3B77A

Crystal structure of a ph domain containing bacterial protein (exig_2160) from exiguobacterium sibiricum 255-15 at 2.42 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
188
Chain Sequence
b'DIGQVIHPDDFDKAAADDYVLHEDGEKIYFLIKSKTDEYCFTNLALVHLDGESASKRVLYRYPYAHYPIRHVMFETAGTVDLDVEIKFEIGGKHYSIDVDKKQLEHVKDLYKALLAIAEKQYEGQKMLEFANSSLNHSVTILGGLRQGDMNVPQTFKDLSQESFDWLQGHYYKWNQKDFGSFYEKYIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Bacterial pleckstrin homology domains: a prokaryotic origin for the PH domain.
pubmed doi rcsb
source organism Exiguobacterium sibiricum
molecule tags Unknown function
total genus 56
structure length 188
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11724 YvbH_ext YvbH-like oligomerisation region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3b77A02
2.30.29.50 Mainly Beta Roll PH-domain like Bacterial Pleckstrin homology domain 3b77A01
3B8NA 1K33A 1MOFA 2LP7A 1QR8A 5HFLA 4FIPC 1Y66A 4G2KA 4N21A 4JGSA 2P6JA 2EZPA 1K34A 1QR9A 2EZOA 3CP1A 3HSAA 1F23A 3P30A 4E2LA 1QCEA 3GWOA 5CN0A 1QBZA 1SZTA 3B8MA 4JF3A 1JPXA 1EBOA 2EBOA 3MHHC 5H9CA 4N23A 5KA5A 3K9AA 1DF5A 3CYOA 1DLBA 1Y4MA 1I5YA 2OT5A 5HFMA 1JQ0A 3DCXA 5KA6A 3H01A 2M7WA 4FK5C 1DF4A 1MG1A 1ENVA 3MHSC 2X7RB 4JPRA 4FJCC 2MK3A 3WFVA 5CMUA 1I5XA 3M99B 3B77A
chains in the Genus database with same CATH superfamily
1XD4A 3F5WC 3CWBH 1OCZB 5LG4B 2EZPA 2NZ8B 1H8EG 1WB7A 3AG4B 1WPBA 3EXAA 1WVHA 2HJDA 5B1NA 2D2QA 4LF9B 1P7GA 1XL4A 2DN9A 4FLTA 1YI2V 4ZRIA 1UNRA 2GTAA 3H9VA 4I55B 1R6KA 3LSSA 5KAIZ 2BTQA 4HAUB 2YICA 3CSXA 4LFAO 3APOA 1O9HA 4R6ZA 1FXKC 2IM9A 2QTSA 5LGNA 4DX8A 1SRYA 4UCVA 4JI1B 4XDLA 3SYQA 1OV9A 5CA1A 4B3TO 2JS3A 3B8MA 4H33A 1EZVH 2EMSA 5TISZ 3F5TA 1SESA 5FPOA 2R9AA 4TV8A 1J19A 1R3JC 3BA9A 3PJSK 3WB0A 1UPQA 1E1QG 1AB3A 4J9YB 4GZUA 2FJUB 4QJ5B 4I9QA 2GS0A 4HAZB 3CCMV 3SUZA 4RWUA 3HB3B 2QKMA 2EX3A 4MW3A 3PVUA 2ITCC 2YXYA 3BABA 1KZ7A 4K3AA 3D3IA 3CJHB 1PFJA 2YS3A 2QDOA 3E2EA 2O57A 4I4TB 4F7GA 1OCRC 1P84F 2XNDG 2Q0OC 3IVFA 1F51A 1X59A 4NXMB 2B1GA 1YIJV 2UUCB 3HKCA 4JYBA 5DI9B 4Z1MG 2DA0A 2VSZA 2XASA 3K06A 3CRRA 3K08A 1O9GA 4PA4A 5KQ4A 4J7ZA 3QO7A 2BCCH 5FLXN 2BTQB 2CTQA 2DWDC 3CCUV 4JGSA 3AJ4A 2PYLA 1FXKA 4IHJA 1SZXA 4PD4F 2RSGA 2EIJC 1Z5WA 4O2AB 4PI2A 4JI7B 2L1CA 2Q8VA 4GNKB 1MSDA 4DO2A 1IBMB 1VQOV 2HP8A 2D9XA 2OIGA 3RVZA 4OGQB 1H2SB 1YZBA 1UPRA 3ZRVA 5DM6V 2QWPB 3AU5A 3G4SV 3A98B 3CXBB 2ZE6A 2VQEB 4CH5A 1Q86W 2YI8A 3ABMC 4I7ZB 5B3SC 4LWSB 2KIEA 5D3YA 4R8CA 3D36C 4DYLA 1UNQA 3P32A 3ODOA 5DHAB 4K8XA 1H2GA 2E2XA 1YVWA 2YIBD 2V76A 3ABTA 1BQZA 1FPOA 1BSMA 1ZSPA 1R3IC 1FGZA 1KB9F 1TVKA 1JX9A 3H1KH 1KQSU 5KUMA 1US6A 5EFXA 3SJAC 3RYCA 3ODWA 3B2EE 3E83A 3W7TA 1Y67A 2DX5A 1QR9A 4FLYA 2KB1A 2X0LA 3V5WA 2BCJA 4PELA 4NY0A 1FXKB 4IHJB 3NXSA 2QM8A 1VQ4V 1EFRG 1EGXA 2QJ1A 1WP8A 4C7UA 1Y76B 4H44B 1B6QA 2JK5C 4JI0B 3CCSV 4MY6A 3FYEB 3RT3C 4JI0O 5EYPB 3AG2C 1D5NA 4CC6A 4HYOA 3SPJA 2JS5A 4CH4A 2YRYA 2LQTA 4X1IA 2UXNA 1BTNA 1GKFA 4EKUA 1NU2A 3OANA 5IYDO 1LUWA 1U96A 1ZC3B 1I5XA 1P7BA 2QA4V 1OCRB 4X89A 1THZA 3QBVB 4DV4B 3Q4HB 2ZXWC 5BZBA 3HW2B 3LNNA 1XREA 2UU9O 3VQVA 2KIGA 2KKWA 4OT1A 2W6JG 5J2UA 4DV4O 2MW2B 3OEEG 4IAPA 1KP2A 4JYAB 2A0LA 4I50B 1K3EA 2VKIA 1BZKA 1MAIA 4Q20A 4LNUA 4PDRA 2UUBB 2WLMA 1AJQA 2IJJA 4P9PA 4JYAO 2QEXV 2EIJB 2Q5ZA 1GTOA 3HK0A 2VQFO 3L70H 2VWJA 3IC9A 2GSMB 3BINA 2DWEC 4HAMA 3DXRA 4JTAB 3AK2A 5B5EZ 4LFBO 3AG3C 1J0WA 4MVMA 4CC5A 5K1PA 5B3SB 3ZRXA 3OMNB 1KC8W 3E8HA 1MZEA 3H01A 2D4QA 1FXHA 1ENVA 1XNRB 4WBNA 4U3JB 4X1IB 4G27B 2OCCC 4JI2B 2LYDA 4DR6B 1FS0G 1M56C 2OWOA 3GWKC 1M1KW 1V54B 2Z0PA 4JI2O 3AK1A 4DR6O 4PA3A 3TXQA 1IURA 4TUYB 1XNQB 1AVMA 3CYOA 3S3XA 1XI1A 1ROPA 1QU7A 5LP6C 3IFXA 2PZSA 4IL6Z 4X1KB 4QE9A 3CC4V 2RVBB 3CPWU 1JCHA 2JGUA 4J9ZB 3OE7G 2IFSA 1K4DC 1Y74A 5AG2A 5LA6A 1DK1A 1GC7A 3FM8C 1P4RA 1TUBB 3J81N 2RNBA 4J11A 1MNGA 3D8FA 1SHCA 3SJCC 3FD9A 1U5DA 1GG3A 3ZMVA 3JD0A 3WG7C 3T1CA 5KAFZ 2N05A 4F4LA 4U7OA 4JAVA 3AG2B 3CE2A 2WLIA 3I56V 4LFCO 1G6UA 4X88A 2QE7G 1N34B 4GXBA 2DYRC 5LHGA 2LW1A 3JAKB 1N0NA 2GCJA 5ITZA 2N23A 3K5MA 2CTRA 4ZKIA 4OX9B 3TVVA 4IGGA 3CCEV 5B1AB 2Z3YA 2R9IA 4HB4B 2YVCA 4LP8A 1JOYA 3A8PA 1I94O 4LF8B 2UZSA 3CC2V 1HNWB 5LP6A 4DV6B 4IIJA 5LYJA 1Q7YW 1H2MA 2ODMA 2A9HA 4LF8O 2AL6A 1AP5A 1HNWO 2DQ0A 1HWYA 4DV6O 2UXXA 1U5GA 2Z0AA 2MDXA 1R3LC 5BR8B 1JR9A 4MVUA 1SQFA 4D0NB 3J7AU 3WB2A 1UJWB 2VRWB 2B5UA 5C6RA 2HG5C 5BR8O 2B1IA 4D6WA 2QKCA 5LMUB 1AJNA 3MPXA 5KHGA 1PP9H 2Y8FA 2NMBA 1WNSA 4HNAB 3FB7C 2R0DA 2XAQA 4F6EA 2OQBA 1IDSA 4DUYB 4PDVA 2GTSA 1WGQA 2CGOA 1XHXA 3SYAA 1YJ9V 2OCCB 3ULCA 2UUAB 5JH7A 1DLBA 5KUKA 2UVMA 3ZHQA 2E75B 1S5HC 3O96A 1ORQC 4E4EA 3ZMZA 4YL8A 3ETQA 4K81A 4GPTB 3FB8C 2OTLV 3PZDA 4FLWA 2ELBA 1FGYA 4DR7O 1F4MA 2P0HA 1VQ7V 1H2KA 5LYJB 2RDCA 3ZBHA 4YJ2A 1IXMA 1JPXA 2H3OA 2YIBA 3BA8A 1OY2A 4TKNA 3ABKB 2ROZB 3HPLC 4X1YB 4X20B 2P4KA 1YITV 1KI1B 2KQXA 3X2QC 2MWNB 2QWOB 4KHBB 4DX90 2M38A 3E8GA 3HKDB 3CCLV 3ZN0A 4ZIBA 1K7DA 2YEVB 3WG7B 2YS5A 5H6RA 3SR2C 3PN1A 3T06A 2Q73A 2PUSA 4DK1A 1NVPB 2ZCEA 3OTFA 4X65B 5GOWB 1NR7A 4KAXB 4EB6A 3H1JH 4D6TH 2ZKOA 3VBBA 4GT1A 1W1GA 2LJ2A 3L74H 4IYHA 4MT8A 5JP4A 1IX9A 2Q7EA 2ZDIC 4GMVA 5DHFB 2BOCC 1AR5A 2G38A 4X66O 1X05A 3DXCA 3ASNC 3UO2A 3VQYA 5GONA 4ZHQA 1H2NA 3W7SA 3MAQA 1Q6UA 2IH1C 3L9DA 4L6EA 4DR4B 1SQGA 1A32A 1MPHA 3KY9A 4JI3B 1MIXA 4PV1B 5HE1A 2XAFA 3EVKA 4ASUG 4JAUA 4O4LB 4JI5B 1M7EA 3THOA 1XKEA 4UXNA 4PHZA 1WJMA 3LSUA 1N36B 2EINC 2JDIG 3FEHA 1Q8IA 3K57A 1V5UA 3ZHRA 4WFAV 1H8HG 2ELAA 3U12A 1N36O 3J80N 2GV9A 2PGGA 4N21A 4R7CA 1VQ6V 2P6JA 3OR7C 1M5IA 1PL4A 4JAAA 3CIKA 2FB5A 2JGDB 2HTHB 4JF3A 4ZRJA 5GTHZ 5IWAB 3FYIB 5DEDA 2LFSA 3PSCA 4I0XA 1NBMG 1NT2B 1HDJA 2BTOA 4IYIA 5KHJA 4BIUA 1WA8B 4WVFB 4A6HA 1K9MW 5I2MA 4DV3B 4DR5O 1GN4A 1KP3A 5CBHA 3ZJZA 4LF7O 4O2BB 3GVMA 4KHPB 1ZSQA 2WLLA 1PLSA 1XL6A 1U5FA 1Q6IA 2CUGA 2WAMA 4KHOA 1ZLZA 3A58A 2YF0A 5I2SA 1Q6HA 2QKLA 5CA0A 3D8CA 4YHHB 1TGOA 3TCUA 1J5EO 5HE3A 4QJ4B 2CK3G 5E1AC 2F93B 2W2XC 5JVDB 4JV5O 4Z2NA 4BW9A 1QQGA 3X2QB 2Y0IA 4QE7A 4PNKA 2EIKC 3ZHTA 3WB1A 4X62B 3ZDTA 4TOIA 4PA9A 5D3XA 3FB6C 4FK5C 3FVCA 4PDMA 2Q67A 3OW2U 4JPRA 2RUKB 2VS0A 4X64B 1AI7A 3ETDA 4B3MO 5IT9N 2JRIA 1UEFA 3TJTA 2E5LO 1L1FA 3MDBC 1SC5B 3OTOO 4YIPA 4WFBV 3TO1A 2Y69B 3SYPA 1YJNV 4MVZA 4XDJA 3SO6A 1N0JA 2Y48A 5CA3A 4YONA 5JQGB 3MD0A 1L0LH 4JZ2A 2CODA 4TT3G 1Q81W 5CLLB 1IZ3A 4MVQA 5IJ9A 3K79A 4OPAA 1VQ8V 4HHVA 3HSAA 2ZKMX 4FZ1A 2LGWA 1GRJA 2EINB 1OMWA 1SERA 4Z2WA 3FAVA 3B09A 3ZMTA 5JHGA 4LFAB 2K2JA 2UZRA 3JATB 4J42A 3TW1A 1Q90D 4GOUA 3OEHG 1P5TA 2Z13A 5C5BB 3SYOA 4B3TB 2I1JA 2BSKB 2EJ7A 4F6RA 2OIEA 3KZ1A 3BRCA 1E5WA 1COWG 1JFFB 2XUMA 3KZIZ 1GH6A 3K0DA 4MVOA 3HQCA 2Q0AA 1WG7A 3M1IB 2ZR3A 2HVKC 3RYFB 4WFEA 1H2LA 2GJYA 1VF6C 1M93A 3W7XA 3UT5B 1W2BU 4B3SB 5B1BC 1BHAA 2WWWA 3SYCA 1R73A 3MHHC 1K92A 4B3SO 1BT8A 5H5NA 2N0YA 1EN6A 2W0FC 3N2KA 2YT1A 2JEUA 5IE9A 3RGBA 1R6NA 2UXCB 5B66Z 1HR0O 1JMKC 4FJCC 3G9WA 3U8ZA 2KUQA 5LOPB 2AW9A 1GN3A 3JASA 3ZMSA 2UXCO 3EHBB 3SGIA 2EIKB 2G35A 5BY1A 3BJIA 2NN4A 2GDSA 3AU4A 4O4JA 3CB2A 1ZC4B 2W6IG 1GMGA 2H94A 4CHMA 1VQ9V 3JYCA 1U29A 2D9ZA 1HP8A 3K9SA 4LH6A 3CX5F 2X18A 2D3OW 2CY4A 2DJVA 5CA1B 2JIZG 1XMQO 4J7JA 2LG1A 1DF4A 3ASOB 2K9PA 2I5CA 1NU1H 1KBHA 4TV8B 3M99B 1OQNA 3M7MX 3T1HB 3OHMB 3SYXA 3STLC 1OCOC 5IY5C 4BBKA 3F7YC 3LDCA 1F4NA 2BOBC 1D5AA 3T1HO 4IOYX 1VF6A 2K2UA 1LW3A 5H9CA 3UO3A 5E79Z 1OCCC 3DXDA 4DV5O 1NS1A 3CCJV 1FD9A 4BW5A 3HKCB 2MKRA 2XOKG 2AHZA 4YY3O 5CBGA 1G4YB 2EJ8A 1S0VA 3P30A 1RJ2A 3M8AA 1XBLA 3SPCA 2ZE8A 4O4JB 4TQFA 1L8DA 1XQ8A 4JZGA 3A0RA 4B6HA 2Q9LA 1X11A 1AI4A 1NJIW 4HAVB 5DN6G 1SKVA 2MFQA 3BFRA 3D8DA 1L0NH 2ZT9B 4LCUC 4DV0O 1XR0B 1IBKO 1W1DA 3T2MA 1Y5OA 3P7ZA 1YJWV 2PYJA 2CRFA 3BCCH 4HB2B 4GZRB 2XAHA 4XBFA 3RN4A 3E89A 1SETA 3OT7A 3VQXA 1K97A 2UU9B 5JJEB 1DDVA 1TVKB 1WLEA 3C90A 5B1OA 2HR3A 4UUJC 3U10A 3RYCB 3NWFA 5LBQA 4L1RA 5KA5A 3L73H 3L75H 1KECA 1G8MA 4MW8A 4CYEA 4H13B 5J3TA 5CB4A 2N04A 2Y0PA 5GTIZ 2L35A 2VQFB 4W4LA 5J2TA 3TGUH 4BAYA 2LFRA 5LGTA 4CS3A 5JCOC 2OTJV 5L3DA 4LFBB 4WF9V 1GM7A 3FSSA 4F7HA 2DFKA 2HKOA 1YHQV 1W0JG 3ABMB 1RSOA 3CXCU 1WI1A 2AGAA 2LOXA 1VMGA 2D9YA 5CMUA 3ZN1A 3W7WA 1P3RA 2EULA 4CSQA 2ARHA 1IXBA 1OCCB 2YXLA 3AG1C 5KHIA 4K35A 4ZOLA 1R3KC 2DHKA 3ZX6A 3I55V 4HAXB 4EFBA 4A6FA 2KG7A 2X6CA 3OD4A 3K5NA 2RCVA 3RYHA 1T77A 2Z0QA 4WFGA 1G1XB 3ETGA 3LUTB 4UV9A 5J2UB 2EIMC 2NLJC 3B4SA 1LNQA 2GCLA 5EBLC 3JAWA 2HFEC 4LNUB 3CMAV 1V9PA 5BXZA 1D2DA 3ZHVA 4CS2A 2E76B 2ZINA 1U27A 2QGNA 5JCOA 2P7TC 4EJNA 4DUZO 1GM8A 3G71V 3HKEA 3ABUA 2D9WA 1KD1W 3RBZA 3DXRB 5IYZA 4LFCB 1PPJH 1PKXA 3S3WA 4RAIA 2LOZA 4DV2B 1Q5OA 2YUAA 1AR4A 4O4IA 1FHOA 4JTCB 3QWMA 1AI5A 1VQNV 4WBNB 2P0DA 1YTFB 2DX1A 4DV2O 1QCEA 4P2ZA 1NH2B 1QLNA 1XCGA 3JSNA 1BTKA 5EK0A 5H6QA 2ZIOA 4TQDA 1QNMA 3SJQC 2RRFA 1I94B 1NR1A 4J10A 4J80A 1WGUA 3KCXA 3RYHB 4Z1VA 5D3WA 3RVYA 2ZXWB 2QR4A 5EZYA 2Q6AA 3SPHA 3OFNG 1K5QA 1PNKA 2RN9A 3PVWA 2KR0A 3CP1A 1ZL8A 2QM4A 1B06A 2XQNM 1Y74B 5LA6B 2GBOA 2RNRB 4GYCB 3T1YO 1DF5A 5L3BA 2OYQA 4UB6Z 1Y4MA 4GKJO 1H38A 4FMTA 3HKEB 1DTOA 3DC5A 3DTUB 1ZVRA 3CRCA 5LMNB 4L8JA 2H8PC 1ZUQA 4I5SA 3AG3B 4KFMA 1FB8A 1W59A 3CHXA 4CH6A 5BMVA 1E79G 5LMNO 1SQVH 3OR6C 1H4RA 1M57C 2WLIB 3U0ZA 3N2GA 2DW4A 3BY6A 3TXSA 1QBZA 2JJ1G 5LGUA 2ADZA 1BQ0A 2NBVA 3KKYA 4QXAB 1N32B 4XWXA 1Q3EA 1M56B 4QJ3B 1XDCA 5ITZB 2YI9A 2COFA 1BS3A 1N32O 3HIEA 2X7RB 1BAKA 4DR7B 5L3CA 1JA8A 2YT0A 1I08A 2WSSG 3AK3A 5C8YA 3BEHA 4MTGA 1Q43A 1SF9A 2K49A 1YDXA 5LHHA 3PVLA 4Z2MB 4EMOA 1GK9A 5LP6B 4IIJB 2ZM6O 4MT7A 1I7AA 3WYFB 1X4TA 2XAJA 4DV1B 4DW0A 2DKPA 1WJZA 1FJGO 3ULBA 2Z14A 2H7DA 1PD3A 2P06A 2QM7A 4DRXA 1SGHA 4DV1O 3LJUX 2CGNA 4LF4O 2Z5UA 4CS4A 1KZGA 3ICXA 4JI6O 3E22A 2YDEA 4G2KA 4QIWF 1K4CC 3A0BZ 1TUEB 1EBOA 5LXTA 3PP2A 4UCSA 5J9PC 2IJKA 3N2GB 1VP7A 4R50A 4X66B 3K5LA 3DCXA 1MMMA 2DYRB 1EVHA 4FM0A 1KUQA 1J95A 2DQ3A 3NR7A 1XX0A 1M4UA 3HKBA 5JH7B 1HNXO 1V5MA 2BE3A 2LP7A 4FIPC 5JJNB 5C79A 2GUZA 3P3PA 2J59M 4UCOA 2K8EA 1KKCA 3KG2A 2YS8A 1URFA 1VQKV 2IH3C 3OGCC 5HE0A 3ABLC 2K00A 2QWRB 4EKWA 2ADQB 4YJ2B 5L3EA 1MA1A 2KCJA 3ZCCA 1RP3B 1VIBA 2CAZC 1BMFG 5DIFB 4KP4A 5LHIA 1CEZA 1K33A 4QGPA 1S76D 3JCZA 3RYIA 2R2YA 1DYNA 1LUVA 2FYUH 4FLZA 4FLXA 3E22B 1XEQA 4YIOA 3CCVV 3E8BA 4J41A 1VQLV 4A6KA 3WU2Z 1CPYA 1V55C 3CS5A 4RQFA 4MS2A 2CDYA 5D5QA 2HEPA 1M57B 4EB6B 3OUSA 3MHSC 4PA6A 4DR1O 4DR5B 2HE7A 3KRWA 3A0HZ 3P3NA 3SNHA 4FFBA 1GC6A 4HATB 3ML0A 2P90A 4LF7B 4A5KA 2ZNJA 4B7EA 3R66A 3KRXA 1EZJA 3FX7A 4B08A 1K8AW 5GONB 1HNZB 1PNMA 4ZHQB 5FNVA 5IJ0A 1DDWA 2EJRA 4AILC 4UFZA 2VRZA 3NW8A 4CHJA 2YXHA 3K9AA 4EFEA 3ODXA 3ZRWA 1HNZO 1Y6XA 3ZIAG 4GLXA 1J5EB 1KYOF 5KMGA 1QVFU 4BR6A 4D7TA 5KX5A 4ZI7A 4JV5B 4FPPA 1QR8A 1GN2A 1EAZA 3VQWA 3TETA 3DXEA 4GKKO 4O4HA 4FFKA 2QWNB 2WA4A 3IAYA 3RYIB 2WLJA 3CEIA 4HBNA 4FLVA 5EC1C 2J0JA 1QQCA 2V4DA 4JYYA 2PY5A 3FB5C 5FI1A 3AEIA 1N8RW 4B3MB 1AJPA 4WJ7A 2QKSA 4JI8O 1RM1C 2E5LB 4CBCA 4I0XB 3ZS8C 1NZ6A 3OTOB 3GYOA 4CH3A 4FFBB 3JAMN 3G6BA 1EF1A 3A2FA 1VARA 4EEQA 4I55A 4ABMA 2RLOA 3ASNB 3T4ZA 2WLLB 4LF5O 1NI2A 4F7UP 1SQPH 2H7EA 2UXBO 2ITDC 1BGYH 5J3QA 1VF7A 2P8VA 1MOFA 2UXDO 3ABLB 5CA0B 2HJFC 4KVGB 1FHXA 4DR2B 1X1GA 4QJFB 5K1XA 2EILC 1XUQA 2Y4TA 1NTKH 3X23A 5EIBD 4DR2O 2P67A 4TWKA 2NNUA 4HDQA 3N27A 4GX5A 3CJHA 3DC6A 4I4TA 2ROVA 1V55B 4QPKA 1PNLA 3B40A 2Q69A 1OZ0A 5LONB 4KUMA 4LF9O 3ML4A 3QVNA 2M7WA 4W4KA 1MG1A 1LB1A 1Z5VA 3T4DA 4O2AA 2L6LA 2PI4A 4RO2A 4UVAA 3O9OA 2F66C 4JI1O 2A06H 3SDLA 4TYZA 5IJ9B 3LDDA 1HR0B 1ZX3A 1TQZA 1R6TA 4LWSA 1VEWA 4FZ0A 3OMIB 4PI0A 3C3SA 2CAYA 3FAVB 5LOVA 1SQXH 5JJJB 2PZ1A 2CTWA 1N33B 2X6BA 4HB0B 2V7QG 1VF5B 4QNHB 2QTOA 3IGAC 1N33O 1FAFA 2EBOA 2ZQMA 4Q6GA 1ZM0A 1RM1B 1XMQB 3JD2A 4F6RB 1FOEA 4NB5A 1IVSA 5HFMA 4IFSA 4RQEA 2ADPA 1I2HA 1MABG 1NVPD 2IU0A 4NXMO 2HHHB 2Z0OA 3K04A 4UV8A 2UUCO 4TV9A 1MK9B 3NWDA 1PL0A 5KLVH 2IYBA 2HHHO 2F43G 2ZE5A 2XTAA 1X86A 1WB8A 2RQ6A 4DV5B 4TSFG 4OPHA 2F4VB 1MZFA 2R09A 1Y76A 1ZWIC 3VOUA 3K03A 4JI7O 2IBZH 1P49A 1S5LZ 2F4VO 2PI5A 1IBMO 2COCA 4LC1A 4K2PA 3WFVA 3F7VC 1JJ2U 3WA0A 3DGEA 4YY3B 3IJ4A 3N2KB 5EYPA 2PF4E 4JI4B 2VQEO 4RUEA 4K17A 2IW5A 1UNPA 1V88A 2EILB 1JVMA 2P5OA 3QNEA 2DOSA 5LOVB 3JASB 4JI4O 5KQ1A 3OAAG 2IU3A 4MK0A 2WLNA 4L87A 3ETEA 1V54C 3JCUZ 1I5YA 4JASA 3JD1A 2RMKB 2J0MA 2DE0X 4HAWB 3Q4HA 3JD4A 1BL8A 4HB3B 2MK3A 4DV0B 5FL7G 1IBKB 1GM9A 3I5DA 2OTXA 4GN1A 1ISNA 2Y7BA 2ETNA 2ZNIA 4UCRA 2F1MA 2DYSC 1YXBA 4I50A 1T5EA 1M90W 1F23A 2ATKC 4TV9B 4FLUA 5FI0A 3RWRD 1EN4A 3JALA 3JD3A 2FKXA 3FKSG 2V1DA 2ZD9A 2PTMA 4AQYB 4HSIA 1FAOA 3DSQA 1CXZB 3QO5A 4AQYO 5B1BB 3ZEDA 2AEHA 3K5OA 4MTOA 4KXRA 2A3QA 2HVJC 3D36A 2D9VA 2C2AA 5D3VA 3QIJA 4NKGB 3L71H 4DXAB 4PDLA 4KHAA 2FMLA 4U3JA 3SJBC 1AP6A 4DV7B 1Q67A 4K2OA 4MTXA 1U2BA 3EFFK 2Z59A 5CBFA 2LGQA 4DV7O 3RCPA 3SPGA 2YS1A 2Q4PA 3TFMA 5EBMC 1W0KG 1FYJA 1BE3H 1E1RG 5B1AC 2Q7GA 4TUYA 1B55A 3OGIB 4D7SA 3A8QA 2DTCA 3CRAA 2E74B 4X1KA 4WSFA 5EIBC 3ZHSA 2Q68A 4G28B 5IDJA 1OCOB 5IY5B 3JALB 1FFTB 3E35A 1SA0A 2CY5A 5DH9B 3BVOA 4X8AA 1VQ5V 1TUBA 2UUBO 1N3HA 5FPRA 1SS3A 3QF7A 4U3FH 3SV1A 3N7CA 4OXSA 2AHYA 4K8ZA 1BWNA 3QG5A 2VWKA 3STZC 3UKMA 2QSAA 3OM3B 1ZTEA 1K5DB 1ZYIA 4GMXB 1BCCH 2ILMA 3APQA 5EC2C 3JAKA 1KU9A 4MVRA 1S5JA 5CB4B 5EBWC 5JWPA 1XNRO 1PV0A 4DUZB 3GB7C 1NKDA 2X6AA 3UM7A 5J2TB 1W1HA 5A9GA 1K34A 2F95B 3VOQA 5C16A 4QPJA 1FXVA 2Q13A 3PG7A 4HAYB 2CH7A 1S72V 3UCSC 2EC1A 2YC0A 4MVSA 1LR1A 3SPIA 1XNQO 2DYSB 4ICGA 1RSOB 1XOUA 3ABKC 3UZTA 2P0FA 3JSLA 3OMAB 1SA0B 4NTXA 2Y8GA 2CTPA 1UFIA 2N74A 2FJLA 1FFXA 4PJ0Z 4P7IA 4DK0A 4AHCA 3A8TA 3BPZA 3C3TA 3NWAA 4GX2A 1DDMA 4ZOLB 1H10A 3IC7A 2ZE7A 5H2FZ 2DLWA 4YJ3A 3H1HH 4A6FB 3KCYA 2IJHA 2KG7B 2R9RB 4FVMA 4K0KB 4WFFA 3KSYA 1M9NA 2YSUB 4HNAA 2DHIA 4K0KO 1IBLB 1QVGU 2YIAA 1Q82W 4IT5A 1NTZH 4PQ0A 2QKAA 2ZPYA 2AXTZ 2IJIA 3K3WA 3CD6V 1QLEC 4ZRKA 1N34O 2W2XD 3JAWB 2JP2A 1IBLO 3GWOA 3T1YB 1K73W 4GKJB 2FTKA 1AR1B 2D10A 1M7RA 2WLHA 3JARA 2R70A 2D2CB 4DR3B 4OX9O 2CH7B 4JYCA 3G80A 1U97A 4B7KA 4FM2A 1DBHA 3BHPA 5L3GA 5IYZB 2WLKA 4DR3O 4XDKA 3CCQV 1AWEA 1RPRA 4X20A 4X1YA 4E2LA 1UPGA 5CN0A 1EN5A 1XMOB 3O65A 1AROP 2ZR2A 4O4IB 2KUPA 2D11A 2L2IA 4LF6B 1FFXB 4NVPA 4DXWA 4KHBA 5LL6Y 4C0AA 2OCHA 3CXHF 5GW7A 3HKDA 2EMTA 1XMOO 2COAA 2OT5A 2P4VA 3AG1B 5KHHA 2YEVA 4LF6O 4AI8A 5JLJB 4NR1A 4YJ3B 1XHZA 4GCZA 1AQCA 1F7YA 2Q7HA 5D27A 2LW7A 2WA3A 1V5PA 2ZM6B 1CP9A 2LO1A 5EZYB 5LMUO 5JHHA 2F23A 1TXDA 1X1FA 1YF2A 1FJGB 4U7NA 4NTYA 2EIMB 1NTVA 3CRMA 1OHHG 4DUYO 4GX0A 1QHTA 2XT9A 3ZRSA 3U11A 4UVCA 1TJ6A 1B3QA 2JJ2G 4LF4B 4P30A 1JQ0A 1ZL8B 4DIXA 3AG7A 2UUAO 4X9QA 4JI6B 1MI1A 2W2WA 3CCRV 2LKOA 3RW0A 1FHWA 3H1IH 4LBEC 3JARB 2XAGA 4I9WA 1Z87A 2LULA 1WPXA 3BAAA 3H1LH 4RUFA 2DYQA 4O4LA 1RPOA 2P22C 4A5UB 1I0HA 1I7FA 5BMVB 2HLDG 3U7DA 4N23A 1S3JA 3D3QA 1MSWD 3F0WA 2YT2A 4MSWC 1HNXB 2RGNB 2I1KA 2GHYA 1NTMH 1RFYA 4HZ3A 2JGDA 1V61A 3E8FA 1SQQH 3GYPA 3K58A 1Y66A 5J3YA 2JVDA 1OJHA 2EZOA 1B04A 4UVBA 1SZTA 5C8YB 3CRQA 1R1BA 1WA8A 4NXNB 3W7UA 1GO3F 4X65O 1DROA 5F2VO 2E3CA 1YCIA 3VIAA 1QLEB 3OUFA 5IRSA 4GUNA 4BIOA 4NXNO 1MKEA 1U5EA 2Y69C 3TK1A 5HE2A 4WFHA 2CE4A 4O2BA 5L81A 1Z2GA 4WCEV 1BHBA 2M14A 1NTYA 4JTDB 1YEWA 4DRXB 3ZMUA 3CC7V 2B9ZA 3TCAA 4PA7A 4H8SA 2GUMA 3P6AA 4MTFA 1VQMV 5M4YB 1XILA 3QO8A 3PEGA 2DN6A 3D8EA 1K5GB 4DR1B 1RRPB 1IRSA 4CZZA 4DR4O 1OCZC 4DW1A 1P6SA 1TA8A 4JI3O 3AG4C 4NTWA 1GN6A 2FL4A 5LXTB 2YIDA 4JI5O 4HDOA 5JVDA 3B77A 3B8NA 1WJ1A 3K59A 3HKBB 2ZIMA 1WAZA 5IYCO 3G67A 2A7WA 1AI6A 3CMEV 4J7KA 2GUZB 1FKAO 1TAEA 4LR3A 2K1EA 5D5PA 5IWAO 1MK7B 4P9OA 2AZ2A 2ZDIA 4H37A 4GKKB 3R65A 3FFQA 2Z4DA 2RJZA 1VQPV 1NI8A 5C93A 1MIZB 4ZBMA 2M6YA 1YSCA 1XODA 2DYNA 1KMIZ 4DV3O 4Y94A 2KSDA 5DECA 3LDEA 5IYBO 1DGSA 4BWAA 5JQGA 4NSWA 4UCUA 2I5FA 4B3RB 4KHPO 2A79B 2R72A 4NYKA 4JI8B 2Y4UA 4B3RO 4UCTA 5L3FA 3ZVRA 5CLQB 2QWQB 3RFRA 1PM9A 4YHHO 1PMSA 3UQ8A 3QTCA 2NR5A 2KGXB 4OSNA 3JATA 1WP7A 5KCVA 2DKQA 3ZHUA 1Y19B 4DBBA 4LH7A 4LF5B 1SQBH 5C5BA 2UXBB 2JEXA 1ZAUA 5KA6A 5FNVB 5IJ0B 1YTFD 2BSKA 4YXWG 4X62O 4H0LB 2UXDB 2J0KA 2WPDG 1NH2D 4FM1A 3L72H 3ZRWB 1JJOA 1AILA 2W0XA 3G6EV 5HFLA 1NQTA 1JFFA 2DMXA 4X64O 5A2QN 3LSQA 5KMGB 3E86A 3ASOC 3MDSA 2YSZA 1GAXA 4KL1A 5KX5B 3HR0A 4UB8Z 4ZI7B 1K5SA 3K0GA 2XHBA 3LNMB 1WN7A 2AZ0A 1EM1A 4O4HB 3RYFA 1N4CA 4GX1A 1S77D 2DHJA 3UT5A 1HW7A 4BIZA 1KKDA 1QC6A 3NSUA 3F5RA 5KHKA 1V89A
chains in the Genus database with same CATH topology
1GM9A 3F5WC 3W7SA 4JTCB 1AI5A 1VQNV 1OCZB 2DYSC 1YTFB 2EZPA 1H8EG 3AG4B 1M90W 1F23A 2ATKC 1QCEA 2IH1C 4P2ZA 5B1NA 1NH2B 1QLNA 3JD3A 1XL4A 5EK0A 5H6QA 3FKSG 2V1DA 2XAFA 2ZD9A 3SJQC 4ASUG 1NR1A 4JAUA 1YI2V 4UXNA 1R6KA 3LSSA 3RVYA 2ZXWB 3QO5A 2EINC 2Q6AA 3SPHA 3OFNG 2JDIG 1K5QA 1PNKA 5B1BB 4R6ZA 4WFAV 1H8HG 1FXKC 4MTOA 5LGNA 4R7CA 4N21A 1SRYA 1VQ6V 2P6JA 3OR7C 4XDLA 2HVJC 3CP1A 3SYQA 3D36A 2C2AA 3B8MA 4H33A 4JF3A 1SESA 4PDLA 3FYIB 1DF5A 1R3JC 2LFSA 3PJSK 1Y4MA 5L3BA 4MTXA 1H38A 1NBMG 1E1QG 4FMTA 3EFFK 1DTOA 4J9YB 4BIUA 5CBFA 3DTUB 3SPGA 2H8PC 1K9MW 3CCMV 4I5SA 5EBMC 1W0KG 3AG3B 4KFMA 1E1RG 3HB3B 5B1AC 1E79G 4MW3A 3OR6C 1KP3A 5CBHA 1M57C 2WLIB 3ZJZA 2ITCC 2DW4A 3BY6A 2WLLA 1QBZA 2JJ1G 1XL6A 3D3IA 5LGUA 3E2EA 1OCRC 2XNDG 1F51A 1M56B 2Q68A 2B1GA 4G28B 2WAMA 1OCOB 5IDJA 5IY5B 1FFTB 1YIJV 3E35A 2X7RB 4JYBA 4X8AA 4Z1MG 2XASA 3K06A 5L3CA 1VQ5V 3K08A 3TCUA 4PA4A 2WSSG 2CK3G 3QO7A 5E1AC 3BEHA 4MTGA 2DWDC 3CCUV 4JGSA 5LHHA 1FXKA 1GK9A 4OXSA 2AHYA 3X2QB 2EIJC 4QE7A 2XAJA 2EIKC 4DO2A 3STZC 3UKMA 1VQOV 4PA9A 3OM3B 3RVZA 1PD3A 3ZRVA 5DM6V 2QM7A 3FB6C 4FK5C 3G4SV 4PDMA 2Q67A 3OW2U 4JPRA 1Q86W 2Z5UA 3ABMC 5EC2C 5B3SC 4MVRA 5EBWC 4R8CA 1AI7A 3ETDA 3GB7C 4G2KA 3P32A 1NKDA 2X6AA 3UM7A 1L1FA 4QIWF 1K34A 1K4CC 4QPJA 1TUEB 4WFBV 1H2GA 1FXVA 1EBOA 2Y69B 3SYPA 3ABTA 1YJNV 5J9PC 2IJKA 4MVZA 1S72V 4XDJA 4R50A 1R3IC 4MVSA 3DCXA 3SPIA 2DYRB 2Y48A 2DYSB 1JX9A 5CA3A 1J95A 1KQSU 2DQ3A 3MD0A 5KUMA 3ABKC 3OMAB 2LP7A 4FIPC 4TT3G 3E83A 1Q81W 4MVQA 3W7TA 3K79A 1VQ8V 3HSAA 1QR9A 3KG2A 2KB1A 2X0LA 2EINB 1VQKV 1SERA 4GX2A 4PELA 2IH3C 3OGCC 3IC7A 1FXKB 3ABLC 3NXSA 2QM8A 1VQ4V 1EFRG 3ZMTA 2IJHA 4EKWA 2R9RB 4WFFA 5L3EA 1M9NA 2YSUB 3ZCCA 3OEHG 1B6QA 3SYOA 1BMFG 2JK5C 1QVGU 4KP4A 5LHIA 3CCSV 1K33A 1CEZA 1Q82W 1S76D 3JCZA 3FYEB 2IJIA 3K3WA 3CD6V 1QLEC 3GWOA 1K73W 3AG2C 4HYOA 3SPJA 1COWG 3CCVV 2FTKA 3E8BA 1VQLV 3K0DA 1AR1B 4MVOA 1CPYA 1V55C 2WLHA 2UXNA 1GKFA 4RQFA 4MS2A 1M57B 4JYCA 5IYDO 3OUSA 3MHSC 4PA6A 1I5XA 2ZR3A 2HVKC 5L3GA 1P7BA 2WLKA 4WFEA 2QA4V 1OCRB 2P90A 3ML0A 4X89A 4XDKA 1THZA 3CCQV 3W7XA 1W2BU 2ZXWC 1RPRA 5BZBA 1EZJA 1K8AW 4E2LA 5B1BC 1BHAA 2WWWA 2W6JG 1PNMA 5CN0A 3SYCA 1R73A 3MHHC 1AROP 2EJRA 2ZR2A 1K92A 3OEEG 1KP2A 4DXWA 2A0LA 3K9AA 1K3EA 2W0FC 5GW7A 3ZRWA 2JEUA 2OT5A 4Q20A 3AG1B 1R6NA 2YEVA 4PDRA 3ZIAG 2WLMA 1AJQA 2IJJA 4P9PA 4FJCC 1QVFU 2QEXV 2EIJB 4GCZA 1GTOA 3ZMSA 3EHBB 2EIKB 4FPPA 1QR8A 2GSMB 1CP9A 3TETA 2DWEC 4HAMA 2W6IG 4JTAB 1GMGA 4U7NA 2H94A 1VQ9V 3JYCA 3AG3C 2EIMB 4MVMA 2WLJA 5B3SB 1OHHG 4GX0A 3ZRXA 3OMNB 3ZRSA 1KC8W 4UVCA 5EC1C 2JJ2G 2D3OW 4P30A 3FB5C 1JQ0A 3E8HA 2JIZG 3H01A 1DF4A 3AEIA 3ASOB 1FXHA 1ENVA 3CCRV 1N8RW 3RW0A 1AJPA 4G27B 2QKSA 4LBEC 2OCCC 3M99B 1RM1C 2XAGA 4CBCA 4I9WA 3STLC 1FS0G 1M56C 1WPXA 1M1KW 1OCOC 5IY5C 3F7YC 1V54B 4RUFA 3LDCA 1F4NA 2BOBC 1RPOA 4PA3A 2HLDG 5H9CA 4N23A 1S3JA 3ASNB 1OCCC 3CYOA 1MSWD 1ROPA 4MSWC 3T4ZA 2WLLB 3IFXA 3CCJV 2GHYA 2ITDC 3CC4V 4QE9A 3CPWU 1JCHA 4HZ3A 4BW5A 4J9ZB 1MOFA 3OE7G 3E8FA 3ABLB 1Y66A 1K4DC 2XOKG 2AHZA 5CBGA 1G4YB 1S0VA 2EZOA 1P4RA 3P30A 4UVBA 1SZTA 2HJFC 3SPCA 3ZMVA 3JD0A 3WG7C 3W7UA 1GO3F 3T1CA 4QJFB 2EILC 3A0RA 1QLEB 4F4LA 1AI4A 2P67A 3OUFA 4U7OA 1NJIW 4JAVA 4TWKA 2Y69C 2NNUA 3AG2B 5DN6G 2WLIA 3TK1A 4WFHA 3I56V 4WCEV 4X88A 4GX5A 1BHBA 2QE7G 4JTDB 4LCUC 3ZMUA 3CC7V 2DYRC 5LHGA 1V55B 4QPKA 1PNLA 4PA7A 3T2MA 2Q69A 1OZ0A 4KUMA 4MTFA 1VQMV 1YJWV 4ZKIA 3QO8A 3CCEV 4CZZA 5B1AB 1OCZC 2Z3YA 2R9IA 3AG4C 2M7WA 2XAHA 4XBFA 4LP8A 1JOYA 1MG1A 3E89A 1SETA 3CC2V 3T4DA 3B77A 1K97A 3B8NA 2PI4A 1Q7YW 4RO2A 2A9HA 1WLEA 4UVAA 5B1OA 2HR3A 2DQ0A 1HWYA 2UXXA 5IYCO 4UUJC 1R3LC 1AI6A 3CMEV 5LBQA 5KA5A 1KECA 4MVUA 3LDDA 1G8MA 4MW8A 1UJWB 2K1EA 2B5UA 3OMIB 2HG5C 2B1IA 4P9OA 4BAYA 2ZDIA 2LFRA 1AJNA 4H37A 3R65A 5LGTA 2OTJV 1VQPV 5L3DA 5C93A 2X6BA 4ZBMA 4WF9V 1YSCA 2V7QG 3FB7C 4QNHB 1GM7A 2XAQA 2QTOA 4PDVA 3LDEA 5IYBO 3IGAC 2HKOA 2EBOA 2ZQMA 3SYAA 1YHQV 1YJ9V 1W0JG 2OCCB 1RM1B 3ABMB 3JD2A 1DLBA 2A79B 5KUKA 3CXCU 5HFMA 1S5HC 4RQEA 1ORQC 1MABG 1NVPD 3ZMZA 2IU0A 5L3FA 5CMUA 3K04A 3ZN1A 3W7WA 4UV8A 3FB8C 2OTLV 1OCCB 3AG1C 1PL0A 1R3KC 1F4MA 2F43G 1VQ7V 3I55V 2X6CA 1IXMA 4TSFG 1JPXA 1ZWIC 3VOUA 3ABKB 3HPLC 3K03A 2JEXA 4WFGA 3ETGA 3LUTB 5KA6A 4UV9A 1YITV 2PI5A 1YTFD 4YXWG 3X2QC 2EIMC 2NLJC 4LC1A 2WPDG 3WFVA 1NH2D 1LNQA 3E8GA 3F7VC 5EBLC 1JJ2U 3DGEA 2HFEC 3ZRWB 3G6EV 3CCLV 3ZN0A 1K7DA 2YEVB 4RUEA 3CMAV 5HFLA 1NQTA 3WG7B 5H6RA 2IW5A 3LSQA 3E86A 2EILB 3ASOC 1JVMA 3QNEA 1NVPB 2P7TC 1GM8A 3OAAG 1NR7A 3G71V 2IU3A 1K5SA 3K0GA 3ABUA 2WLNA 3LNMB 3VBBA 4L87A 4GT1A 1KD1W 3ETEA 1V54C 3RBZA 4GX1A 4MT8A 1I5YA 1S77D 4JASA 2ZDIC 2BOCC 3JD1A 1PKXA 4RAIA 3JD4A 1BL8A 2MK3A 4BIZA 1KKDA 5FL7G 3ASNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8N A;  1K33 A;  1MOF A;  2LP7 A;  1QR8 A;  5HFL A;  4FIP C;  1Y66 A;  4G2K A;  4N21 A;  4JGS A;  2P6J A;  2EZP A;  1K34 A;  1QR9 A;  2EZO A;  3CP1 A;  3HSA A;  1F23 A;  3P30 A;  4E2L A;  1QCE A;  3GWO A;  5CN0 A;  1QBZ A;  1SZT A;  3B8M A;  4JF3 A;  1JPX A;  1EBO A;  2EBO A;  3MHH C;  5H9C A;  4N23 A;  5KA5 A;  3K9A A;  1DF5 A;  3CYO A;  1DLB A;  1Y4M A;  1I5Y A;  2OT5 A;  5HFM A;  1JQ0 A;  3DCX A;  5KA6 A;  3H01 A;  2M7W A;  4FK5 C;  1DF4 A;  1MG1 A;  1ENV A;  3MHS C;  2X7R B;  4JPR A;  4FJC C;  2MK3 A;  3WFV A;  5CMU A;  1I5X A;  3M99 B;  3B77 A; 
#chains in the Genus database with same CATH topology
 1XD4 A;  3F5W C;  3CWB H;  1OCZ B;  5LG4 B;  2EZP A;  2NZ8 B;  1H8E G;  1WB7 A;  3AG4 B;  1WPB A;  3EXA A;  1WVH A;  2HJD A;  5B1N A;  2D2Q A;  4LF9 B;  1P7G A;  1XL4 A;  2DN9 A;  4FLT A;  1YI2 V;  4ZRI A;  1UNR A;  2GTA A;  3H9V A;  4I55 B;  1R6K A;  3LSS A;  5KAI Z;  2BTQ A;  4HAU B;  2YIC A;  3CSX A;  4LFA O;  3APO A;  1O9H A;  4R6Z A;  1FXK C;  2IM9 A;  2QTS A;  5LGN A;  4DX8 A;  1SRY A;  4UCV A;  4JI1 B;  4XDL A;  3SYQ A;  1OV9 A;  5CA1 A;  4B3T O;  2JS3 A;  3B8M A;  4H33 A;  1EZV H;  2EMS A;  5TIS Z;  3F5T A;  1SES A;  5FPO A;  2R9A A;  4TV8 A;  1J19 A;  1R3J C;  3BA9 A;  3PJS K;  3WB0 A;  1UPQ A;  1E1Q G;  1AB3 A;  4J9Y B;  4GZU A;  2FJU B;  4QJ5 B;  4I9Q A;  2GS0 A;  4HAZ B;  3CCM V;  3SUZ A;  4RWU A;  3HB3 B;  2QKM A;  2EX3 A;  4MW3 A;  3PVU A;  2ITC C;  2YXY A;  3BAB A;  1KZ7 A;  4K3A A;  3D3I A;  3CJH B;  1PFJ A;  2YS3 A;  2QDO A;  3E2E A;  2O57 A;  4I4T B;  4F7G A;  1OCR C;  1P84 F;  2XND G;  2Q0O C;  3IVF A;  1F51 A;  1X59 A;  4NXM B;  2B1G A;  1YIJ V;  2UUC B;  3HKC A;  4JYB A;  5DI9 B;  4Z1M G;  2DA0 A;  2VSZ A;  2XAS A;  3K06 A;  3CRR A;  3K08 A;  1O9G A;  4PA4 A;  5KQ4 A;  4J7Z A;  3QO7 A;  2BCC H;  5FLX N;  2BTQ B;  2CTQ A;  2DWD C;  3CCU V;  4JGS A;  3AJ4 A;  2PYL A;  1FXK A;  4IHJ A;  1SZX A;  4PD4 F;  2RSG A;  2EIJ C;  1Z5W A;  4O2A B;  4PI2 A;  4JI7 B;  2L1C A;  2Q8V A;  4GNK B;  1MSD A;  4DO2 A;  1IBM B;  1VQO V;  2HP8 A;  2D9X A;  2OIG A;  3RVZ A;  4OGQ B;  1H2S B;  1YZB A;  1UPR A;  3ZRV A;  5DM6 V;  2QWP B;  3AU5 A;  3G4S V;  3A98 B;  3CXB B;  2ZE6 A;  2VQE B;  4CH5 A;  1Q86 W;  2YI8 A;  3ABM C;  4I7Z B;  5B3S C;  4LWS B;  2KIE A;  5D3Y A;  4R8C A;  3D36 C;  4DYL A;  1UNQ A;  3P32 A;  3ODO A;  5DHA B;  4K8X A;  1H2G A;  2E2X A;  1YVW A;  2YIB D;  2V76 A;  3ABT A;  1BQZ A;  1FPO A;  1BSM A;  1ZSP A;  1R3I C;  1FGZ A;  1KB9 F;  1TVK A;  1JX9 A;  3H1K H;  1KQS U;  5KUM A;  1US6 A;  5EFX A;  3SJA C;  3RYC A;  3ODW A;  3B2E E;  3E83 A;  3W7T A;  1Y67 A;  2DX5 A;  1QR9 A;  4FLY A;  2KB1 A;  2X0L A;  3V5W A;  2BCJ A;  4PEL A;  4NY0 A;  1FXK B;  4IHJ B;  3NXS A;  2QM8 A;  1VQ4 V;  1EFR G;  1EGX A;  2QJ1 A;  1WP8 A;  4C7U A;  1Y76 B;  4H44 B;  1B6Q A;  2JK5 C;  4JI0 B;  3CCS V;  4MY6 A;  3FYE B;  3RT3 C;  4JI0 O;  5EYP B;  3AG2 C;  1D5N A;  4CC6 A;  4HYO A;  3SPJ A;  2JS5 A;  4CH4 A;  2YRY A;  2LQT A;  4X1I A;  2UXN A;  1BTN A;  1GKF A;  4EKU A;  1NU2 A;  3OAN A;  5IYD O;  1LUW A;  1U96 A;  1ZC3 B;  1I5X A;  1P7B A;  2QA4 V;  1OCR B;  4X89 A;  1THZ A;  3QBV B;  4DV4 B;  3Q4H B;  2ZXW C;  5BZB A;  3HW2 B;  3LNN A;  1XRE A;  2UU9 O;  3VQV A;  2KIG A;  2KKW A;  4OT1 A;  2W6J G;  5J2U A;  4DV4 O;  2MW2 B;  3OEE G;  4IAP A;  1KP2 A;  4JYA B;  2A0L A;  4I50 B;  1K3E A;  2VKI A;  1BZK A;  1MAI A;  4Q20 A;  4LNU A;  4PDR A;  2UUB B;  2WLM A;  1AJQ A;  2IJJ A;  4P9P A;  4JYA O;  2QEX V;  2EIJ B;  2Q5Z A;  1GTO A;  3HK0 A;  2VQF O;  3L70 H;  2VWJ A;  3IC9 A;  2GSM B;  3BIN A;  2DWE C;  4HAM A;  3DXR A;  4JTA B;  3AK2 A;  5B5E Z;  4LFB O;  3AG3 C;  1J0W A;  4MVM A;  4CC5 A;  5K1P A;  5B3S B;  3ZRX A;  3OMN B;  1KC8 W;  3E8H A;  1MZE A;  3H01 A;  2D4Q A;  1FXH A;  1ENV A;  1XNR B;  4WBN A;  4U3J B;  4X1I B;  4G27 B;  2OCC C;  4JI2 B;  2LYD A;  4DR6 B;  1FS0 G;  1M56 C;  2OWO A;  3GWK C;  1M1K W;  1V54 B;  2Z0P A;  4JI2 O;  3AK1 A;  4DR6 O;  4PA3 A;  3TXQ A;  1IUR A;  4TUY B;  1XNQ B;  1AVM A;  3CYO A;  3S3X A;  1XI1 A;  1ROP A;  1QU7 A;  5LP6 C;  3IFX A;  2PZS A;  4IL6 Z;  4X1K B;  4QE9 A;  3CC4 V;  2RVB B;  3CPW U;  1JCH A;  2JGU A;  4J9Z B;  3OE7 G;  2IFS A;  1K4D C;  1Y74 A;  5AG2 A;  5LA6 A;  1DK1 A;  1GC7 A;  3FM8 C;  1P4R A;  1TUB B;  3J81 N;  2RNB A;  4J11 A;  1MNG A;  3D8F A;  1SHC A;  3SJC C;  3FD9 A;  1U5D A;  1GG3 A;  3ZMV A;  3JD0 A;  3WG7 C;  3T1C A;  5KAF Z;  2N05 A;  4F4L A;  4U7O A;  4JAV A;  3AG2 B;  3CE2 A;  2WLI A;  3I56 V;  4LFC O;  1G6U A;  4X88 A;  2QE7 G;  1N34 B;  4GXB A;  2DYR C;  5LHG A;  2LW1 A;  3JAK B;  1N0N A;  2GCJ A;  5ITZ A;  2N23 A;  3K5M A;  2CTR A;  4ZKI A;  4OX9 B;  3TVV A;  4IGG A;  3CCE V;  5B1A B;  2Z3Y A;  2R9I A;  4HB4 B;  2YVC A;  4LP8 A;  1JOY A;  3A8P A;  1I94 O;  4LF8 B;  2UZS A;  3CC2 V;  1HNW B;  5LP6 A;  4DV6 B;  4IIJ A;  5LYJ A;  1Q7Y W;  1H2M A;  2ODM A;  2A9H A;  4LF8 O;  2AL6 A;  1AP5 A;  1HNW O;  2DQ0 A;  1HWY A;  4DV6 O;  2UXX A;  1U5G A;  2Z0A A;  2MDX A;  1R3L C;  5BR8 B;  1JR9 A;  4MVU A;  1SQF A;  4D0N B;  3J7A U;  3WB2 A;  1UJW B;  2VRW B;  2B5U A;  5C6R A;  2HG5 C;  5BR8 O;  2B1I A;  4D6W A;  2QKC A;  5LMU B;  1AJN A;  3MPX A;  5KHG A;  1PP9 H;  2Y8F A;  2NMB A;  1WNS A;  4HNA B;  3FB7 C;  2R0D A;  2XAQ A;  4F6E A;  2OQB A;  1IDS A;  4DUY B;  4PDV A;  2GTS A;  1WGQ A;  2CGO A;  1XHX A;  3SYA A;  1YJ9 V;  2OCC B;  3ULC A;  2UUA B;  5JH7 A;  1DLB A;  5KUK A;  2UVM A;  3ZHQ A;  2E75 B;  1S5H C;  3O96 A;  1ORQ C;  4E4E A;  3ZMZ A;  4YL8 A;  3ETQ A;  4K81 A;  4GPT B;  3FB8 C;  2OTL V;  3PZD A;  4FLW A;  2ELB A;  1FGY A;  4DR7 O;  1F4M A;  2P0H A;  1VQ7 V;  1H2K A;  5LYJ B;  2RDC A;  3ZBH A;  4YJ2 A;  1IXM A;  1JPX A;  2H3O A;  2YIB A;  3BA8 A;  1OY2 A;  4TKN A;  3ABK B;  2ROZ B;  3HPL C;  4X1Y B;  4X20 B;  2P4K A;  1YIT V;  1KI1 B;  2KQX A;  3X2Q C;  2MWN B;  2QWO B;  4KHB B;  4DX9 0;  2M38 A;  3E8G A;  3HKD B;  3CCL V;  3ZN0 A;  4ZIB A;  1K7D A;  2YEV B;  3WG7 B;  2YS5 A;  5H6R A;  3SR2 C;  3PN1 A;  3T06 A;  2Q73 A;  2PUS A;  4DK1 A;  1NVP B;  2ZCE A;  3OTF A;  4X65 B;  5GOW B;  1NR7 A;  4KAX B;  4EB6 A;  3H1J H;  4D6T H;  2ZKO A;  3VBB A;  4GT1 A;  1W1G A;  2LJ2 A;  3L74 H;  4IYH A;  4MT8 A;  5JP4 A;  1IX9 A;  2Q7E A;  2ZDI C;  4GMV A;  5DHF B;  2BOC C;  1AR5 A;  2G38 A;  4X66 O;  1X05 A;  3DXC A;  3ASN C;  3UO2 A;  3VQY A;  5GON A;  4ZHQ A;  1H2N A;  3W7S A;  3MAQ A;  1Q6U A;  2IH1 C;  3L9D A;  4L6E A;  4DR4 B;  1SQG A;  1A32 A;  1MPH A;  3KY9 A;  4JI3 B;  1MIX A;  4PV1 B;  5HE1 A;  2XAF A;  3EVK A;  4ASU G;  4JAU A;  4O4L B;  4JI5 B;  1M7E A;  3THO A;  1XKE A;  4UXN A;  4PHZ A;  1WJM A;  3LSU A;  1N36 B;  2EIN C;  2JDI G;  3FEH A;  1Q8I A;  3K57 A;  1V5U A;  3ZHR A;  4WFA V;  1H8H G;  2ELA A;  3U12 A;  1N36 O;  3J80 N;  2GV9 A;  2PGG A;  4N21 A;  4R7C A;  1VQ6 V;  2P6J A;  3OR7 C;  1M5I A;  1PL4 A;  4JAA A;  3CIK A;  2FB5 A;  2JGD B;  2HTH B;  4JF3 A;  4ZRJ A;  5GTH Z;  5IWA B;  3FYI B;  5DED A;  2LFS A;  3PSC A;  4I0X A;  1NBM G;  1NT2 B;  1HDJ A;  2BTO A;  4IYI A;  5KHJ A;  4BIU A;  1WA8 B;  4WVF B;  4A6H A;  1K9M W;  5I2M A;  4DV3 B;  4DR5 O;  1GN4 A;  1KP3 A;  5CBH A;  3ZJZ A;  4LF7 O;  4O2B B;  3GVM A;  4KHP B;  1ZSQ A;  2WLL A;  1PLS A;  1XL6 A;  1U5F A;  1Q6I A;  2CUG A;  2WAM A;  4KHO A;  1ZLZ A;  3A58 A;  2YF0 A;  5I2S A;  1Q6H A;  2QKL A;  5CA0 A;  3D8C A;  4YHH B;  1TGO A;  3TCU A;  1J5E O;  5HE3 A;  4QJ4 B;  2CK3 G;  5E1A C;  2F93 B;  2W2X C;  5JVD B;  4JV5 O;  4Z2N A;  4BW9 A;  1QQG A;  3X2Q B;  2Y0I A;  4QE7 A;  4PNK A;  2EIK C;  3ZHT A;  3WB1 A;  4X62 B;  3ZDT A;  4TOI A;  4PA9 A;  5D3X A;  3FB6 C;  4FK5 C;  3FVC A;  4PDM A;  2Q67 A;  3OW2 U;  4JPR A;  2RUK B;  2VS0 A;  4X64 B;  1AI7 A;  3ETD A;  4B3M O;  5IT9 N;  2JRI A;  1UEF A;  3TJT A;  2E5L O;  1L1F A;  3MDB C;  1SC5 B;  3OTO O;  4YIP A;  4WFB V;  3TO1 A;  2Y69 B;  3SYP A;  1YJN V;  4MVZ A;  4XDJ A;  3SO6 A;  1N0J A;  2Y48 A;  5CA3 A;  4YON A;  5JQG B;  3MD0 A;  1L0L H;  4JZ2 A;  2COD A;  4TT3 G;  1Q81 W;  5CLL B;  1IZ3 A;  4MVQ A;  5IJ9 A;  3K79 A;  4OPA A;  1VQ8 V;  4HHV A;  3HSA A;  2ZKM X;  4FZ1 A;  2LGW A;  1GRJ A;  2EIN B;  1OMW A;  1SER A;  4Z2W A;  3FAV A;  3B09 A;  3ZMT A;  5JHG A;  4LFA B;  2K2J A;  2UZR A;  3JAT B;  4J42 A;  3TW1 A;  1Q90 D;  4GOU A;  3OEH G;  1P5T A;  2Z13 A;  5C5B B;  3SYO A;  4B3T B;  2I1J A;  2BSK B;  2EJ7 A;  4F6R A;  2OIE A;  3KZ1 A;  3BRC A;  1E5W A;  1COW G;  1JFF B;  2XUM A;  3KZI Z;  1GH6 A;  3K0D A;  4MVO A;  3HQC A;  2Q0A A;  1WG7 A;  3M1I B;  2ZR3 A;  2HVK C;  3RYF B;  4WFE A;  1H2L A;  2GJY A;  1VF6 C;  1M93 A;  3W7X A;  3UT5 B;  1W2B U;  4B3S B;  5B1B C;  1BHA A;  2WWW A;  3SYC A;  1R73 A;  3MHH C;  1K92 A;  4B3S O;  1BT8 A;  5H5N A;  2N0Y A;  1EN6 A;  2W0F C;  3N2K A;  2YT1 A;  2JEU A;  5IE9 A;  3RGB A;  1R6N A;  2UXC B;  5B66 Z;  1HR0 O;  1JMK C;  4FJC C;  3G9W A;  3U8Z A;  2KUQ A;  5LOP B;  2AW9 A;  1GN3 A;  3JAS A;  3ZMS A;  2UXC O;  3EHB B;  3SGI A;  2EIK B;  2G35 A;  5BY1 A;  3BJI A;  2NN4 A;  2GDS A;  3AU4 A;  4O4J A;  3CB2 A;  1ZC4 B;  2W6I G;  1GMG A;  2H94 A;  4CHM A;  1VQ9 V;  3JYC A;  1U29 A;  2D9Z A;  1HP8 A;  3K9S A;  4LH6 A;  3CX5 F;  2X18 A;  2D3O W;  2CY4 A;  2DJV A;  5CA1 B;  2JIZ G;  1XMQ O;  4J7J A;  2LG1 A;  1DF4 A;  3ASO B;  2K9P A;  2I5C A;  1NU1 H;  1KBH A;  4TV8 B;  3M99 B;  1OQN A;  3M7M X;  3T1H B;  3OHM B;  3SYX A;  3STL C;  1OCO C;  5IY5 C;  4BBK A;  3F7Y C;  3LDC A;  1F4N A;  2BOB C;  1D5A A;  3T1H O;  4IOY X;  1VF6 A;  2K2U A;  1LW3 A;  5H9C A;  3UO3 A;  5E79 Z;  1OCC C;  3DXD A;  4DV5 O;  1NS1 A;  3CCJ V;  1FD9 A;  4BW5 A;  3HKC B;  2MKR A;  2XOK G;  2AHZ A;  4YY3 O;  5CBG A;  1G4Y B;  2EJ8 A;  1S0V A;  3P30 A;  1RJ2 A;  3M8A A;  1XBL A;  3SPC A;  2ZE8 A;  4O4J B;  4TQF A;  1L8D A;  1XQ8 A;  4JZG A;  3A0R A;  4B6H A;  2Q9L A;  1X11 A;  1AI4 A;  1NJI W;  4HAV B;  5DN6 G;  1SKV A;  2MFQ A;  3BFR A;  3D8D A;  1L0N H;  2ZT9 B;  4LCU C;  4DV0 O;  1XR0 B;  1IBK O;  1W1D A;  3T2M A;  1Y5O A;  3P7Z A;  1YJW V;  2PYJ A;  2CRF A;  3BCC H;  4HB2 B;  4GZR B;  2XAH A;  4XBF A;  3RN4 A;  3E89 A;  1SET A;  3OT7 A;  3VQX A;  1K97 A;  2UU9 B;  5JJE B;  1DDV A;  1TVK B;  1WLE A;  3C90 A;  5B1O A;  2HR3 A;  4UUJ C;  3U10 A;  3RYC B;  3NWF A;  5LBQ A;  4L1R A;  5KA5 A;  3L73 H;  3L75 H;  1KEC A;  1G8M A;  4MW8 A;  4CYE A;  4H13 B;  5J3T A;  5CB4 A;  2N04 A;  2Y0P A;  5GTI Z;  2L35 A;  2VQF B;  4W4L A;  5J2T A;  3TGU H;  4BAY A;  2LFR A;  5LGT A;  4CS3 A;  5JCO C;  2OTJ V;  5L3D A;  4LFB B;  4WF9 V;  1GM7 A;  3FSS A;  4F7H A;  2DFK A;  2HKO A;  1YHQ V;  1W0J G;  3ABM B;  1RSO A;  3CXC U;  1WI1 A;  2AGA A;  2LOX A;  1VMG A;  2D9Y A;  5CMU A;  3ZN1 A;  3W7W A;  1P3R A;  2EUL A;  4CSQ A;  2ARH A;  1IXB A;  1OCC B;  2YXL A;  3AG1 C;  5KHI A;  4K35 A;  4ZOL A;  1R3K C;  2DHK A;  3ZX6 A;  3I55 V;  4HAX B;  4EFB A;  4A6F A;  2KG7 A;  2X6C A;  3OD4 A;  3K5N A;  2RCV A;  3RYH A;  1T77 A;  2Z0Q A;  4WFG A;  1G1X B;  3ETG A;  3LUT B;  4UV9 A;  5J2U B;  2EIM C;  2NLJ C;  3B4S A;  1LNQ A;  2GCL A;  5EBL C;  3JAW A;  2HFE C;  4LNU B;  3CMA V;  1V9P A;  5BXZ A;  1D2D A;  3ZHV A;  4CS2 A;  2E76 B;  2ZIN A;  1U27 A;  2QGN A;  5JCO A;  2P7T C;  4EJN A;  4DUZ O;  1GM8 A;  3G71 V;  3HKE A;  3ABU A;  2D9W A;  1KD1 W;  3RBZ A;  3DXR B;  5IYZ A;  4LFC B;  1PPJ H;  1PKX A;  3S3W A;  4RAI A;  2LOZ A;  4DV2 B;  1Q5O A;  2YUA A;  1AR4 A;  4O4I A;  1FHO A;  4JTC B;  3QWM A;  1AI5 A;  1VQN V;  4WBN B;  2P0D A;  1YTF B;  2DX1 A;  4DV2 O;  1QCE A;  4P2Z A;  1NH2 B;  1QLN A;  1XCG A;  3JSN A;  1BTK A;  5EK0 A;  5H6Q A;  2ZIO A;  4TQD A;  1QNM A;  3SJQ C;  2RRF A;  1I94 B;  1NR1 A;  4J10 A;  4J80 A;  1WGU A;  3KCX A;  3RYH B;  4Z1V A;  5D3W A;  3RVY A;  2ZXW B;  2QR4 A;  5EZY A;  2Q6A A;  3SPH A;  3OFN G;  1K5Q A;  1PNK A;  2RN9 A;  3PVW A;  2KR0 A;  3CP1 A;  1ZL8 A;  2QM4 A;  1B06 A;  2XQN M;  1Y74 B;  5LA6 B;  2GBO A;  2RNR B;  4GYC B;  3T1Y O;  1DF5 A;  5L3B A;  2OYQ A;  4UB6 Z;  1Y4M A;  4GKJ O;  1H38 A;  4FMT A;  3HKE B;  1DTO A;  3DC5 A;  3DTU B;  1ZVR A;  3CRC A;  5LMN B;  4L8J A;  2H8P C;  1ZUQ A;  4I5S A;  3AG3 B;  4KFM A;  1FB8 A;  1W59 A;  3CHX A;  4CH6 A;  5BMV A;  1E79 G;  5LMN O;  1SQV H;  3OR6 C;  1H4R A;  1M57 C;  2WLI B;  3U0Z A;  3N2G A;  2DW4 A;  3BY6 A;  3TXS A;  1QBZ A;  2JJ1 G;  5LGU A;  2ADZ A;  1BQ0 A;  2NBV A;  3KKY A;  4QXA B;  1N32 B;  4XWX A;  1Q3E A;  1M56 B;  4QJ3 B;  1XDC A;  5ITZ B;  2YI9 A;  2COF A;  1BS3 A;  1N32 O;  3HIE A;  2X7R B;  1BAK A;  4DR7 B;  5L3C A;  1JA8 A;  2YT0 A;  1I08 A;  2WSS G;  3AK3 A;  5C8Y A;  3BEH A;  4MTG A;  1Q43 A;  1SF9 A;  2K49 A;  1YDX A;  5LHH A;  3PVL A;  4Z2M B;  4EMO A;  1GK9 A;  5LP6 B;  4IIJ B;  2ZM6 O;  4MT7 A;  1I7A A;  3WYF B;  1X4T A;  2XAJ A;  4DV1 B;  4DW0 A;  2DKP A;  1WJZ A;  1FJG O;  3ULB A;  2Z14 A;  2H7D A;  1PD3 A;  2P06 A;  2QM7 A;  4DRX A;  1SGH A;  4DV1 O;  3LJU X;  2CGN A;  4LF4 O;  2Z5U A;  4CS4 A;  1KZG A;  3ICX A;  4JI6 O;  3E22 A;  2YDE A;  4G2K A;  4QIW F;  1K4C C;  3A0B Z;  1TUE B;  1EBO A;  5LXT A;  3PP2 A;  4UCS A;  5J9P C;  2IJK A;  3N2G B;  1VP7 A;  4R50 A;  4X66 B;  3K5L A;  3DCX A;  1MMM A;  2DYR B;  1EVH A;  4FM0 A;  1KUQ A;  1J95 A;  2DQ3 A;  3NR7 A;  1XX0 A;  1M4U A;  3HKB A;  5JH7 B;  1HNX O;  1V5M A;  2BE3 A;  2LP7 A;  4FIP C;  5JJN B;  5C79 A;  2GUZ A;  3P3P A;  2J59 M;  4UCO A;  2K8E A;  1KKC A;  3KG2 A;  2YS8 A;  1URF A;  1VQK V;  2IH3 C;  3OGC C;  5HE0 A;  3ABL C;  2K00 A;  2QWR B;  4EKW A;  2ADQ B;  4YJ2 B;  5L3E A;  1MA1 A;  2KCJ A;  3ZCC A;  1RP3 B;  1VIB A;  2CAZ C;  1BMF G;  5DIF B;  4KP4 A;  5LHI A;  1CEZ A;  1K33 A;  4QGP A;  1S76 D;  3JCZ A;  3RYI A;  2R2Y A;  1DYN A;  1LUV A;  2FYU H;  4FLZ A;  4FLX A;  3E22 B;  1XEQ A;  4YIO A;  3CCV V;  3E8B A;  4J41 A;  1VQL V;  4A6K A;  3WU2 Z;  1CPY A;  1V55 C;  3CS5 A;  4RQF A;  4MS2 A;  2CDY A;  5D5Q A;  2HEP A;  1M57 B;  4EB6 B;  3OUS A;  3MHS C;  4PA6 A;  4DR1 O;  4DR5 B;  2HE7 A;  3KRW A;  3A0H Z;  3P3N A;  3SNH A;  4FFB A;  1GC6 A;  4HAT B;  3ML0 A;  2P90 A;  4LF7 B;  4A5K A;  2ZNJ A;  4B7E A;  3R66 A;  3KRX A;  1EZJ A;  3FX7 A;  4B08 A;  1K8A W;  5GON B;  1HNZ B;  1PNM A;  4ZHQ B;  5FNV A;  5IJ0 A;  1DDW A;  2EJR A;  4AIL C;  4UFZ A;  2VRZ A;  3NW8 A;  4CHJ A;  2YXH A;  3K9A A;  4EFE A;  3ODX A;  3ZRW A;  1HNZ O;  1Y6X A;  3ZIA G;  4GLX A;  1J5E B;  1KYO F;  5KMG A;  1QVF U;  4BR6 A;  4D7T A;  5KX5 A;  4ZI7 A;  4JV5 B;  4FPP A;  1QR8 A;  1GN2 A;  1EAZ A;  3VQW A;  3TET A;  3DXE A;  4GKK O;  4O4H A;  4FFK A;  2QWN B;  2WA4 A;  3IAY A;  3RYI B;  2WLJ A;  3CEI A;  4HBN A;  4FLV A;  5EC1 C;  2J0J A;  1QQC A;  2V4D A;  4JYY A;  2PY5 A;  3FB5 C;  5FI1 A;  3AEI A;  1N8R W;  4B3M B;  1AJP A;  4WJ7 A;  2QKS A;  4JI8 O;  1RM1 C;  2E5L B;  4CBC A;  4I0X B;  3ZS8 C;  1NZ6 A;  3OTO B;  3GYO A;  4CH3 A;  4FFB B;  3JAM N;  3G6B A;  1EF1 A;  3A2F A;  1VAR A;  4EEQ A;  4I55 A;  4ABM A;  2RLO A;  3ASN B;  3T4Z A;  2WLL B;  4LF5 O;  1NI2 A;  4F7U P;  1SQP H;  2H7E A;  2UXB O;  2ITD C;  1BGY H;  5J3Q A;  1VF7 A;  2P8V A;  1MOF A;  2UXD O;  3ABL B;  5CA0 B;  2HJF C;  4KVG B;  1FHX A;  4DR2 B;  1X1G A;  4QJF B;  5K1X A;  2EIL C;  1XUQ A;  2Y4T A;  1NTK H;  3X23 A;  5EIB D;  4DR2 O;  2P67 A;  4TWK A;  2NNU A;  4HDQ A;  3N27 A;  4GX5 A;  3CJH A;  3DC6 A;  4I4T A;  2ROV A;  1V55 B;  4QPK A;  1PNL A;  3B40 A;  2Q69 A;  1OZ0 A;  5LON B;  4KUM A;  4LF9 O;  3ML4 A;  3QVN A;  2M7W A;  4W4K A;  1MG1 A;  1LB1 A;  1Z5V A;  3T4D A;  4O2A A;  2L6L A;  2PI4 A;  4RO2 A;  4UVA A;  3O9O A;  2F66 C;  4JI1 O;  2A06 H;  3SDL A;  4TYZ A;  5IJ9 B;  3LDD A;  1HR0 B;  1ZX3 A;  1TQZ A;  1R6T A;  4LWS A;  1VEW A;  4FZ0 A;  3OMI B;  4PI0 A;  3C3S A;  2CAY A;  3FAV B;  5LOV A;  1SQX H;  5JJJ B;  2PZ1 A;  2CTW A;  1N33 B;  2X6B A;  4HB0 B;  2V7Q G;  1VF5 B;  4QNH B;  2QTO A;  3IGA C;  1N33 O;  1FAF A;  2EBO A;  2ZQM A;  4Q6G A;  1ZM0 A;  1RM1 B;  1XMQ B;  3JD2 A;  4F6R B;  1FOE A;  4NB5 A;  1IVS A;  5HFM A;  4IFS A;  4RQE A;  2ADP A;  1I2H A;  1MAB G;  1NVP D;  2IU0 A;  4NXM O;  2HHH B;  2Z0O A;  3K04 A;  4UV8 A;  2UUC O;  4TV9 A;  1MK9 B;  3NWD A;  1PL0 A;  5KLV H;  2IYB A;  2HHH O;  2F43 G;  2ZE5 A;  2XTA A;  1X86 A;  1WB8 A;  2RQ6 A;  4DV5 B;  4TSF G;  4OPH A;  2F4V B;  1MZF A;  2R09 A;  1Y76 A;  1ZWI C;  3VOU A;  3K03 A;  4JI7 O;  2IBZ H;  1P49 A;  1S5L Z;  2F4V O;  2PI5 A;  1IBM O;  2COC A;  4LC1 A;  4K2P A;  3WFV A;  3F7V C;  1JJ2 U;  3WA0 A;  3DGE A;  4YY3 B;  3IJ4 A;  3N2K B;  5EYP A;  2PF4 E;  4JI4 B;  2VQE O;  4RUE A;  4K17 A;  2IW5 A;  1UNP A;  1V88 A;  2EIL B;  1JVM A;  2P5O A;  3QNE A;  2DOS A;  5LOV B;  3JAS B;  4JI4 O;  5KQ1 A;  3OAA G;  2IU3 A;  4MK0 A;  2WLN A;  4L87 A;  3ETE A;  1V54 C;  3JCU Z;  1I5Y A;  4JAS A;  3JD1 A;  2RMK B;  2J0M A;  2DE0 X;  4HAW B;  3Q4H A;  3JD4 A;  1BL8 A;  4HB3 B;  2MK3 A;  4DV0 B;  5FL7 G;  1IBK B;  1GM9 A;  3I5D A;  2OTX A;  4GN1 A;  1ISN A;  2Y7B A;  2ETN A;  2ZNI A;  4UCR A;  2F1M A;  2DYS C;  1YXB A;  4I50 A;  1T5E A;  1M90 W;  1F23 A;  2ATK C;  4TV9 B;  4FLU A;  5FI0 A;  3RWR D;  1EN4 A;  3JAL A;  3JD3 A;  2FKX A;  3FKS G;  2V1D A;  2ZD9 A;  2PTM A;  4AQY B;  4HSI A;  1FAO A;  3DSQ A;  1CXZ B;  3QO5 A;  4AQY O;  5B1B B;  3ZED A;  2AEH A;  3K5O A;  4MTO A;  4KXR A;  2A3Q A;  2HVJ C;  3D36 A;  2D9V A;  2C2A A;  5D3V A;  3QIJ A;  4NKG B;  3L71 H;  4DXA B;  4PDL A;  4KHA A;  2FML A;  4U3J A;  3SJB C;  1AP6 A;  4DV7 B;  1Q67 A;  4K2O A;  4MTX A;  1U2B A;  3EFF K;  2Z59 A;  5CBF A;  2LGQ A;  4DV7 O;  3RCP A;  3SPG A;  2YS1 A;  2Q4P A;  3TFM A;  5EBM C;  1W0K G;  1FYJ A;  1BE3 H;  1E1R G;  5B1A C;  2Q7G A;  4TUY A;  1B55 A;  3OGI B;  4D7S A;  3A8Q A;  2DTC A;  3CRA A;  2E74 B;  4X1K A;  4WSF A;  5EIB C;  3ZHS A;  2Q68 A;  4G28 B;  5IDJ A;  1OCO B;  5IY5 B;  3JAL B;  1FFT B;  3E35 A;  1SA0 A;  2CY5 A;  5DH9 B;  3BVO A;  4X8A A;  1VQ5 V;  1TUB A;  2UUB O;  1N3H A;  5FPR A;  1SS3 A;  3QF7 A;  4U3F H;  3SV1 A;  3N7C A;  4OXS A;  2AHY A;  4K8Z A;  1BWN A;  3QG5 A;  2VWK A;  3STZ C;  3UKM A;  2QSA A;  3OM3 B;  1ZTE A;  1K5D B;  1ZYI A;  4GMX B;  1BCC H;  2ILM A;  3APQ A;  5EC2 C;  3JAK A;  1KU9 A;  4MVR A;  1S5J A;  5CB4 B;  5EBW C;  5JWP A;  1XNR O;  1PV0 A;  4DUZ B;  3GB7 C;  1NKD A;  2X6A A;  3UM7 A;  5J2T B;  1W1H A;  5A9G A;  1K34 A;  2F95 B;  3VOQ A;  5C16 A;  4QPJ A;  1FXV A;  2Q13 A;  3PG7 A;  4HAY B;  2CH7 A;  1S72 V;  3UCS C;  2EC1 A;  2YC0 A;  4MVS A;  1LR1 A;  3SPI A;  1XNQ O;  2DYS B;  4ICG A;  1RSO B;  1XOU A;  3ABK C;  3UZT A;  2P0F A;  3JSL A;  3OMA B;  1SA0 B;  4NTX A;  2Y8G A;  2CTP A;  1UFI A;  2N74 A;  2FJL A;  1FFX A;  4PJ0 Z;  4P7I A;  4DK0 A;  4AHC A;  3A8T A;  3BPZ A;  3C3T A;  3NWA A;  4GX2 A;  1DDM A;  4ZOL B;  1H10 A;  3IC7 A;  2ZE7 A;  5H2F Z;  2DLW A;  4YJ3 A;  3H1H H;  4A6F B;  3KCY A;  2IJH A;  2KG7 B;  2R9R B;  4FVM A;  4K0K B;  4WFF A;  3KSY A;  1M9N A;  2YSU B;  4HNA A;  2DHI A;  4K0K O;  1IBL B;  1QVG U;  2YIA A;  1Q82 W;  4IT5 A;  1NTZ H;  4PQ0 A;  2QKA A;  2ZPY A;  2AXT Z;  2IJI A;  3K3W A;  3CD6 V;  1QLE C;  4ZRK A;  1N34 O;  2W2X D;  3JAW B;  2JP2 A;  1IBL O;  3GWO A;  3T1Y B;  1K73 W;  4GKJ B;  2FTK A;  1AR1 B;  2D10 A;  1M7R A;  2WLH A;  3JAR A;  2R70 A;  2D2C B;  4DR3 B;  4OX9 O;  2CH7 B;  4JYC A;  3G80 A;  1U97 A;  4B7K A;  4FM2 A;  1DBH A;  3BHP A;  5L3G A;  5IYZ B;  2WLK A;  4DR3 O;  4XDK A;  3CCQ V;  1AWE A;  1RPR A;  4X20 A;  4X1Y A;  4E2L A;  1UPG A;  5CN0 A;  1EN5 A;  1XMO B;  3O65 A;  1ARO P;  2ZR2 A;  4O4I B;  2KUP A;  2D11 A;  2L2I A;  4LF6 B;  1FFX B;  4NVP A;  4DXW A;  4KHB A;  5LL6 Y;  4C0A A;  2OCH A;  3CXH F;  5GW7 A;  3HKD A;  2EMT A;  1XMO O;  2COA A;  2OT5 A;  2P4V A;  3AG1 B;  5KHH A;  2YEV A;  4LF6 O;  4AI8 A;  5JLJ B;  4NR1 A;  4YJ3 B;  1XHZ A;  4GCZ A;  1AQC A;  1F7Y A;  2Q7H A;  5D27 A;  2LW7 A;  2WA3 A;  1V5P A;  2ZM6 B;  1CP9 A;  2LO1 A;  5EZY B;  5LMU O;  5JHH A;  2F23 A;  1TXD A;  1X1F A;  1YF2 A;  1FJG B;  4U7N A;  4NTY A;  2EIM B;  1NTV A;  3CRM A;  1OHH G;  4DUY O;  4GX0 A;  1QHT A;  2XT9 A;  3ZRS A;  3U11 A;  4UVC A;  1TJ6 A;  1B3Q A;  2JJ2 G;  4LF4 B;  4P30 A;  1JQ0 A;  1ZL8 B;  4DIX A;  3AG7 A;  2UUA O;  4X9Q A;  4JI6 B;  1MI1 A;  2W2W A;  3CCR V;  2LKO A;  3RW0 A;  1FHW A;  3H1I H;  4LBE C;  3JAR B;  2XAG A;  4I9W A;  1Z87 A;  2LUL A;  1WPX A;  3BAA A;  3H1L H;  4RUF A;  2DYQ A;  4O4L A;  1RPO A;  2P22 C;  4A5U B;  1I0H A;  1I7F A;  5BMV B;  2HLD G;  3U7D A;  4N23 A;  1S3J A;  3D3Q A;  1MSW D;  3F0W A;  2YT2 A;  4MSW C;  1HNX B;  2RGN B;  2I1K A;  2GHY A;  1NTM H;  1RFY A;  4HZ3 A;  2JGD A;  1V61 A;  3E8F A;  1SQQ H;  3GYP A;  3K58 A;  1Y66 A;  5J3Y A;  2JVD A;  1OJH A;  2EZO A;  1B04 A;  4UVB A;  1SZT A;  5C8Y B;  3CRQ A;  1R1B A;  1WA8 A;  4NXN B;  3W7U A;  1GO3 F;  4X65 O;  1DRO A;  5F2V O;  2E3C A;  1YCI A;  3VIA A;  1QLE B;  3OUF A;  5IRS A;  4GUN A;  4BIO A;  4NXN O;  1MKE A;  1U5E A;  2Y69 C;  3TK1 A;  5HE2 A;  4WFH A;  2CE4 A;  4O2B A;  5L81 A;  1Z2G A;  4WCE V;  1BHB A;  2M14 A;  1NTY A;  4JTD B;  1YEW A;  4DRX B;  3ZMU A;  3CC7 V;  2B9Z A;  3TCA A;  4PA7 A;  4H8S A;  2GUM A;  3P6A A;  4MTF A;  1VQM V;  5M4Y B;  1XIL A;  3QO8 A;  3PEG A;  2DN6 A;  3D8E A;  1K5G B;  4DR1 B;  1RRP B;  1IRS A;  4CZZ A;  4DR4 O;  1OCZ C;  4DW1 A;  1P6S A;  1TA8 A;  4JI3 O;  3AG4 C;  4NTW A;  1GN6 A;  2FL4 A;  5LXT B;  2YID A;  4JI5 O;  4HDO A;  5JVD A;  3B77 A;  3B8N A;  1WJ1 A;  3K59 A;  3HKB B;  2ZIM A;  1WAZ A;  5IYC O;  3G67 A;  2A7W A;  1AI6 A;  3CME V;  4J7K A;  2GUZ B;  1FKA O;  1TAE A;  4LR3 A;  2K1E A;  5D5P A;  5IWA O;  1MK7 B;  4P9O A;  2AZ2 A;  2ZDI A;  4H37 A;  4GKK B;  3R65 A;  3FFQ A;  2Z4D A;  2RJZ A;  1VQP V;  1NI8 A;  5C93 A;  1MIZ B;  4ZBM A;  2M6Y A;  1YSC A;  1XOD A;  2DYN A;  1KMI Z;  4DV3 O;  4Y94 A;  2KSD A;  5DEC A;  3LDE A;  5IYB O;  1DGS A;  4BWA A;  5JQG A;  4NSW A;  4UCU A;  2I5F A;  4B3R B;  4KHP O;  2A79 B;  2R72 A;  4NYK A;  4JI8 B;  2Y4U A;  4B3R O;  4UCT A;  5L3F A;  3ZVR A;  5CLQ B;  2QWQ B;  3RFR A;  1PM9 A;  4YHH O;  1PMS A;  3UQ8 A;  3QTC A;  2NR5 A;  2KGX B;  4OSN A;  3JAT A;  1WP7 A;  5KCV A;  2DKQ A;  3ZHU A;  1Y19 B;  4DBB A;  4LH7 A;  4LF5 B;  1SQB H;  5C5B A;  2UXB B;  2JEX A;  1ZAU A;  5KA6 A;  5FNV B;  5IJ0 B;  1YTF D;  2BSK A;  4YXW G;  4X62 O;  4H0L B;  2UXD B;  2J0K A;  2WPD G;  1NH2 D;  4FM1 A;  3L72 H;  3ZRW B;  1JJO A;  1AIL A;  2W0X A;  3G6E V;  5HFL A;  1NQT A;  1JFF A;  2DMX A;  4X64 O;  5A2Q N;  3LSQ A;  5KMG B;  3E86 A;  3ASO C;  3MDS A;  2YSZ A;  1GAX A;  4KL1 A;  5KX5 B;  3HR0 A;  4UB8 Z;  4ZI7 B;  1K5S A;  3K0G A;  2XHB A;  3LNM B;  1WN7 A;  2AZ0 A;  1EM1 A;  4O4H B;  3RYF A;  1N4C A;  4GX1 A;  1S77 D;  2DHJ A;  3UT5 A;  1HW7 A;  4BIZ A;  1KKD A;  1QC6 A;  3NSU A;  3F5R A;  5KHK A;  1V89 A; 
#chains in the Genus database with same CATH homology
 1GM9 A;  3F5W C;  3W7S A;  4JTC B;  1AI5 A;  1VQN V;  1OCZ B;  2DYS C;  1YTF B;  2EZP A;  1H8E G;  3AG4 B;  1M90 W;  1F23 A;  2ATK C;  1QCE A;  2IH1 C;  4P2Z A;  5B1N A;  1NH2 B;  1QLN A;  3JD3 A;  1XL4 A;  5EK0 A;  5H6Q A;  3FKS G;  2V1D A;  2XAF A;  2ZD9 A;  3SJQ C;  4ASU G;  1NR1 A;  4JAU A;  1YI2 V;  4UXN A;  1R6K A;  3LSS A;  3RVY A;  2ZXW B;  3QO5 A;  2EIN C;  2Q6A A;  3SPH A;  3OFN G;  2JDI G;  1K5Q A;  1PNK A;  5B1B B;  4R6Z A;  4WFA V;  1H8H G;  1FXK C;  4MTO A;  5LGN A;  4R7C A;  4N21 A;  1SRY A;  1VQ6 V;  2P6J A;  3OR7 C;  4XDL A;  2HVJ C;  3CP1 A;  3SYQ A;  3D36 A;  2C2A A;  3B8M A;  4H33 A;  4JF3 A;  1SES A;  4PDL A;  3FYI B;  1DF5 A;  1R3J C;  2LFS A;  3PJS K;  1Y4M A;  5L3B A;  4MTX A;  1H38 A;  1NBM G;  1E1Q G;  4FMT A;  3EFF K;  1DTO A;  4J9Y B;  4BIU A;  5CBF A;  3DTU B;  3SPG A;  2H8P C;  1K9M W;  3CCM V;  4I5S A;  5EBM C;  1W0K G;  3AG3 B;  4KFM A;  1E1R G;  3HB3 B;  5B1A C;  1E79 G;  4MW3 A;  3OR6 C;  1KP3 A;  5CBH A;  1M57 C;  2WLI B;  3ZJZ A;  2ITC C;  2DW4 A;  3BY6 A;  2WLL A;  1QBZ A;  2JJ1 G;  1XL6 A;  3D3I A;  5LGU A;  3E2E A;  1OCR C;  2XND G;  1F51 A;  1M56 B;  2Q68 A;  2B1G A;  4G28 B;  2WAM A;  1OCO B;  5IDJ A;  5IY5 B;  1FFT B;  1YIJ V;  3E35 A;  2X7R B;  4JYB A;  4X8A A;  4Z1M G;  2XAS A;  3K06 A;  5L3C A;  1VQ5 V;  3K08 A;  3TCU A;  4PA4 A;  2WSS G;  2CK3 G;  3QO7 A;  5E1A C;  3BEH A;  4MTG A;  2DWD C;  3CCU V;  4JGS A;  5LHH A;  1FXK A;  1GK9 A;  4OXS A;  2AHY A;  3X2Q B;  2EIJ C;  4QE7 A;  2XAJ A;  2EIK C;  4DO2 A;  3STZ C;  3UKM A;  1VQO V;  4PA9 A;  3OM3 B;  3RVZ A;  1PD3 A;  3ZRV A;  5DM6 V;  2QM7 A;  3FB6 C;  4FK5 C;  3G4S V;  4PDM A;  2Q67 A;  3OW2 U;  4JPR A;  1Q86 W;  2Z5U A;  3ABM C;  5EC2 C;  5B3S C;  4MVR A;  5EBW C;  4R8C A;  1AI7 A;  3ETD A;  3GB7 C;  4G2K A;  3P32 A;  1NKD A;  2X6A A;  3UM7 A;  1L1F A;  4QIW F;  1K34 A;  1K4C C;  4QPJ A;  1TUE B;  4WFB V;  1H2G A;  1FXV A;  1EBO A;  2Y69 B;  3SYP A;  3ABT A;  1YJN V;  5J9P C;  2IJK A;  4MVZ A;  1S72 V;  4XDJ A;  4R50 A;  1R3I C;  4MVS A;  3DCX A;  3SPI A;  2DYR B;  2Y48 A;  2DYS B;  1JX9 A;  5CA3 A;  1J95 A;  1KQS U;  2DQ3 A;  3MD0 A;  5KUM A;  3ABK C;  3OMA B;  2LP7 A;  4FIP C;  4TT3 G;  3E83 A;  1Q81 W;  4MVQ A;  3W7T A;  3K79 A;  1VQ8 V;  3HSA A;  1QR9 A;  3KG2 A;  2KB1 A;  2X0L A;  2EIN B;  1VQK V;  1SER A;  4GX2 A;  4PEL A;  2IH3 C;  3OGC C;  3IC7 A;  1FXK B;  3ABL C;  3NXS A;  2QM8 A;  1VQ4 V;  1EFR G;  3ZMT A;  2IJH A;  4EKW A;  2R9R B;  4WFF A;  5L3E A;  1M9N A;  2YSU B;  3ZCC A;  3OEH G;  1B6Q A;  3SYO A;  1BMF G;  2JK5 C;  1QVG U;  4KP4 A;  5LHI A;  3CCS V;  1K33 A;  1CEZ A;  1Q82 W;  1S76 D;  3JCZ A;  3FYE B;  2IJI A;  3K3W A;  3CD6 V;  1QLE C;  3GWO A;  1K73 W;  3AG2 C;  4HYO A;  3SPJ A;  1COW G;  3CCV V;  2FTK A;  3E8B A;  1VQL V;  3K0D A;  1AR1 B;  4MVO A;  1CPY A;  1V55 C;  2WLH A;  2UXN A;  1GKF A;  4RQF A;  4MS2 A;  1M57 B;  4JYC A;  5IYD O;  3OUS A;  3MHS C;  4PA6 A;  1I5X A;  2ZR3 A;  2HVK C;  5L3G A;  1P7B A;  2WLK A;  4WFE A;  2QA4 V;  1OCR B;  2P90 A;  3ML0 A;  4X89 A;  4XDK A;  1THZ A;  3CCQ V;  3W7X A;  1W2B U;  2ZXW C;  1RPR A;  5BZB A;  1EZJ A;  1K8A W;  4E2L A;  5B1B C;  1BHA A;  2WWW A;  2W6J G;  1PNM A;  5CN0 A;  3SYC A;  1R73 A;  3MHH C;  1ARO P;  2EJR A;  2ZR2 A;  1K92 A;  3OEE G;  1KP2 A;  4DXW A;  2A0L A;  3K9A A;  1K3E A;  2W0F C;  5GW7 A;  3ZRW A;  2JEU A;  2OT5 A;  4Q20 A;  3AG1 B;  1R6N A;  2YEV A;  4PDR A;  3ZIA G;  2WLM A;  1AJQ A;  2IJJ A;  4P9P A;  4FJC C;  1QVF U;  2QEX V;  2EIJ B;  4GCZ A;  1GTO A;  3ZMS A;  3EHB B;  2EIK B;  4FPP A;  1QR8 A;  2GSM B;  1CP9 A;  3TET A;  2DWE C;  4HAM A;  2W6I G;  4JTA B;  1GMG A;  4U7N A;  2H94 A;  1VQ9 V;  3JYC A;  3AG3 C;  2EIM B;  4MVM A;  2WLJ A;  5B3S B;  1OHH G;  4GX0 A;  3ZRX A;  3OMN B;  3ZRS A;  1KC8 W;  4UVC A;  5EC1 C;  2JJ2 G;  2D3O W;  4P30 A;  3FB5 C;  1JQ0 A;  3E8H A;  2JIZ G;  3H01 A;  1DF4 A;  3AEI A;  3ASO B;  1FXH A;  1ENV A;  3CCR V;  1N8R W;  3RW0 A;  1AJP A;  4G27 B;  2QKS A;  4LBE C;  2OCC C;  3M99 B;  1RM1 C;  2XAG A;  4CBC A;  4I9W A;  3STL C;  1FS0 G;  1M56 C;  1WPX A;  1M1K W;  1OCO C;  5IY5 C;  3F7Y C;  1V54 B;  4RUF A;  3LDC A;  1F4N A;  2BOB C;  1RPO A;  4PA3 A;  2HLD G;  5H9C A;  4N23 A;  1S3J A;  3ASN B;  1OCC C;  3CYO A;  1MSW D;  1ROP A;  4MSW C;  3T4Z A;  2WLL B;  3IFX A;  3CCJ V;  2GHY A;  2ITD C;  3CC4 V;  4QE9 A;  3CPW U;  1JCH A;  4HZ3 A;  4BW5 A;  4J9Z B;  1MOF A;  3OE7 G;  3E8F A;  3ABL B;  1Y66 A;  1K4D C;  2XOK G;  2AHZ A;  5CBG A;  1G4Y B;  1S0V A;  2EZO A;  1P4R A;  3P30 A;  4UVB A;  1SZT A;  2HJF C;  3SPC A;  3ZMV A;  3JD0 A;  3WG7 C;  3W7U A;  1GO3 F;  3T1C A;  4QJF B;  2EIL C;  3A0R A;  1QLE B;  4F4L A;  1AI4 A;  2P67 A;  3OUF A;  4U7O A;  1NJI W;  4JAV A;  4TWK A;  2Y69 C;  2NNU A;  3AG2 B;  5DN6 G;  2WLI A;  3TK1 A;  4WFH A;  3I56 V;  4WCE V;  4X88 A;  4GX5 A;  1BHB A;  2QE7 G;  4JTD B;  4LCU C;  3ZMU A;  3CC7 V;  2DYR C;  5LHG A;  1V55 B;  4QPK A;  1PNL A;  4PA7 A;  3T2M A;  2Q69 A;  1OZ0 A;  4KUM A;  4MTF A;  1VQM V;  1YJW V;  4ZKI A;  3QO8 A;  3CCE V;  4CZZ A;  5B1A B;  1OCZ C;  2Z3Y A;  2R9I A;  3AG4 C;  2M7W A;  2XAH A;  4XBF A;  4LP8 A;  1JOY A;  1MG1 A;  3E89 A;  1SET A;  3CC2 V;  3T4D A;  3B77 A;  1K97 A;  3B8N A;  2PI4 A;  1Q7Y W;  4RO2 A;  2A9H A;  1WLE A;  4UVA A;  5B1O A;  2HR3 A;  2DQ0 A;  1HWY A;  2UXX A;  5IYC O;  4UUJ C;  1R3L C;  1AI6 A;  3CME V;  5LBQ A;  5KA5 A;  1KEC A;  4MVU A;  3LDD A;  1G8M A;  4MW8 A;  1UJW B;  2K1E A;  2B5U A;  3OMI B;  2HG5 C;  2B1I A;  4P9O A;  4BAY A;  2ZDI A;  2LFR A;  1AJN A;  4H37 A;  3R65 A;  5LGT A;  2OTJ V;  1VQP V;  5L3D A;  5C93 A;  2X6B A;  4ZBM A;  4WF9 V;  1YSC A;  2V7Q G;  3FB7 C;  4QNH B;  1GM7 A;  2XAQ A;  2QTO A;  4PDV A;  3LDE A;  5IYB O;  3IGA C;  2HKO A;  2EBO A;  2ZQM A;  3SYA A;  1YHQ V;  1YJ9 V;  1W0J G;  2OCC B;  1RM1 B;  3ABM B;  3JD2 A;  1DLB A;  2A79 B;  5KUK A;  3CXC U;  5HFM A;  1S5H C;  4RQE A;  1ORQ C;  1MAB G;  1NVP D;  3ZMZ A;  2IU0 A;  5L3F A;  5CMU A;  3K04 A;  3ZN1 A;  3W7W A;  4UV8 A;  3FB8 C;  2OTL V;  1OCC B;  3AG1 C;  1PL0 A;  1R3K C;  1F4M A;  2F43 G;  1VQ7 V;  3I55 V;  2X6C A;  1IXM A;  4TSF G;  1JPX A;  1ZWI C;  3VOU A;  3ABK B;  3HPL C;  3K03 A;  2JEX A;  4WFG A;  3ETG A;  3LUT B;  5KA6 A;  4UV9 A;  1YIT V;  2PI5 A;  1YTF D;  4YXW G;  3X2Q C;  2EIM C;  2NLJ C;  4LC1 A;  2WPD G;  3WFV A;  1NH2 D;  1LNQ A;  3E8G A;  3F7V C;  5EBL C;  1JJ2 U;  3DGE A;  2HFE C;  3ZRW B;  3G6E V;  3CCL V;  3ZN0 A;  1K7D A;  2YEV B;  4RUE A;  3CMA V;  5HFL A;  1NQT A;  3WG7 B;  5H6R A;  2IW5 A;  3LSQ A;  3E86 A;  2EIL B;  3ASO C;  1JVM A;  3QNE A;  1NVP B;  2P7T C;  1GM8 A;  3OAA G;  1NR7 A;  3G71 V;  2IU3 A;  1K5S A;  3K0G A;  3ABU A;  2WLN A;  3LNM B;  3VBB A;  4L87 A;  4GT1 A;  1KD1 W;  3ETE A;  1V54 C;  3RBZ A;  4GX1 A;  4MT8 A;  1I5Y A;  1S77 D;  4JAS A;  2ZDI C;  2BOC C;  3JD1 A;  1PKX A;  4RAI A;  3JD4 A;  1BL8 A;  2MK3 A;  4BIZ A;  1KKD A;  5FL7 G;  3ASN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...