA 3PFWO 3KUKA 2O8DA 1XCJA 4ZAWA 4HRVA 5C5DA 1WB6A 4OL0A 3GA0A 3PXUA 4MS4A 2I03A 5HZKA 4BXOA 2FSUA 1W8DA 4HWSA 2YKGA 4LECA 3ABSB 5K2OA 3HBAA 1QO9A 1Y7IA 4D25A 1GJRA 2ATEA 2DWPA 5K0SA 1PZGA 1MCZA 3LMKA 1GYRA 2OOKA 2XI4A 3K6KA 4LKOA 4X1KA 4QUKA 4R2WA 2XW6A 3N3AC 1MQSA 3L5KA 3PCXA 4LZJA 1YI1A 4R0VA 5G4LA 5BQPA 4YP9A 1GA6A 1GD1O 5KJCA 4NENA 5LZ7A 4XVRA 1UKEA 3RS7A 1ITZA 2X9NA 5HHTA 3DHWC 4RO0A 1IM8A 3K6RA 8MHTA 4JUAA 3LF2A 1LLQA 1R0XA 3O74A 3UGQA 4L27A 1A9XB 1NP7A 2XMBA 5ERXA 2WV9A 2WSMA 3S1AB 8ABPA 1GNTA 2C4KA 2QTTA 4JJFA 3RRBA 2PU7A 3NR2A 3HUFA 2LDBA 1YAJA 2W83A 4GVPA 3AQ4A 3SDSA 3DCNA 4UHFA 4AC9A 4IHKA 4F9FA 3UKOA 5IH3A 4Z7JA 3DOIA 4CMIB 2Y1OA 4Y2RA 1ZUWA 4KZPA 1P17A 2OCBA 3FDFA 3KVRA 4G2TA 2FEWB 4GM0A 3W8DA 3OQ1A 4D42A 4GBJA 1Z3IX 1WW3A 4ZARA 2IQ5A 1KQFA 3LVBA 1O97D 1YCFA 3HGQA 4PW0A 3WY9A 4PVCA 5LMZA 1KP3A 3KZCA 4ZQIA 1QTNA 4YDSA 4AKSA 2FPIB 5BVHA 3IP5A 1XXHE 1DJNA 3L4KA 1EVIA 4DLSA 3STHA 4DR4B 3SI7A 2IJGX 1Z5UA 2KX7A 3CX4A 1C2YA 3DQQA 4BX2A 2Z56A 2C07A 3G0OA 3OIWA 2PLAA 4YRSA 3OEHA 4K1LA 5IKEA 2ZANA 3M5PA 4HCJA 4LHXA 4JODA 4E2ZA 1THZA 1E2QA 1R50A 2FKAA 1KVQA 4R8MA 3RTCA 4C78A 4RD2A 3U0BA 4PYMA 5KNCD 1FTWA 2DFPA 3V8RA 2ZS9A 3ZHTA 2EP7A 2FZGA 4LRSB 5EYPB 4C3VA 3KETA 4LHYA 2BFMA 5AP9A 4OBBA 5IDQA 4ZQCB 3PLNA 1XJ5A 1DE0A 1WKCA 3WQSB 2NZXA 2EW8A 3A9CA 3NTQA 5CT6A 4ENSA 3MUNA 5F35A 4AECA 2I54A 2JGNA 4GO1A 1A5BB 1YO6A 1W0JA 3DVAB 1OFUX 1H2YA 4FFOA 1XZAA 2XB9A 1NJ5A 4QNRA 2LCIA 3UGJA 1OIXA 2WPDA 5K4AA 2CLIB 4M0DA 3ZJTA 1L4FA 2PGLA 1E2BA 3EZLA 5IZCC 3DBLB 2QSUA 1ONNA 3MC1A 1SXHA 2JFYA 2W93A 4KQ9A 4JYPA 3NXSA 4QTXA 2A0XA 1FFWA 1K88A 2JI7A 3N0RA 3ACCA 3FDXA 3N7UA 3OKAA 5J1TB 2VYVA 2J31A 4KHZA 3IAM1 5EIWA 1NR1A 4IS3A 4MGKR 2WAOA 4QT0A 2ABWA 2O5VA 1T6YA 4G1CA 5ADVA 4A0RA 2V3VA 5LC1A 5F7OA 5FYQA 4E4YA 3ETDA 3RO7A 1H66A 4GLLA 4QOJA 5AJZA 4LDPA 3ZHOA 4B4VA 3KSAC 4ZV4A 4PHGA 4PQFA 5JY1A 2W2MA 1TC1A 1KBQA 2JLSA 1LVHA 3R7BA 2OV2A 5E1OA 2BEUA 2C2KA 3DF7A 3F9CA 4TTAA 1N5OX 4RJJA 4ML3A 2ZULA 2YVAA 5IAEA 4U5XA 4EG6A 2YBEA 1RKQA 4JYAB 2IYLD 1CVRA 2COEA 2X9GA 1JIIA 4MR9A 1RC8A 2CL6X 2RGBA 2BSQA 1W0KD 1YULA 5E8JA 1OW3B 5K3SA 1Y98A 2F1IA 3MF4A 1EXDA 2B9VA 2V7EA 3I8OA 1SC9A 4IYJA 5A4MS 4PAOA 1L7EA 1AO0A 3NBYC 2KI5A 3NVKI 2EKBA 3TSCA 3L0YA 4BKQA 3FNQA 1UT8A 2GK3A 5LDHA 5M7EA 4HDKB 1OLUA 4CDMA 2GJ9A 1TCVA 2FWBA 2YNMD 3LHKA 4UUMA 5DCYA 4GLFA 5DGCA 5BOSB 2HQBA 4RXUA 1IXYA 4HDSB 5TMBA 3R09A 1R00A 2XBUA 5EGSA 3OBBA 4DQ0A 1NDHA 4NDAA 3P0EA 4DIOA 1LSOA 3A1FA 1YBAA 2ZE8A 3AIMA 5A5GA 2D7CA 2WD9A 5F4ZA 3D2LA 3DZHA 4D0SA 1TVMA 3I64A 2I2XB 3G89A 3WRXC 2XKJE 3B7WA 4PAGA 4CEHB 4KR2A 1J07A 1CF4A 2R6AA 4IMJB 2Q62A 1I2ZA 5LSAA 4TN5A 3R5JA 4R9NA 2ONJA 5GOTA 3SMQA 2HV9A 1IIRA 4RA9B 1V47A 1BO6A 2X8JB 4AMGA 3HJBA 1IN6A 3TB4A 1L3BA 2V7XA 2ZIXB 1K75A 3BFKA 4LZOA 5JC8A 4DBLC 3C3DA 2UUBB 3P0RA 4P4LA 3GZTB 4KLNA 2XYHA 1UWCA 3EG9B 5HIIA 4DV2B 4HDRA 3MHTA 2JRCA 3ENNA 3PUKA 4B35A 1V7CA 1M75A 3AIKA 3CRRA 4G9EA 1OASA 4UDOA 5CRIA 1QO0A 3SGLA 3ZUGA 1I7SB 3EXEA 3IULA 5KX5A 2G9NA 3E22B 3NHWA 1CY6A 5AOCA 4TV9A 4BIMA 4W5RA 4BBAA 4NOMA 1J97A 2A1TS 2QUIA 3AB7A 3L2OB 2OXTA 3VYTB 3T38A 2V6GA 3UAWA 1A8UA 3E2PA 3PV0A 3TSZA 4E08A 4Z6KA 2CV2A 3FVQA 5T67A 1RYHA 4REQB 3EH1A 2EHJA 3LUGA 3RUPA 4BNNA 1NVGA 1CIPA 4WI1A 3MCTA 2XWQA 3JQ9C 3DVSX 2FEKA 4A2CA 5EWJB 1G55A 1G3IA 3CV3A 5AW6A 1ZVQA 3QVMA 1QBGA 3PB3A 2IOFK 1EM8A 3S99A 2CB9A 5JNVA 1OBOA 3TKAA 1S8FA 1LU9A 1SEVA 1T2CA 3NBUA 3QFTA 4INAA 1JHRA 4QOSA 3STWA 5EZ6B 5KC8A 1Q3TA 3ESYA 3K0AA 4BRWA 3AB3A 4LRYA 3TBKA 1RI5A 1JEYB 5H8WA 1ZHHA 1POXA 2G09A 2YIDA 3IALA 3KEMA 3TVTA 2G9RA 5EJ4A 1RZRA 3O75A 3B1VA 3B2QA 3GLHA 1Q11A 1WQ1R 3IEUA 4CZ2A 3DL7A 2EL9A 1ZESA 3AF6A 1F38A 2JAHA 5A4IS 3FDIA 3LJKA 4MS3B 3LO5A 1Z08A 4Z5XA 4NEHB 5F2NA 2CLCX 2BFEA 3KFXA 4ARIA 1HTTA 3G1WA 1APBA 1UK7A 5HDQA 2LW7A 2OHFA 3ZZ0A 3KZKA 4DEXA 1VFNA 1U3WA 1WDKA 3RS3A 1KMHB 3L9WA 3DULA 3RRNA 5HM8A 4ENQA 4PLYA 2EFJA 2BMEA 1XXLA 4MR7A 1SXJD 4L28A 2ZRHA 4ZXFA 3AK4A 4XPZA 4CMJA 2GO1A 4P35A 5I3ZA 1T9ZA 2IC5A 3EBOA 2V9PA 1DBQA 3EHEA 1ZA2A 1BMQA 3MWEB 3BWYA 5ALVA 3R3UA 1IXRC 1XVAA 2PFKA 3FD8A 4KVZA 4UULA 3ZK7A 1P7WA 3BXOA 3O4HA 3R4CA 4PG7A 5FI1B 4AWBA 5AJWA 3Q4GA 4ZHSA 2O2XA 2EBHX 1B0ZA 4JXJA 3JAWB 2XYQA 1UBJS 5TF4A 3SU8A 3I1YA 4ILKA 4OP3A 3RS9A 3UJAA 2D5LA 1QCCA 1SUEA 2A9KA 1Y8QA 3H5OA 5CDTA 1RABA 4KXVA 1VRCA 4OYHA 1T5OA 1CJKC 2X8AA 3QVGB 5K0LA 5ALPA 4B7ZA 2BKXA 3B6IA 1I9GA 3AR7A 6REQB 1S8AA 4JB8A 4LISA 4D9BA 1QVWA 3ZXYA 3H7AA 5DYYA 2XKBA 4FE4A 1ZLXA 4WFKA 3VU0A 4C4RA 1XTVA 3LA8A 5TIIA 3CX6A 3LY9A 1N32B 3F73A 5CJPA 3CM0A 1N7IA 2XMQA 4O1IA 3EPHA 3S2FA 4PYOA 5DHRA 4TSRA 1T5DX 2CVHA 1JH8A 4QGSA 4AZ3A 1GGFA 5SZJA 3ESZA 4YCBA 4BMYA 4WBNA 4FWBA 3JU3A 4NMWA 2FSGA 2O1XA 2C2ZA 4FGSA 1RZUA 4QU5A 1JTEA 2JFVA 5IVHA 2P5YA 2HXSA 4ABYA 1KGSA 1D7AA 3R0JA 3TE6A 4WSOA 4QM7A 2HJWA 1S3GA 1EINA 3G7NA 1PR0A 3HFRA 4X94A 1TVEA 2N47A 3FYUC 2YS7A 4YV0A 2RE8A 1QAMA 2CJWA 2J4CA 3AXTA 4KAJA 3KYCB 2W2VA 3L7KA 1MUUA 4NS4A 4BWGA 4B7XA 2WSYB 1E7MA 2P2YA 3L8CA 4BLPA 1EGAA 1AZWA 2ZITA 3O5AA 1JW9B 4MUIA 4UBNA 3ZCXA 1C8VB 2VDQB 3WQHA 4BKRA 3EPJA 3AEYA 1PE0A 3B3AA 2RG7A 2OCGA 1OBHA 1BEUB 3A7EA 3Q7IA 3SC6A 1Q7TA 1QH1B 5DLPA 2QRZA 3LAWA 1FLNA 4LZPA 4ZTUB 5FUWA 2LVBA 2DE0X 2IBMA 4IGAA 1I14A 3GJ4A 4RKFA 5DDIP 2NZJA 3R9WA 4M0FA 3FTCA 1VLMA 1KY3A 5BPHA 4NBKA 4US2R 2WZBA 2A5JA 3FZNA 3DBRB 1QDEA 2V3WA 3O8NA 1DWPA 2AJTA 2B92A 2IZ5A 3KOMA 3OM8A 1QPBA 1USKA 1ZIXA 3MNFA 4LX0A 3FW1A 1HO3A 3RD5A 4NZNA 2CNWD 3TBFA 3TNJA 4EAQA 4B7CA 1DQZA 4U7HA 3GRFA 1KQPA 3EZ6A 3IOCA 4M9RA 3SXPA 5E9AA 3Q9LA 1J5PA 3AJAA 1FFCA 5EP4A 4LZWA 4BJ6A 1NMSA 4CEJA 1RMQA 1F12A 5IXSA 4ZYYA 2R44A 3HJCA 4FEEA 2ZS8A 1ENOA 2IU3A 2ZSHA 2VOEA 4P6VF 1O57A 4Q6WA 2UU9B 2XRMA 3IKVA 4N6GA 1LQTA 2QXYA 1XFDA 2VHQA 1BWRA 3DWEX 1LKZA 4IIVA 4KI0A 3VV3A 2ZIWB 5LQCA 2QYTA 4BJ5A 4RSMA 3TI7A 2Q0XA 4Q3LA 1EXMA 4GXRA 2YXLA 2JVKA 4EA7A 2PUFA 3I6MA 4N41A 1CUVA 4LSWA 3IODA 1YRLA 1Z4PX 3OJ0A 4R9SA 2PT6A 1W2GA 3MBKA 2Z08A 1FP4A 3G9QA 4FOTA 1T8RA 4RJIA 3ZE8A 1C81A 1CJCA 1F4VA 2P6RA 5G2OA 1L4KA 5A4AA 3LDFA 4TL7A 2RMKA 2XAAA 1QNLA 1PTKA 1XYYA 2XUZA 3T54A 4EF5A 4JROA 4PZAA 2FJ0A 4JL6A 2VHEA 4MUHA 1H6BA 1NI3A 1KI4A 4YHHB 3LV8A 2M6RA 1DCTA 2YIJA 4H7IA 1VP3A 4DVGA 2ZTUA 3NHAA 4OP2A 4ZRMA 2PX2A 5ITVA 4XWWA 1Z5WA 3SOPA 2JIBA 3AFMA 3GVIA 3KFLA 3ADDA 4Y98A 1GGHA 1EMDA 1QFJA 2H2HA 3BMCA 3ROZA 4HQLA 4CE6A 5JSZB 2XE8A 4JLNA 4QOHA 3ZY6A 1TXGA 1U5CA 2XUIA 5TGDA 5CLHA 3V80A 4BZPA 1JFVA 3BS4A 2C4UA 1K63A 5TPZA 2WDZA 3TD6A 2AZXA 5FD8A 2XB2A 3D3WA 1SOMA 2I5PO 2QTMA 2BH2A 1XL0A 4D96A 1PYOA 4UVGA 3ZCPA 4C7VA 1X80A 5G0VA 3WGYA 5HZHA 1FYDA 4YBZA 2O54A 1QWOA 1FYFA 4IM7A 4WK2B 1CZHA 4MW5A 1XP8A 2UUPA 3LQFA 1D0VA 2OILA 1J1UA 3ETJA 2OZVA 1FNDA 1BMFA 2YHIA 3PVSA 4G5OA 3GHYA 3QLJA 4FFVA 1JLSA 4K3VA 5EQTA 1DDIA 3W5IA 1LC0A 4RTQA 4WUTA 2BUAA 5DNWA 1DZIA 1UFKA 5HIKA 3GOQA 4L75A 5ENDA 1F8YA 2QAGA 2BAGA 3BHMA 5BQFA 2WAYA 2B6HA 5BSUA 2YJ5A 2FGJA 3U80A 4Q1AA 3CZMA 4LGMA 2O2HA 3OT4A 5CPBA 3FNBA 4Q34A 2GBLA 2BFBA 1X7YA 1SHJA 5DXFA 4CODB 1M74A 3B3FA 4BNFA 3CFYA 4L9SA 1K2WA 2BFFB 3OESA 4Q9AA 1ZIPA 4LXHA 1SB9A 3O1IC 3MIIA 1US8B 4O6VA 4XDHA 3QEAZ 3L43A 2IIQA 4YCNA 1V1JA 1F6DA 3DDUA 2O2ZA 4KMRA 2FW1A 3WAKA 3ST7A 2HDWA 4R41A 3PX2A 1LLFA 3W5BA 2GBCA 4QJBA 3QYJA 4DOMA 1AM4D 1MG5A 1XI2A 4QOFA 1SG9A 3GARA 1N9KA 3GW8A 2IV7A 1Y1KE 2PS3A 2XOKA 3IFSA 1FY2A 1KL7A 3B1ZA 4H17A 3CYFA 4XGNA 2FEMA 2P6PA 3ENKA 4PM4A 2DJIA 2OHHA 4QOGA 1DV1A 5BN3A 3TLYA 1FLVA 2JLQA 1XD9A 4QBGB 4UNRA 2R79A 2NXCA 4I6JA 1CR2A 3QVVA 1C0LA 1XZBA 2G80A 3GOHA 4FHEA 4YPFA 2HMSA 4L4YA 1K5PA 2BGLA 3A4LA 3HFSA 2VP2A 2VP5A 1D7OA 4EYGA 1L4NA 1XKLA 1C4XA 2C5BA 2YWCA 2WKSA 3SE7A 4HAWA 2QLLA 2OCPA 1NJ1A 1XAHA 2I6GA 2OAP1 4DXAA 4E13A 2II6A 5LZ5A 2BFAA 4BEBA 4RF2A 3G5AA 4XYLA 3MQ4A 2D00A 3KXLA 3JYPA 2JIPA 2C8LA 2PBZA 1HYHA 2XCOA 3LT5A 1RBQA 1XD2B 2YBDA 4IUYA 5IUKC 5IUJC 5LWQA 2WM9B 2WYWA 2WQ7A 4WDRA 4MARA 3VX4A 2PE5A 3AWDA 3WL5A 1TUBA 3D31A 3GJQA 4UOEA 2Q28A 3NHRA 4AJ1A 3WFJA 3ZV6A 1Z4MA 4QSMA 4QPZA 1FYXA 5CXSA 2XVAA 4HUJA 1C9KA 2IZOA 4LCJA 4WK0B 3LGAA 1P2VA 2AYXA 1M2VB 1X1DA 2DPXA 1CS0B 5G0WA 1JWAB 1H2XA 1QHHA 5D7BA 4B87A 1IZ7A 5JROA 5ICSA 4WNAA 3QELA 4CQMD 4GPTA 1Z75A 4MB6A 4MDFA 4KBFA 3DQPA 3A28A 3QLUA 5EP2A 2IUFA 2OGSA 4LVCA 2OG2A 1RHQA 3ER6A 3LCCA 4H1VA 1JR2A 2G88A 1YQQA 4EY3A 4BVFA 5CAEA 1GFZA 1FDOA 3OQMA 1Z6AA 3DC7A 2QAJA 3HNPA 3PXEA 2ZRKA 4JA0A 1F0PA 1Z7BA 4L8LA 4RAQA 3WGGA 5A9SB 4MV4A 1C3JA 3PFHA 1N4AA 1ULUA 2GLUA 3HCRA 5F4BA 3LLCA 3D4PA 3EVNA 4LC0A 2JH9A 3UFBA 5JMOA 2BISA 1G21A 4MKFA 4HAXA 4W5HA 1TKAA 5C0OE 4CV3A 2G08A 5LZ2A 4EH1A 3LBHA 1XGKA 3KQWA 1O0BA 5G40A 5LQMA 4F7WA 3LLUA 3EZ2A 3R44A 4YI3A 4TPKA 4BNZA 4EGFA 2X9LA 1NPYA 1NYTA 3FBTA 5DI3A 3DA8A 1F2TB 5CEJA 1RLUA 2CB0A 1P72A 3CNQS 1T1GA 3GGCA 4LDRA 4P3KA 4Q47A 1V4NA 5ANRB 2DCUA 1VHQA 1VJ0A 3HYCA 5ALOA 5J2TA 3K0CC 3ETCA 2CL5A 1SVWA 2W6IA 4BZZA 4ECEA 4R0MA 3A1VA 1ZMBA 4YR7A 2V98A 3CPJB 3TNFA 4F8EA 3OSZA 1KEPA 4YFYA 2WYIA 4RZ3A 2BHSA 4IX1A 2I22A 3DE7X 4KMSA 4R8RA 1CZUA 2NP6A 1JEAA 1XAJA 4F93B 3IURA 4ZKEA 1DRKA 2QZPA 2J87A 2EARA 5DVZA 5IM4F 2X77A 5B58T 3I1JA 5LMCA 4C5AA 3F67A 9LDBA 4P22A 4IO1A 5JS6A 1VG1A 4I8IA 1DKRA 1OGJA 4GAEA 2F67A 5HMMA 1HI9A 4L8VA 1F17A 2H4ZA 4D8VA 3FOWA 4QODA 4M99A 3T5AA 2VNKA 1A9SA 3S2SA 4QA9A 4D3XA 2R8YA 5KUTA 4X62B 3ZLUA 3IIEA 4C1BA 2CFSA 2ZVQX 3TIFA 2ZW9A 1CD5A 1UBHS 2Z6QA 3KPYA 4ZT7A 3G49A 2ZIVB 4WZAE 3FOCA 1JNYA 1X1CA 4UVIA 3DHNA 3KLPX 4H77A 5FJJA 4IIJB 4LE1A 4CU2A 1B26A 2LKCA 3MGCA 3UK1A 2F17A 1XNQB 3C1OA 1R0LA 2CBGA 3FJ1A 3TAHA 2H1CA 4QUGA 3TTWA 4UUPA 1EFCA 2K6GA 3ILHA 1A2QA 3RUCA 3QKSB 1EHYA 5F5XA 1EI9A 3CIOA 4ND5A 1M1YB 3CEMA 1TQHA 1TT5B 1Y33E 1Z8DA 4KR0A 4YRLA 3LPLA 1WUKS 5CEEA 1Q1AA 1SKUA 1T3ZA 4X1OA 3LUFA 4BU0A 4E1BA 3VDMA 4CV0A 4D6XA 4HRAA 2FW9A 2J9RA 1BVYF 2P2ZA 4TKZA 3GEHA 2XTJA 3SZ3A 1N2IA 4UJ5A 4LJ8A 5ETJA 1BXRA 2J0QA 3ZNPA 2P0YA 1IJFA 4CTKA 1K97A 5LM3A 4CM8B 5JQGA 4XWGA 3M9XA 3RSFA 3O91A 3ZVNA 2XV1A 3HP7A 3DT9A 3C6YA 3L4BC 1NVWQ 4ZO6A 1YNOA 4YT5A 3WLKX 1O54A 3ZTTA 1Y3IA 5IT9A 2QN1A 5ELXA 1M9NA 4PSKA 3NRCA 5T3UA 3PF8A 3BTVA 2IHUA 2YJ4A 3VYSB 5K9ZA 2DQSA 1JJVA 1HYGA 1V8FA 1JQJC 1U4SA 3R3HA 1V9CA 1XRQA 4F3YA 4KWEA 4B34A 1U94A 1ZNXA 2G04A 2XNKA 1NXVA 2Z2JA 1EVQA 4G4SP 1ZQ1A 3OO1A 4I3GA 2JFUA 1PAUA 4L1KA 5GVRA 4Z1OA 2J0SA 4CKWB 2REQB 4F97A 3HU5A 3A37A 5IT0A 1KFJB 1CDDA 1XE3A 3FHTA 1PGOA 2QVCA 2HT6A 3OZUA 1TD9A 3WYEA 2IYXA 4HXYA 3J7AC 1FX0A 1SOVA 3NG1A 4BV3A 3FR7A 3QF7A 2Y4OA 4NG5A 1XTTA 2E82A 1WX1A 3W77A 1U98A 2R84A 5EZYA 3HQ4O 1KK0A 5H9WA 3FYCA 2Z5VA 1QRRA 3K8YA 4KE7A 1U3CA 4HBGA 5F9HA 1HDCA 2C5SA 1GU7A 5J5AA 1UBSB 1ZHFA 3M2PA 4MKZA 3BJIC 3P2YA 3ZK8A 1SC6A 4XIJA 1UMBA 4ER0A 3NVMB 2ACWA 3L79A 4EZEA 2ZIEA 5GM2A 2PPLA 3EFEA 5BWOA 3DOCA 4UHKA 1VSQA 3ADOA 4DXDA 2YV2A 3R40A 4Z9FA 2C96A 4UU7A 2V59A 4TMKA 5LXTF 3WMRA 2NWQA 3IP3A 4Q05A 3V7FA 3PWKA 3W05A 2PUJA 4XD7D 4RVUA 1A9PA 1P0QA 3GAZA 1MC1A 2P7IA 2Z5FA 3D6TB 4ZREA 2H1SA 3A3KA 3JR3A 3PG5A 2M6SA 5IASA 4ZHQB 2VXBA 3DMYA 2PMKA 5EAIA 4RKQA 1T2UA 2Q4RA 3FOEC 4G84A 1WIWA 1BWPA 5EXPA 4BVEA 1OYOA 3U4AA 4L85A 3UV7A 1B8PA 1ZVJA 4KO3S 1NUUA 1G5FA 2PGJA 1GZHB 4M1QA 4H35A 3L0BA 3SBXA 1I4TD 4FMPA 3UEOA 2LV8A 3T5DA 4MR8A 4OI1A 3C7TA 3AW9A 1LQ2A 4MA5A 2ZUWA 4NZ9A 3EGOA 1A97A 3FVTA 1EK0A 3FOBA 2E1RA 4MQUA 1NVBA 1SBNE 1H0SA 2J6BA 2C4MA 2RONA 1USGA 3KUUA 3VH4A 3VU1A 3YASA 4QG3A 2NSLA 4GW3A 1TYAE 4R7TA 3RUEA 1FMTA 2HF7A 4UMEA 5KVSA 3NCHA 4M60A 1PF7E 4U9IS 1NDUA 3VPBA 4BMOB 4RHYA 4BEWA 3LRPA 1KXJA 3KJIA 5JATA 1XMOB 4BZQA 2C1ZA 1MA0A 4KMMA 2J9FA 2ONCA 2PS9A 2ZETA 3ON5A 5AKHA 3RBAA 3LT1A 4KIWA 4DCSA 4PYIA 1Q83A 2GBIA 5EHQA 4BLUA 4BMCA 2Z9DA 4FBGA 3EEQA 3B38A 3CF4A 1YR2A 2E4VA 4QU8A 1TCUA 1UXOA 4YS6A 1CE8A 3G2IA 3B60A 2ZBQA 3SKXA 4D4JA 3RSGA 1ENZA 1N3BA 2ZEJA 4OAPA 4X6LA 1RIIA 4GFDA 2QN7A 3GGPA 1VB5A 2PGXA 4XB6B 3W06A 4DQDA 5JBQA 1AS3A 1BRTA 4M36A 1SQFA 4FFBA 1RFGE 3G0DA 5AJVB 2QN6A 3R75A 3TM4A 3M1LA 1EHIA 3VR5A 4AMBA 3ZCUA 1GNSA 1M8KA 1OU0A 3D0QA 4KQIA 2BBWA 1YKFA 5CFLA 5I9LA 5C1PA 1TI7A 1WDTA 2PQ2A 2PSSA 4Y6OA 4PTLA 1VZ2A 2FQWA 4QTYA 4QEDA 3V4ZA 4INJA 1E4YA 3OPXA 3HJHA 1FS6A 3HA5A 3RVLA 4J43A 4C7BA 1BX0A 2VDJA 5DW0A 1BDIA 1YBFA 2WWIA 3PVZA 2BF7A 3UMCA 3NOQA 2JVIA 3OQHA 2V0GA 2ZJ7A 3IAAA 3KQYA 3KOUA 1MVLA 4RJLA 4J1TA 2XRYA 5DGTA 2IS1A 4JEHA 1HL7A 1O9HA 3KXIA 1KPGA 1M6VA 3KQPA 4X7BA 4YQZA 5LR6A 1XZKA 4O4HA 1PRYA 1RJWA 1V96A 4UM8B 3OZWA 1JDBC 2ID4A 3K9NA 1UDRA 3N2IA 4R5HA 5J1SB 2VT3A 3PNOA 2W6JD 4TQUS 1HNNA 1V11B 3B6ZA 2WWWA 5CT5A 4ER7A 3VO1A 1JTVA 1R8YA 3V4SA 3EA0A 4CMBA 5HWSA 1F14A 4OO3A 2IOQA 4ESOA 2OK8A 3GRAA 2H1HA 3JAKA 1CRLA 2R1TA 3GDOA 4G23A 2XOXA 5BYKA 3KJFA 4UXHA 4AP9A 5JJIA 1CF2O 4KPUA 3VHXA 3E1KA 4RFSA 3V6MA 4YJ3A 3NGLA 3DEAA 2P6NA 2VJPA 1S01A 1AGNA 2YJGA 3HDYA 4HLQB 3V32A 1ML4A 1AHPA 4KEAA 2F4VB 3S44A 2C2BA 3SJZA 4RK5A 4CMGA 4URZR 4GMKA 3NWPA 2GCIA 2BHNA 4AVYA 4RGVA 4BMPB 1Z6ZA 1ORRA 5FB3A 4DKXA 5KWEA 2C88A 3TUJC 4WVLA 2OESA 2PBRA 3A32A 4V0QA 2HSZA 3GLFB 1EBFA 3IEXA 1BKDR 3BJRA 1YDHA 3I8SA 3O03A 1XKQA 2E21A 2W6OA 3G79A 3PCTA 1YBHA 3TFWA 2WI8A 4AUKA 5FL7D 2LTAA 1FJ2A 4BWVA 5EZ5A 1HA3A 2Q2WA 1MZPA 5FT9A 1O7JA 1J8YF 1LF0A 5BN5B 4BVKA 5C8YB 4HAUA 3FPKA 2WF8A 4KGVA 4MVJM 1DXYA 2BGIA 1G16A 4HFMA 4D92A 2A57A 1GCAA 4A2QA 3X1ZA 3D8NA 2IPAB 4PFJA 4H6VA 5LYJB 4BE4A 1GSIA 2R4UA 5AYVA 3VR6H 3E15A 3EGVA 1UANA 2QZSA 1UBOS 1QHNA 2WMNB 3QX7A 1Y1QA 4CKYA 4RJKA 1PZNA 4BFCA 1A2KC 4RVNA 3L1UA 1E1LA 1JKJA 2BHRA 2H2FA 2FHSA 3QEBZ 5D51S 3R3ZA 4OK6A 3JTMA 3QSGA 1SY7A 3VR4A 2YWJA 3WGIA 1WPQA 2ZRFA 2Y67A 3O9VA 5L3QA 2UXDB 4O4IB 3GFPA 2QP4A 2EGHA 3I2JA 2AFIE 4GNRA 4IKPA 1RRVA 1SPBS 5EMMA 3SD7A 3THYB 3MMSA 3UMJA 2ZWMA 3I32A 5CDFE 4GR5A 4H0CA 2DQKA 1B00A 2P75A 3L46A 3OFKA 3TH5A 4X6YA 5A1TA 5C32A 3ZU2A 4QDOA 5F1PA 3PQCA 2WB2A 1C9NA 1N2EA 1AURA 1RE0A 2R8OA 3JASB 4P7BA 2K7FA 1J90A 4WOBA 2P41A 4CG1A 2FG5A 2F43B 4QREA 1L2TA 1UOQA 2J0UB 3I6QA 1N2JA 4JR2A 1WHSB 1KYWA 3A1TA 1JHMA 3RIXA 2WKQA 1VMKA 3UENA 4Q5IA 3VZDA 2IEIA 1E0DA 1VOTA 1IUNA 4IFTA 4MNTA 4BU1A 3IV9A 4OMDA 3OIUA 4XB1A 1K06A 2Y4NA 5CURA 1Q20A 5JPCA 2F55A 1MNAA 1U9IA 1BU5A 3AHJA 2JCVA 3UGKA 1N0WA 4LDAA 4AP5A 3P2IA 3JYOA 3TEFA 3D3JA 3FMIA 5CTAA 3C5CA 4MI6A 3K2BA 3EWNA 1QR6A 4MCAA 3D9QX 2W2XA 1TF5A 5EPEA 3WG9A 1I3OA 2ZXFA 4ZRDA 4BC0A 1FPMA 4G0OA 4NEGA 4C4YA 4JVNA 2IP1A 3ER8A 4HX2A 4R3NA 3ENZA 2YV5A 4RCYA 5EHNA 1OMOA 4B6QA 4BO7A 2RK4A 4D8TA 3V6LA 2AQ8A 5C7YA 1FPQA 3OCUA 3DZGA 1NVKA 5DNVA 1WB4A 3D02A 1C9EA 1BA2A 5IWAB 3AUTA 4IMPA 4MQ5A 4LV6A 3KV3O 3MAJA 2MSWA 4G0PA 5IJXA 2JVJA 1OWMA 3SEQA 5CK4A 1HYBA 3D8UA 1T34A 2YMPA 3DXYA 3GY0A 3MELA 4F2GA 2WJIA 3FWZA 4A26A 2C2OA 3A3YA 4A0FA 4BZXA 5K8UA 3DO6A 4I6EA 1K8RA 4HB0A 2AZDA 1P0IA 3HWX1 2UYQA 3ZCSA 5FWYB 2PSEA 4EFMA 1QDLB 2RGNC 5HE8A 2HRCA 4YJGB 3GAMA 4RPGA 5EXEA 2ECOA 2QRNA 3T4EA 3HACA 1MBZA 1Q1NA 2P1ZA 3U13A 3GPCA 1N3YA 4NMXB 1D1TA 5CNJA 3C6KA 3QVKA 5DSTA 3FY4A 4GI3A 3RBXA 3DTVB 2WOJA 3RU2A 2PJDA 5F73A 1V4VA 4WCFB 4PCLA 2N75A 2DQZA 5KJEA 3RNLA 3DE4X 2ZBFA 5HSGA 3RTAA 2ZK7A 4R68A 2C9YA 4QUHA 2GVNA 4GQAA 1A7UA 1PK8A 1X8XA 1A2OA 4LGVA 4QG7A 2VOJA 3RGWS 1TZMA 3K9LA 2Q6OA 1YZ3A 2D4HA 1GQSA 2F3SA 3S1AA 2R0QC 5LJLA 1J8VA 5CITA 1HTBA 1XTRA 4UC0A 4KIUA 3F0TA 2CLHB 5AM2A 1DQPA 2W90A 2CMDA 4MW6A 3RGGA 5LVAA 5J47A 3ABOB 3CVVA 3B3GA 1U2TA 4CMIA 1W4AA 3PHCA 4P80A 3SZRA 3P2OA 1X7WB 2VJDA 3C1AA 4LXXA 3JQ7B 2HZ7A 2R00A 4GD3Q 2YYAA 4D43A 2C7RA 1O8CA 1IL0A 3FSGA 1Q21A 1UXIA 2QRLA 1JG7A 1GL3A 2GR9A 1NJGA 4J4BA 1TIKA 3VR6D 3OZBA 3MILA 4MRMB 2X5KO 4S2UA 1I8TA 3QW4B 2VP6A 4R1LA 1NXWA 3DMTC 5AW1A 1UZUA 2J07A 2FPIA 4IQ8A 2BHLA 2JJ1A 1XG5A 2ETVA 3K7EA 3F5SA 4UPEA 4UOZA 2WM8A 3CNEA 2AW3A 2C8KA 2GFHA 1P4GA 3B5JA 2PWPA 4QUIA 5ALDA 4A3SA 3OVMA 1T0IA 4EHNA 5K0TA 1J23A 4HN2A 2NT3A 2FU5C 3IR5A 3OE5A 1S9DA 2C42A 2XOEA 1RLJA 2IYNA 1XZ8A 1M2NA 1SH7A 3KB8A 2XD9A 3HMKA 4IRUB 2EZUA 1P75A 5BNZA 3VTAA 2A4KA 4CF6A 4ND4A 3W2FA 1Y5NA 4UMFA 5FYDA 3O31A 4IDPA 3AUYA 3VUEA 4C89A 3ZGYA 3N2ZB 3P2KA 3QA9A 2OGWA 3OU7A 2R60A 3UXYA 5KCMA 4EUHA 1C7ZA 2QUJA 3NDIA 5IHXA 3DE5X 1EX1A 3TZEA 3UCXA 3HU1A 4LAFA 5EXDA 2YX1A 5BN1A 3VO2A 3VYWA 2Z9BA 3DVAA 4QXAA 4MUJA 4IDCA 5ELMA 3IERA 1NQVA 1ECFA 4GS5A 4I0WB 2XMPA 3MYYA 4XM2A 1LB1B 1VYUA 2AR7A 5ALWA 4O3MA 4OU5A 3HKEB 1RM4A 4XIGS 1KNXA 3NWBA 1JFFA 1K86A 1GL6A 3NM5A 4CFSA 1KHTA 5AKLA 3UCEA 4B83A 2OUIA 3AZOA 3DBLA 2VQDA 3P2EA 3SYLA 2EYUA 1YBMA 3WBJA 5AQ1A 4JJZA 3A1DA 1IFXA 2O3UA 3PDWA 1UT6A 2W22A 2QUHA 3WB0A 5CDGA 1IVNA 3ZHSA 4YMTA 3LS2A 4GYJA 1X19A 2IY7A 1TCAA 1ZUD1 3RU7A 1A69A 4QELA 1CYDA 2NPOA 2DPMA 1FMJA 1GG8A 1ZEJA 3WKAA 4QDKA 1JI0A 2R68A 2XF8A 4DCJA 1Y6FA 2NMVA 2I6XA 1IVYA 2IIPA 4Q3OA 3Q2IA 4Y3UA 3GFVA 2Y1KA 5IPFA 4A27A 1ID8A 4ZICA 4C03A 2K2WA 3WKBA 1MJHA 2R5FA 5DASA 1Y9DA 4DR7B 2AKAB 2Y77A 4PZEA 3BX1A 4V0NA 1IN7A 2PYIA 3R6GA 1P77A 3H05A 4M1WA 3NATA 2YQZA 2Y0PA 3JYHA 4J9UE 5F1KA 2ZBDA 3IVGA 3BFJA 1PV4A 1XRRA 3CEHA 3I5UA 1E32A 1LV7A 1CJMA 3T5TA 2Z43A 1JR3A 3ZWBA 5LP6B 4DR2B 3G59A 3KSRA 3H6HA 5AIAA 3K16A 3W6UA 1SQGA 5ADHA 4XASA 2OBNA 2VK2A 4KQ1A 1M66A 1MDFA 1UFOA 1D1PA 4F3RA 2A9VA 2Q45A 3Q7SA 4JDPA 4R01A 2X0DA 1ZN7A 4HDKA 4ACAA 2YMLA 4CETA 4QHTA 4WE3A 4K6HA 3G8CA 1JR6A 5BOSA 1TB4A