3B77A

Crystal structure of a ph domain containing bacterial protein (exig_2160) from exiguobacterium sibiricum 255-15 at 2.42 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
188
Chain Sequence
DIGQVIHPDDFDKAAADDYVLHEDGEKIYFLIKSKTDEYCFTNLALVHLDGESASKRVLYRYPYAHYPIRHVMFETAGTVDLDVEIKFEIGGKHYSIDVDKKQLEHVKDLYKALLAIAEKQYEGQKMLEFANSSLNHSVTILGGLRQGDMNVPQTFKDLSQESFDWLQGHYYKWNQKDFGSFYEKYIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Bacterial pleckstrin homology domains: a prokaryotic origin for the PH domain.
pubmed doi rcsb
source organism Exiguobacterium sibiricum
molecule tags Unknown function
total genus 56
structure length 188
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11724 YvbH_ext YvbH-like oligomerisation region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3b77A02
2.30.29.50 Mainly Beta Roll PH-domain like Bacterial Pleckstrin homology domain 3b77A01
1JQ0A 4N23A 1K33A 3CP1A 2M7WA 1MOFA 2EBOA 1F23A 2X7RB 3MHHC 3K9AA 3MHSC 4N21A 1I5XA 2LP7A 2P6JA 3WFVA 1QR8A 1SZTA 1K34A 5CN0A 3HSAA 3CYOA 4E2LA 4FIPC 1QBZA 5HFMA 5CMUA 5HFLA 3B77A 2EZOA 1QCEA 2MK3A 3B8MA 3GWOA 3H01A 3P30A 4JF3A 3M99B 5KA6A 1DF5A 3DCXA 1QR9A 3B8NA 1DF4A 4JPRA 1DLBA 5KA5A 1ENVA 4JGSA 2EZPA 4FJCC 1MG1A 2OT5A 4FK5C 1I5YA 1JPXA 1Y4MA 4G2KA 1Y66A 5H9CA 1EBOA
chains in the Genus database with same CATH superfamily
4O4HB 2YS8A 4OGQB 1R3IC 2W6IG 4DV5B 1VQ4V 3DXDA 2UUCB 1WI1A 3ABLC 3RGBA 2YVCA 1TUBB 3OAAG 1SGHA 1Q7YW 4DUYB 3CYOA 4TSFG 5FI1A 1PPJH 2RNRB 1XI1A 4W4KA 3GVMA 2D9VA 2Q67A 1X86A 2VQFB 3ZX6A 4IHJA 4J7JA 4GMVA 2YS5A 1IBMB 4IHJB 1ISNA 3ZMVA 5KA6A 5LP6B 5KHIA 3AG3C 2VQEO 5LOVB 2IYBA 3N7CA 3WG7C 1WLEA 4U7OA 4DXWA 4IOYX 2IU3A 4MVOA 1R3KC 1Y66A 4U3FH 3TFMA 3RVZA 1KP2A 5C8YA 4B3MO 4R6ZA 3ABMC 1SQQH 1PLSA 4FPPA 4NXNO 2H7DA 4TOIA 3AK1A 3K79A 1IVSA 1DK1A 1H38A 2ITCC 5BY1A 4LFBO 3C3TA 4Q20A 1L1FA 2AEHA 5CB4A 4HB3B 3DGEA 4QJ5B 3ZVRA 2ZE6A 3DXRB 2NLJC 4JI5B 3C90A 5JH7A 3T2MA 1IBKO 3OEEG 2COFA 4L1RA 5DN6G 1VF7A 1XMQO 1EBOA 5EIBD 3EVKA 1ZC4B 2KKWA 5KAFZ 3JSNA 2Z4DA 1QC6A 1NVPB 3CE2A 4X65B 2OCCB 2CH7A 3CMEV 2QKLA 3AG7A 4KXRA 3F7VC 3QO7A 3CCRV 2P90A 2YDEA 3C3SA 2Q68A 2E3CA 5B1AC 2NNUA 3DC5A 2CH7B 3LNMB 3UKMA 1Y4MA 2COCA 3BABA 1LB1A 5DI9B 4K35A 5B66Z 1W0KG 1O9GA 2RMKB 2E5LB 2EILC 3KRXA 2DE0X 4YY3B 4B3RB 4ZHQA 3T1YB 2AW9A 4DX8A 2AXTZ 3ML0A 5IRSA 1YDXA 3RT3C 1B06A 4ZHQB 2UXDO 2Q4PA 2EIKB 4F7UP 3BINA 2PI4A 5BMVA 1DBHA 3NWAA 1URFA 1OCRB 2YI8A 1N3HA 3IVFA 4JAVA 1IBMO 5LBQA 1BHBA 1MK9B 2QTOA 2C2AA 2QE7G 5IY5C 3ZHVA 2JS3A 2LOXA 4ZKIA 4PDLA 3APQA 4I55A 4QGPA 3K06A 1ZUQA 5BMVB 1U2BA 1Z2GA 5JJEB 1BQ0A 1OCOC 2QKSA 3CCLV 2F1MA 4I55B 4EB6A 2R09A 1LUWA 2IJKA 2YXHA 1KZGA 3WYFB 3A98B 5LMUO 1W59A 1MSDA 1EF1A 2XASA 3RYCA 5CBGA 3SO6A 3UM7A 1YJNV 1YVWA 4EB6B 1E79G 2GBOA 3LDCA 5K1XA 2Y8FA 5CLLB 2OYQA 4A6FB 4MT7A 4J42A 4JI5O 1PL0A 1NR1A 3ETGA 4L8JA 4JPRA 3ML4A 5EYPB 3P32A 5DHFB 5J2UB 2QWQB 4G2KA 2CAZC 5LHIA 1NTVA 2A79B 4NXMB 4HB2B 2YT0A 3CCEV 4PA3A 1QQGA 2QEXV 3HKDB 1N8RW 1FHXA 1X59A 3B09A 4L87A 1AP6A 5D27A 2EJRA 2Q73A 2O57A 2OWOA 3B4SA 1VQ7V 4R7CA 3SYCA 5D3WA 5DHAB 2BOBC 2RGNB 4FJCC 1AILA 1ZL8B 4MVUA 4FM0A 4GCZA 3UZTA 1OY2A 2HG5C 1UNQA 2YEVA 2XAQA 5KHGA 4OPHA 2D9WA 1FOEA 4IGGA 4ZRIA 4YY3O 1SKVA 3BRCA 5IT9N 2D3OW 5GW7A 1M4UA 1CXZB 4CZZA 2YEVB 1WVHA 4MTGA 4RO2A 3FFQA 3HKEA 2JGUA 1W1GA 4UVBA 5GTHZ 4K8XA 1KKCA 2XQNM 3HKEB 5J9PC 2HHHO 1R6NA 1MAIA 3X2QC 2UZSA 5A9GA 3ODOA 1NTKH 3RCPA 1V54C 3P3NA 4NY0A 1GG3A 1QNMA 1AI4A 3K59A 4A6HA 3M99B 5DECA 4GN1A 1XMOB 3JALA 3ZRVA 1K4DC 3KZIZ 1K5QA 1U29A 3RWRD 2ZKOA 1NVPD 1HWYA 1K92A 1UNRA 2DN9A 3N2KA 2UXXA 2GUMA 4HB4B 1K73W 2ELBA 5F2VO 1NU1H 2L1CA 2WAMA 1EZVH 2R2YA 3HSAA 2W6JG 1VMGA 3X23A 2R9RB 2AZ2A 3LDDA 4MVQA 2LW1A 2EIMB 4DR4O 4B3SB 3UO2A 3JARB 2DOSA 5LHGA 4FLYA 4NXMO 1GC6A 3H1KH 4FK5C 2K2JA 4WFHA 4QJFB 2YIAA 2WLJA 2VWKA 1FHWA 1UFIA 1WP8A 4TUYB 1WA8B 3CP1A 1HNWO 4R50A 3IC7A 3FAVA 1KZ7A 3JAKA 3KRWA 2GCLA 1VQ8V 2X6AA 1ZSPA 1KQSU 4FZ0A 4DR6B 2HJDA 1M7RA 1YF2A 2BCCH 2LW7A 1XEQA 5B1OA 3SJBC 5LXTB 3VQYA 2YT1A 1I7FA 3LSSA 1VQOV 4H13B 3H1LH 2LFSA 3PVWA 3ETEA 3A0RA 3L74H 1YEWA 2J0KA 4XDJA 3K04A 4I0XB 4DV0B 1BZKA 1M57C 4AI8A 3WU2Z 1P4RA 4TQDA 1X11A 3EFFK 4UUJC 3ODWA 3ABKC 4NYKA 1GH6A 5LL6Y 1LNQA 2N04A 3WA0A 1NKDA 3H9VA 2KUQA 2UUAB 4KFMA 4DV7B 5L3GA 3J7AU 1P7GA 4TWKA 2UZRA 2Y48A 1RRPB 1KECA 2QJ1A 2LGQA 1Q8IA 3U0ZA 4KHBA 5BXZA 1Q5OA 1CEZA 5IJ0A 2D2CB 3PJSK 3B8MA 5D3VA 1NJIW 5IDJA 4KHBB 1IURA 4L6EA 3A8TA 1AJNA 3OTOB 4DV1O 5IJ0B 5I2SA 1Z5VA 1PP9H 1K97A 2HR3A 3H1IH 1HW7A 2NN4A 3K5MA 3ZEDA 2UXCB 2P5OA 4JI6O 4EMOA 4CBCA 4CC6A 2Y8GA 1W0JG 1THZA 3J81N 2EINB 3E2EA 4LF5B 2QTSA 2HE7A 1FXKA 1WJ1A 2HKOA 3B77A 4UCSA 2A0LA 4O4LA 2DX1A 4AQYB 1I94B 1DDWA 1OV9A 3G4SV 1SHCA 2GUZB 2JJ1G 2G35A 1MABG 4LF8B 4O4LB 1NTZH 3TXQA 5CA1A 3ZRWB 1NTYA 3UCSC 4GT1A 5I2MA 1N4CA 5KHHA 2QM4A 2P4VA 4JI1O 5CA1B 1XODA 3ASNB 1DROA 1F4MA 3PN1A 2EZOA 4LWSA 5EC1C 4OX9B 5JHHA 2DMXA 3QF7A 4OSNA 1O9HA 3K9SA 4IIJB 2JIZG 1IRSA 1JVMA 2IBZH 1XNQO 3CCMV 2X0LA 4LWSB 1QLEB 2XUMA 1I5YA 3OM3B 4WFFA 3JD1A 4JI3B 3BPZA 3ULCA 1GRJA 2KUPA 2Q6AA 1WPXA 4UV8A 2JP2A 4K81A 3VOQA 3H1JH 2W0XA 2DYRC 4X1KA 1V5UA 3I55V 4K0KO 3QIJA 1UNPA 4K17A 2CDYA 1TVKB 1G4YB 2GTSA 4X1KB 2UUAO 4PDRA 4GNKB 3A2FA 4TT3G 1P49A 5C93A 1FYJA 3JASA 5J3YA 3FKSG 1A32A 4WFGA 3ZHRA 1KKDA 3ABLB 4I50A 4AHCA 4CH5A 4PQ0A 3E8BA 4DO2A 4RWUA 1GN2A 1G6UA 1XOUA 4F6EA 4IL6Z 1MNGA 2Y4UA 4JYCA 4Y94A 4I50B 3E8HA 1XHXA 1NT2B 2QDOA 4LFAO 1ZAUA 2QM7A 1S5HC 4JAAA 5H6QA 4CSQA 3UT5A 2DWEC 2JEUA 4TV8B 1VQNV 4E4EA 3CC4V 3JAMN 2QA4V 3OE7G 2KGXB 5IYDO 2PF4E 4UB8Z 1VIBA 3CJHA 1PV0A 4FZ1A 2BOCC 2XT9A 3CSXA 3O65A 1QVGU 1H2NA 1ZWIC 4O4IB 3AG3B 4P30A 4AQYO 2BSKA 3HR0A 3CJHB 5FLXN 1LUVA 4MW3A 3GYOA 1BCCH 3T4ZA 3L73H 3TVVA 5LG4B 5HE2A 2XNDG 2UUBO 2F43G 4EJNA 2VQEB 2JGDB 2LGWA 2Q8VA 1FAFA 2N0YA 3OT7A 1FXKC 3ABMB 2ZQMA 3I56V 1XNRO 4GYCB 3E83A 1XHZA 4UCTA 4F7HA 3E22A 1K34A 1J5EO 3CCVV 2D4QA 3CCQV 4B3MB 2D9XA 4XBFA 1HR0O 4O4JA 4Z2NA 2CY4A 2LYDA 1T5EA 3PVLA 2EIJC 2RQ6A 3E22B 3M7MX 5FPOA 4HBNA 3NR7A 4LFBB 1M9NA 4EKWA 3QVNA 3AG1C 4O4JB 4JI2O 1FKAO 1XREA 2EBOA 2X7RB 3SYPA 1WGUA 1XMQB 4N21A 2Z5UA 5B1NA 2WLIA 2YUAA 3KG2A 1SQGA 4U3JB 5B1BC 1WP7A 5B1AB 1ZTEA 4FLVA 4GLXA 2WLIB 1DLBA 4OXSA 2P0FA 4DX90 1U5DA 1DGSA 4UVCA 4ZOLA 1DTOA 1KC8W 4EEQA 2EILB 4G27B 4CH4A 4FLWA 2DLWA 5EFXA 4FM2A 3LSQA 1SF9A 1HNZO 5J2TB 5EK0A 3LDEA 2FJUB 4ZOLB 3IC9A 4ZRKA 4MW8A 4WCEV 4JTDB 3ZS8C 1S76D 2D10A 4YONA 2RVBB 1H2GA 2ADQB 3Q4HA 3FM8C 1XBLA 1Q81W 1AJPA 1GM9A 4HAZB 2E75B 3ZIAG 4GX5A 4J10A 2PYJA 5IY5B 3Q4HB 1EGXA 4N23A 2UXDB 4HZ3A 2Z0QA 1YJ9V 1MIZB 2J59M 2V1DA 3BJIA 1XDCA 1K5SA 2M6YA 4QPKA 1OCOB 3UQ8A 2A06H 1GAXA 4I9QA 1EN4A 2YC0A 3JCUZ 5CBHA 3NSUA 1M90W 3HW2B 3RYIA 4J9YB 2DWDC 3OHMB 2ETNA 3CB2A 5LMUB 3RW0A 2XAGA 1S5JA 4EKUA 3SJQC 2YI9A 5HFMA 1X1GA 2DHIA 5GONA 4CH3A 2DYQA 2IH3C 5C8YB 5D5QA 3B8NA 1EVHA 1DF4A 3AJ4A 1AB3A 4CH6A 2AGAA 4DR7B 2ELAA 4J41A 2B9ZA 2DYSC 4HSIA 5KUKA 1TAEA 5CB4B 4DR2O 4H0LB 5JH7B 5JHGA 1HDJA 4J7ZA 2OTXA 1YXBA 3P6AA 2AZ0A 4WVFB 3HKBA 4BIZA 1FB8A 2Q5ZA 3U7DA 3V5WA 3AK3A 1F51A 1X1FA 3HKBB 4NSWA 4GZRB 4KHPO 2BTQA 3IGAC 2JDIG 4Z1MG 3UO3A 3MDSA 1XL4A 4XDKA 2BTOA 2P7TC 1YIJV 1NZ6A 2MFQA 1AI5A 3AK2A 4X89A 2ZE5A 1P7BA 5C16A 2BTQB 1EN5A 2DFKA 3TCAA 5FPRA 3DCXA 3VBBA 4DW1A 4DYLA 5JJJB 2N23A 3L75H 5KA5A 2X6BA 1H8EG 3X2QB 1W1HA 3T06A 3PEGA 1NS1A 2LFRA 1Y76A 4HAWB 3DTUB 1V54B 4NTXA 1BAKA 1WJZA 3N2GA 2GTAA 1W2BU 3K9AA 3FYIB 2HHHB 4JYAO 1Y76B 4QE7A 4JTCB 2UVMA 4PA7A 1V89A 3N2GB 3WB1A 1JMKC 2CTRA 2IH1C 3FB6C 4J11A 1RM1C 3K5LA 3FVCA 3G9WA 3MPXA 2DHKA 4C7UA 4B3TO 4JI0O 5JVDA 3T1HO 1NTMH 2B1GA 2PZ1A 1FFXA 1R3LC 2ZKMX 1E1RG 4QXAB 5AG2A 5M4YB 5JVDB 1BTNA 3JSLA 4NB5A 1GMGA 5L3FA 3CC7V 3RYCB 3D8DA 1EAZA 2WLHA 1P3RA 4DR7O 2ADPA 1VQPV 4RUEA 1KBHA 1GM8A 1IBLO 4HYOA 3FB5C 2GSMB 4DR4B 3TETA 3KCYA 3SJAC 2BCJA 4PD4F 1AVMA 3U12A 3OUSA 2YIBA 4K2PA 2LJ2A 4I7ZB 3R66A 1BE3H 1OCCC 1HNWB 3HK0A 1VF6A 1GTOA 3MD0A 2A3QA 3SJCC 1X05A 1K3EA 1FS0G 2WSSG 3OMIB 3ZN1A 2DTCA 4GPTB 4JTAB 2ZM6B 1NQTA 4MS2A 5C79A 1LW3A 1QLNA 1XX0A 1P5TA 1VF5B 4LF4B 1M57B 4KVGB 1FGYA 4W4LA 4P2ZA 3JCZA 5LGNA 3ABKB 4IYHA 3W7XA 1Q82W 4YL8A 1XUQA 1FAOA 4UFZA 3OW2U 1AJQA 4WFAV 5KQ4A 2OCHA 1MZFA 2I1KA 2K49A 1BL8A 4EFEA 2ZINA 3B40A 5CBFA 2Z3YA 3MDBC 1IXMA 1AP5A 4GOUA 2KIEA 4ZRJA 1N0JA 1VQ9V 1GN4A 4HNAA 3CRQA 4Q6GA 3DSQA 2E2XA 3PP2A 1UPGA 1K9MW 1S3JA 2JK5C 2EC1A 4KHOA 5EC2C 2CAYA 4IFSA 1R1BA 1V88A 1NR7A 3KZ1A 4WF9V 1JFFA 4WBNA 4TV9A 1FFTB 4DV1B 3ZJZA 1S0VA 2RNBA 1JQ0A 3JALB 1SETA 1UPRA 2XTAA 2DYNA 4I9WA 1JFFB 4WBNB 4TV9B 1JJ2U 3SNHA 4XWXA 4JI6B 4MT8A 2VS0A 1Q6IA 3N2KB 3QO5A 3PZDA 4D6TH 4D7TA 2OQBA 4K3AA 2DKQA 1B3QA 1IXBA 1MG1A 3JD0A 3W7TA 4X1YA 4QJ4B 4A5UB 1D5AA 5D5PA 1SC5B 1B04A 5LOPB 2M7WA 2D9ZA 2Z13A 2LP7A 2I1JA 5KHJA 1H2SB 4H44B 4X1YB 1M56C 3SYAA 1V55C 4JF3A 4UB6Z 1ZYIA 3THOA 5B3SC 3K57A 1K7DA 3A58A 2ZM6O 1OJHA 4JI1B 3FAVB 3JAKB 4IT5A 1SA0A 2KCJA 2CGOA 3ETQA 4KHAA 5H9CA 4LF4O 1RPOA 1DDMA 2DYRB 1XNQB 2AL6A 1L0LH 1VQ5V 2FMLA 1VF6C 2ZE8A 2EJ7A 2P6JA 2HFEC 4LH7A 1KU9A 4P9PA 4CC5A 1BTKA 1SQPH 3CC2V 2PZSA 1HP8A 2ZIMA 4JI8B 1X4TA 5L3BA 4K0KB 3EHBB 3D36A 1ZX3A 3BEHA 4DR5O 4ZBMA 4ASUG 1R3JC 3RBZA 4PA6A 4BIUA 1I7AA 1TXDA 2AHZA 1D5NA 3SGIA 4GKKO 1PFJA 3CX5F 1Z87A 1FPOA 4MTXA 1SQFA 1RFYA 3TJTA 5IJ9A 1U96A 5KAIZ 4LH6A 5DIFB 2OTJV 3G80A 4CS2A 3SYOA 1BSMA 1SQXH 4DUZO 5D3XA 3U8ZA 2KIGA 4HAUB 4LFAB 5B5EZ 1P6SA 1FHOA 4UXNA 4MVZA 3L71H 4DK1A 3CPWU 1BQZA 1COWG 5H6RA 5TISZ 3CWBH 3IJ4A 2Q69A 1QBZA 4LR3A 3O9OA 3CCSV 3CD6V 5KX5A 1R6TA 2DX5A 3FEHA 3ICXA 2R70A 3BCCH 3KKYA 2OIGA 4JZGA 1FXKB 5KX5B 4ABMA 2V76A 4P9OA 2KR0A 3DXCA 3CRMA 2L6LA 4LP8A 3HB3B 2UUBB 2HVJC 5GTIZ 4JI7O 2Y7BA 3ZMSA 3CXCU 2XOKG 1VQ6V 4PA9A 2GHYA 3ASOC 1XNRB 4NVPA 2HTHB 2EIJB 3J80N 1KP3A 3VOUA 1DF5A 1LR1A 4DV6B 3NXSA 1J5EB 1ZVRA 2A7WA 3AG1B 2ZR3A 4FM1A 2QR4A 2WPDG 5C6RA 2B1IA 1HR0B 4Z2MB 4FLUA 4A5KA 3L9DA 4LNUA 2LO1A 2PYLA 1XCGA 1E1QG 2Y69B 4NKGB 4HDOA 3G67A 5LMNO 1WN7A 4JI2B 3GWKC 2IW5A 2G38A 4LNUB 4JI8O 5B1BB 5L3CA 2RSGA 2PTMA 2DJVA 3JAWA 4DR3B 3B2EE 5KHKA 3ZHTA 5LA6A 4DXAB 3FYEB 4PJ0Z 2WLLA 5LA6B 5J3TA 4K8ZA 3OEHG 2K2UA 2M38A 2XAFA 3OD4A 2F66C 4QJ3B 4DIXA 1Y67A 4X20A 2WLLB 1AR1B 5KCVA 1MA1A 2FL4A 2RN9A 5DM6V 3D36C 4PDMA 3JASB 1PKXA 3D3IA 4GXBA 1GKFA 3NWFA 5KLVH 3A8PA 4CS3A 3GWOA 1V5MA 2GDSA 1HNZB 2FYUH 2VRWB 1P84F 2CK3G 5ITZA 1UPQA 4HATB 4XDLA 3SPCA 3RYHA 4H33A 4X66O 1AWEA 2IJIA 2WLMA 3AG4C 1XR0B 5ITZB 2Z59A 2FTKA 2QKCA 3UT5B 5IWAB 2ZIOA 2W2XC 3MAQA 3ZRSA 1OMWA 2CODA 1K4CC 4NR1A 4PI0A 5A2QN 3DXEA 2IM9A 3CRCA 1QVFU 4C0AA 3ETDA 3K03A 2YT2A 3K08A 1PNLA 3ABTA 1S72V 1OHHG 1J0WA 2DA0A 2RLOA 2RDCA 2BSKB 4FFKA 2ATKC 5CA0A 3CXBB 1Y5OA 1OCZC 2Z0PA 3SPJA 5J3QA 4QE9A 2IFSA 2EX3A 1VARA 4YIPA 2QWNB 3VQXA 5CA0B 4DV6O 4KUMA 3P30A 4LF9O 3CCJV 2MKRA 4YJ3A 1N33O 2DYSB 1Q67A 2CUGA 4KAXB 4QPJA 2A9HA 2DQ3A 1JPXA 3CHXA 2GS0A 1MI1A 2CGNA 4BR6A 1U27A 4GX1A 4TKNA 1TQZA 4GUNA 2D2QA 3FX7A 5EBLC 4DR3O 4MVMA 1BWNA 2Y69C 4QNHB 2UXBO 1QHTA 3LNNA 3M8AA 3U10A 4DR2B 4BBKA 2Z0AA 3F7YC 4JZ2A 1FXHA 1VQLV 2QM8A 4FMTA 1IX9A 2W2XD 1U5EA 2B5UA 3ZHSA 3E8FA 1BT8A 2ARHA 3AG2C 2NBVA 2KQXA 4TYZA 3SV1A 2BE3A 1YTFB 3G6BA 2RUKB 4TQFA 4HAXB 4ZI7A 4JI4O 1AQCA 3S3XA 3MHHC 1OZ0A 4LFCB 1M1KW 1QR8A 1WGQA 3K3WA 2VKIA 4KHPB 3QNEA 1RSOA 4JV5B 4Z1VA 1H2LA 4J9ZB 2KG7A 5BR8O 3D8FA 2FB5A 2NMBA 5LGTA 3F5RA 1MSWD 3K5NA 2YS3A 3A0BZ 1TA8A 1RSOB 1TJ6A 2YS1A 3CRRA 2UXNA 2KG7B 5IYZA 5IWAO 1XILA 2YICA 1KI1B 1BGYH 4U7NA 2I5CA 5IYZB 3JD4A 2CTQA 2HVKC 1RM1B 5EIBC 5FNVA 1GC7A 5KQ1A 2UU9O 2ZXWC 2ROVA 2NR5A 4JYAB 3VQWA 1GN3A 1DDVA 4JGSA 3W7WA 3A0HZ 3QO8A 5FNVB 3ZMZA 2P0DA 4B3TB 4JI0B 3T1HB 1H4RA 4MK0A 3CRAA 5LP6A 1MMMA 1F23A 3RYIB 1BS3A 1KYOF 1GO3F 5LOVA 2ZPYA 2L35A 5HE3A 3HKCA 4YIOA 3CIKA 2PI5A 4R8CA 1ZM0A 1PNKA 5IYBO 2YXLA 3HKCB 5IE9A 2XHBA 4RAIA 3TK1A 2EULA 1HNXO 1RP3B 3K58A 5GONB 4CHMA 1PM9A 3WB0A 3BY6A 1IBLB 4PHZA 1GK9A 1U97A 2KSDA 3OR7C 1OCCB 3W7UA 2K00A 2IJJA 3DXRA 4X1IA 4BW9A 3A8QA 2WLNA 4FLXA 2MDXA 1SQVH 2HJFC 2JS5A 3SPGA 1N32O 4X1IB 1ROPA 4IAPA 4F6RA 2CRFA 3F5WC 2COAA 2ITDC 2OIEA 2WWWA 4LF6O 1K5DB 3TW1A 1S5LZ 2Q7HA 3P3PA 4LFCO 1ZSQA 1Q90D 4F6RB 1AR4A 3F0WA 2Q13A 3FD9A 4LF7B 4JV5O 1Q43A 1Y19B 2GCJA 2PUSA 2QWRB 4PDVA 4YJ2A 2PY5A 4MY6A 3ODXA 3P7ZA 2Q0AA 3D3QA 4FVMA 2E76B 1UEFA 3D8CA 4DV5O 3K0DA 4I4TA 2LQTA 4YJ2B 2UUCO 1IDSA 2YSZA 4DUYO 3BA8A 2DQ0A 2M14A 4I4TB 3PG7A 3STLC 2H94A 1Q6HA 5CMUA 5C5BA 1YITV 1K5GB 1VQKV 2VQFO 4OT1A 5LYJA 1ZLZA 4X9QA 3FB8C 1Y6XA 2ADZA 5C5BB 2I5FA 2K9PA 4GZUA 4EFBA 1MZEA 5LYJB 1FJGB 3N27A 1WG7A 2HLDG 4DRXA 3IAYA 1JR9A 1FFXB 1W1DA 4WJ7A 2PGGA 1EFRG 2H3OA 3WB2A 4DRXB 1L8DA 5LP6C 3OTFA 1YTFD 1MKEA 1XD4A 3AU5A 1TGOA 4A6FA 2LG1A 2JJ2G 2RCVA 5GOWB 1M56B 1Q3EA 1V55B 4PNKA 5EYPA 5B3SB 5J2UA 1PMSA 4HAMA 1KMIZ 2WA4A 1NH2B 1SQBH 2ZDIA 3SPIA 2HP8A 2J0MA 4DR1B 3NWDA 3HKDA 3R65A 3GB7C 2HEPA 3IFXA 4NTYA 4HAYB 4CHJA 3CMAV 2Q7EA 4LF7O 1WB8A 1SZXA 4GKJB 1H10A 2NZ8B 4X65O 2VRZA 4YHHB 4QIWF 1Y74A 4H8SA 3WFVA 2EMTA 4DW0A 4O2AA 5LHHA 1XQ8A 5L3DA 2CY5A 1ZL8A 5IYCO 2JEXA 3E8GA 2FJLA 2V7QG 1Y74B 1XKEA 2OCCC 1U5GA 3OMAB 2FKXA 3OUFA 4O2AB 4LCUC 1G1XB 3D8EA 1TUEB 1YI2V 1D2DA 1KD1W 3OR6C 1L0NH 4LBEC 2E5LO 4DR5B 4DV4B 2W2WA 4MTFA 3OANA 1MOFA 3CXHF 4B3RO 1N0NA 4RUFA 5LGUA 1DYNA 1OQNA 3T1YO 1SERA 2N74A 2WA3A 1JX9A 2DW4A 1V5PA 4UCUA 4GKKB 3HPLC 3ZMUA 2MW2B 4HNAB 1Q6UA 4F4LA 4KL1A 3K0GA 1FJGO 5H2FZ 1IZ3A 2QKMA 5DEDA 4DV2B 4DUZB 4X62B 2YF0A 4J7KA 1KUQA 3BAAA 4B7EA 3BFRA 1ZC3B 2CTPA 1WJMA 1RPRA 2ZD9A 2EIKC 2LOZA 5LONB 4ICGA 3APOA 5E1AC 2D11A 1GM7A 1OCRC 2YXYA 4UCVA 2JRIA 3E89A 5L3EA 4BWAA 2ZR2A 1VEWA 4FFBA 4DK0A 3ZHQA 3LJUX 1ENVA 4PV1B 3BA9A 4FLTA 3QBVB 3ZN0A 2F4VB 2EJ8A 1SS3A 3L72H 1J19A 1UJWB 4FFBB 3ULBA 4JASA 1NU2A 3VQVA 4LC1A 2ZNJA 3ASOB 2R72A 1I5XA 3JARA 5E79Z 4JI7B 1R6KA 5JQGA 4OPAA 3O96A 5JWPA 2IJHA 3SDLA 2ZT9B 3OMNB 4MVSA 4DR1O 4TUYA 1WA8A 1ORQC 5HE0A 2P4KA 4DV3B 3ABUA 5JQGB 4GKJO 3FB7C 1I2HA 3ZMTA 4K2OA 3SYQA 4YHHO 1SRYA 1JCHA 3AU4A 1PD3A 2K8EA 3RVYA 1PL4A 1SA0B 5LMNB 2ZDIC 1AR5A 1CP9A 2ILMA 2ROZB 5LXTA 1MPHA 2RRFA 2N05A 4PA4A 4B7KA 4DBBA 2K1EA 2ODMA 2LKOA 2GJYA 3U11A 1RJ2A 1NI2A 4DV4O 2EZPA 3JYCA 2OT5A 4I0XA 4WFEA 2QKAA 4D0NB 2Q7GA 4JYBA 1H2MA 2QWOB 2YSUB 1YHQV 4D7SA 1YJWV 1EN6A 3OGCC 4MVRA 1PNMA 1M93A 2ZE7A 1J95A 2EMSA 2JVDA 4FLZA 3DC6A 4DV2O 1WAZA 5HE1A 1NBMG 1M7EA 3AG4B 4X62O 2Q0OC 4BAYA 1T77A 1I08A 1B55A 5IJ9B 3F5TA 4D6WA 4X88A 3OGIB 1AI6A 4NTWA 4X66B 1YSCA 1GN6A 4A6KA 4ZIBA 3TCUA 1NH2D 1XMOO 4FIPC 2KB1A 2YIBD 4JAUA 3SYXA 4F7GA 2F4VO 4I5SA 1FGZA 3AEIA 3LSUA 1S77D 5CA3A 3SPHA 1OCZB 5FI0A 4H37A 4X64B 1NI8A 5JJNB 3TO1A 4CYEA 2IU0A 5BZBA 2ZCEA 3JATA 3VIAA 3RN4A 2VSZA 4HB0B 2CTWA 2GUZA 2H7EA 1FD9A 4E2LA 3JD3A 1K8AW 4B3SO 1MIXA 3KY9A 2V4DA 2MK3A 4DV3O 1AROP 3JATB 4HHVA 4PI2A 5FL7G 3ZRWA 4X8AA 2YRYA 4LF9B 2EIMC 2F23A 4GMXB 1N33B 2X18A 5KUMA 1CPYA 2P8VA 4BIOA 1XL6A 1H2KA 3L70H 2DHJA 2WLKA 3TGUH 3W7SA 4GX2A 4IIJA 3RFRA 3G6EV 3CS5A 1YCIA 5JCOA 5DH9B 2ZNIA 1QU7A 2Y0PA 1Z5WA 4DR6O 5HFLA 3TXSA 4UVAA 2UXBB 2F95B 4JYYA 4B08A 3AG2B 2F93B 2P06A 1N34B 1I0HA 3JAWB 4HAVB 5EZYA 2Y0IA 4UV9A 1JJOA 5K1PA 1US6A 5EBWC 2XAJA 2DKPA 2H8PC 2L2IA 4DV0O 3E35A 2P0HA 5EZYB 1TVKA 4MSWC 1QQCA 1Q86W 3QG5A 1R73A 5CN0A 4JI4B 1BHAA 3KCXA 3I5DA 1YZBA 2E74B 5KMGA 4X20B 4DV7O 2R0DA 1N36B 1JA8A 2R9IA 4O2BA 5BR8B 2DN6A 2AHYA 2QGNA 5KMGB 2P67A 2Z14A 3SR2C 3NW8A 4MTOA 4O2BB 1K33A 1MK7B 3MHSC 5EBMC 1WNSA 3RYHB 4TV8A 3CCUV 3HQCA 4KP4A 2ZXWB 3OTOO 1E5WA 2RJZA 1VP7A 4J80A 5CLQB 3H1HH 4WFBV 3PSCA 3ZCCA 4YXWG 4X64O 2UU9B 2Y4TA 4IYIA 4P7IA 2UXCO 2OTLV 2YIDA 3M1IB 4O4IA 4HDQA 1EM1A 4LF5O 3KSYA 1V61A 5JP4A 1SESA 2VWJA 3BHPA 3LUTB 2W0FC 1FXVA 2D9YA 1I94O 2JGDA 3T1CA 3WG7B 1KB9F 2EINC 3EXAA 2CE4A 1EZJA 2Z0OA 4LF8O 4WSFA 2GV9A 1JOYA 2J0JA 3E86A 1BMFG 2R9AA 4AILC 4YJ3B 4UCOA 2Q9LA 1F4NA 4GX0A 4UCRA 1HNXB 2XAHA 4OX9O 4BW5A 1H8HG 4RQEA 2LULA 1SZTA 3ZRXA 2MWNB 3OFNG 3GYPA 3ZHUA 3ZDTA 1U5FA 1F7YA 3PVUA 1QCEA 4NXNB 1N34O 1WPBA 4RQFA 3K5OA 3STZC 4CS4A 3T4DA 3ASNC 3FSSA 4B6HA 4JI3O 2P22C 3JD2A 1N32B 4PELA 4Z2WA 5JCOC 1VQMV 3BVOA 1V9PA 1IBKB 2QSAA 3RYFA 3S3WA 4U3JA 1QLEC 4LF6B 3CEIA 5H5NA 3SUZA 4G28B 1WB7A 3RYFB 5D3YA 1N36O 3H01A 5JLJB 4ZI7B 1B6QA 3G71V 5L81A 1QR9A 3QWMA 2QWPB 2X6CA 4O4HA 3QTCA 1G8MA 1AI7A 3ZBHA 5J2TA 3HIEA 1TUBA 1M5IA
chains in the Genus database with same CATH topology
3JD1A 2Q6AA 1WPXA 4UV8A 1R3IC 2M7WA 2W6IG 1VQ4V 2DYRC 2HLDG 2LP7A 3ABLC 3OAAG 3I55V 1Q7YW 3CYOA 1M56C 3SYAA 4TSFG 1V55C 4JF3A 5B3SC 1K7DA 1G4YB 1EFRG 4PDRA 4TT3G 5C93A 1YTFD 2Q67A 3FKSG 5H9CA 1RPOA 4WFGA 1KKDA 2DYRB 3ABLB 1VQ5V 2JJ2G 3E8BA 4DO2A 1M56B 2P6JA 1V55B 2HFEC 4P9PA 5B3SB 4JYCA 4HAMA 3CC2V 3E8HA 5L3BA 3ZMVA 5KA6A 1NH2B 3AG3C 3EHBB 2QM7A 1S5HC 2ZDIA 3D36A 5H6QA 3SPIA 2DWEC 2JEUA 3BEHA 1VQNV 4ZBMA 3WG7C 3CC4V 1WLEA 4U7OA 4ASUG 4DXWA 1R3JC 3RBZA 3R65A 2IU3A 3GB7C 3IFXA 4PA6A 2QA4V 4MVOA 3OE7G 1R3KC 1Y66A 4BIUA 5IYDO 3CMAV 3RVZA 1KP2A 2AHZA 2BOCC 4QIWF 4R6ZA 3ABMC 3WFVA 4FPPA 1QVGU 5LHHA 1ZWIC 3K79A 4MTXA 5L3DA 3AG3B 5IYCO 2JEXA 4P30A 1H38A 2ITCC 3E8GA 4Q20A 2V7QG 1L1FA 2OTJV 4MW3A 2OCCC 3DGEA 3T4ZA 3SYOA 3OMAB 3OUFA 2NLJC 4LCUC 2XNDG 3T2MA 3OEEG 2F43G 1TUEB 1YI2V 1KD1W 5DN6G 3OR6C 4UXNA 4LBEC 1EBOA 4MVZA 1FXKC 3ABMB 4MTFA 3CPWU 2ZQMA 3I56V 1MOFA 4RUFA 3E83A 5LGUA 1COWG 5H6RA 1SERA 1NVPB 1K34A 3CCVV 1JX9A 2DW4A 2Q69A 1QBZA 2OCCB 3CCQV 3CMEV 3CCSV 3CD6V 4XBFA 3F7VC 3QO7A 3CCRV 2P90A 3HPLC 3ZMUA 2EIJC 2Q68A 5B1AC 4F4LA 2NNUA 3K0GA 1M9NA 1FXKB 3LNMB 4EKWA 3AG1C 4P9OA 3UKMA 1Y4MA 4LP8A 3HB3B 2ZD9A 1RPRA 2EIKC 2HVJC 1W0KG 2EBOA 2X7RB 3SYPA 4N21A 3ZMSA 2EILC 2XOKG 2Z5UA 4PA9A 5E1AC 5B1NA 3CXCU 1VQ6V 2WLIA 2GHYA 1GM7A 1OCRC 3KG2A 3ASOC 2EIJB 5B1BC 3E89A 1KP3A 5L3EA 5B1AB 3VOUA 1DF5A 2ZR2A 3NXSA 3ML0A 2WLIB 3AG1B 1DLBA 2ZR3A 4OXSA 2WPDG 2B1IA 1ENVA 3ZN0A 2EIKB 4UVCA 1E1QG 2Y69B 1DTOA 1UJWB 1KC8W 2EILB 4JASA 2PI4A 4G27B 4LC1A 1OCRB 4JAVA 3ASOB 5LBQA 1BHBA 2QTOA 2IW5A 2C2AA 2QE7G 5IY5C 1I5XA 3LSQA 5B1BB 5L3CA 4ZKIA 4PDLA 3LDEA 5EK0A 1R6KA 3K06A 4MW8A 4WCEV 4JTDB 2IJHA 3FYEB 1S76D 3OMNB 4MVSA 1OCOC 2QKSA 1ORQC 3CCLV 1H2GA 3ABUA 2IJKA 1Q81W 2WLLA 1AJPA 1GM9A 3FB7C 3ZIAG 4GX5A 3ZMTA 2XASA 3OEHG 3SYQA 5CBGA 2XAFA 5IY5B 1SRYA 3UM7A 1JCHA 1YJNV 4N23A 1PD3A 1E79G 2WLLB 3LDCA 4HZ3A 3RVYA 1AR1B 1YJ9V 5DM6V 2ZDIC 4PDMA 1PKXA 2V1DA 3D3IA 1CP9A 1K5SA 4QPKA 1GKFA 1OCOB 4PA4A 3GWOA 1PL0A 1NR1A 3ETGA 2K1EA 4JPRA 2CK3G 5CBHA 4XDLA 3SPCA 3P32A 1M90W 2EZPA 3JYCA 2OT5A 4H33A 4J9YB 4G2KA 2IJIA 5LHIA 2WLMA 3AG4C 4WFEA 2A79B 2DWDC 2FTKA 3RW0A 3CCEV 4JYBA 4PA3A 2QEXV 2YSUB 1YHQV 1N8RW 1YJWV 2XAGA 3ZRSA 4L87A 3OGCC 3SJQC 4MVRA 1PNMA 5HFMA 1J95A 1K4CC 2IH3C 2EJRA 3B8NA 1QVFU 1DF4A 3ETDA 1VQ7V 1NBMG 4R7CA 3K03A 3AG4B 3K08A 1PNLA 3SYCA 2BOBC 4FJCC 4BAYA 3ABTA 1S72V 1OHHG 4MVUA 4GCZA 2DYSC 2ATKC 2HG5C 5KUKA 2YEVA 4X88A 1AI6A 2XAQA 1OCZC 3SPJA 1YSCA 4QE9A 2D3OW 5GW7A 3TCUA 2YEVB 4CZZA 1NH2D 4FIPC 4MTGA 2KB1A 4KUMA 4RO2A 3P30A 4JAUA 3CCJV 4BIZA 4UVBA 2DYSB 4I5SA 3AEIA 1S77D 4QPJA 5CA3A 3SPHA 2A9HA 2DQ3A 1JPXA 1OCZB 1F51A 4H37A 5J9PC 4GX1A 1R6NA 3X2QC 3IGAC 5EBLC 4MVMA 2JDIG 2IU0A 4Z1MG 5BZBA 2Y69C 1XL4A 4XDKA 4QNHB 2P7TC 1V54C 1YIJV 1AI5A 4E2LA 3JD3A 1K8AW 4X89A 1P7BA 2MK3A 3F7YC 1AI4A 1AROP 3M99B 1FXHA 3DCXA 3VBBA 1VQLV 5FL7G 2QM8A 3ZRWA 4FMTA 4X8AA 3ZRVA 5KA5A 1K4DC 2B5UA 2X6BA 1H8EG 1K5QA 2EIMC 3E8FA 3X2QB 3AG2C 5KUMA 1CPYA 2LFRA 1NVPD 3DTUB 1HWYA 1K92A 1V54B 1YTFB 1XL6A 2WLKA 2UXXA 3MHHC 1OZ0A 4GX2A 3W7SA 3K9AA 3G6EV 1W2BU 3FYIB 1K73W 1M1KW 1QR8A 3K3WA 2WAMA 3QNEA 3HSAA 2W6JG 4QE7A 4JTCB 4PA7A 5HFLA 2R9RB 4J9ZB 4UVAA 3LDDA 4MVQA 2IH1C 2EIMB 3FB6C 5LGTA 1MSWD 1RM1C 3AG2B 5LHGA 4UV9A 2UXNA 4FK5C 4WFHA 4QJFB 2B1GA 2WLJA 2XAJA 5EBWC 2H8PC 1R3LC 1E1RG 3E35A 3CP1A 4R50A 3IC7A 4U7NA 4MSWC 3JD4A 1Q86W 1R73A 5CN0A 1GMGA 1VQ8V 5L3FA 3CC7V 1BHAA 2HVKC 1RM1B 2WLHA 2X6AA 1KQSU 2ZXWC 1VQPV 4RUEA 2R9IA 1GM8A 4JGSA 3W7WA 4HYOA 2AHYA 3QO8A 3FB5C 2GSMB 5B1OA 3ZMZA 3TETA 2P67A 3LSSA 1VQOV 4MTOA 1K33A 2LFSA 3ETEA 1F23A 3OUSA 3A0RA 3MHSC 5EBMC 1GO3F 4XDJA 3CCUV 3K04A 4KP4A 2ZXWB 1OCCC 2PI5A 1M57C 4R8CA 1P4RA 3EFFK 4UUJC 4WFBV 1GTOA 1PNKA 3MD0A 5IYBO 3ZCCA 3ABKC 4YXWG 1K3EA 1FS0G 1LNQA 2WSSG 3OMIB 4RAIA 3TK1A 1NKDA 4JTAB 3ZN1A 1NQTA 4KFMA 4MS2A 2OTLV 5L3GA 4TWKA 3BY6A 1QLNA 2Y48A 1KECA 1GK9A 3OR7C 3W7UA 1OCCB 1SESA 1M57B 3LUTB 2W0FC 2IJJA 1FXVA 1CEZA 4P2ZA 3JCZA 5LGNA 2WLNA 3PJSK 3ABKB 3T1CA 3B8MA 3W7XA 1NJIW 3WG7B 2HJFC 2EINC 5IDJA 3SPGA 1Q82W 1AJNA 1EZJA 1ROPA 3OW2U 1JOYA 3F5WC 1AJQA 4WFAV 3E86A 2ITDC 2WWWA 1K97A 1BL8A 2HR3A 5CBFA 2Z3YA 1BMFG 1IXMA 1F4NA 4GX0A 2XAHA 4BW5A 4CBCA 1H8HG 4RQEA 1W0JG 1VQ9V 1SZTA 3ZRXA 1THZA 3OFNG 2EINB 3E2EA 1FXKA 2HKOA 1K9MW 3B77A 1QCEA 1S3JA 4PDVA 2A0LA 2JK5C 4RQFA 3STZC 5EC2C 3T4DA 3ASNC 3G4SV 1NR7A 3JD2A 2JJ1G 4WF9V 1FFTB 4PELA 1VQMV 3K0DA 1MABG 3ZJZA 1S0VA 1QLEC 1JQ0A 1SETA 3ZRWB 4I9WA 1JJ2U 2DQ0A 4GT1A 4G28B 3STLC 2H94A 5CMUA 3ASNB 1F4MA 4MT8A 2EZOA 5EC1C 3H01A 1YITV 3QO5A 1B6QA 3G71V 1VQKV 1QR9A 2X6CA 2JIZG 1JVMA 3FB8C 1G8MA 1AI7A 2X0LA 3CCMV 1MG1A 1QLEB 3JD0A 1I5YA 3W7TA 3OM3B 4WFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQ0 A;  4N23 A;  1K33 A;  3CP1 A;  2M7W A;  1MOF A;  2EBO A;  1F23 A;  2X7R B;  3MHH C;  3K9A A;  3MHS C;  4N21 A;  1I5X A;  2LP7 A;  2P6J A;  3WFV A;  1QR8 A;  1SZT A;  1K34 A;  5CN0 A;  3HSA A;  3CYO A;  4E2L A;  4FIP C;  1QBZ A;  5HFM A;  5CMU A;  5HFL A;  3B77 A;  2EZO A;  1QCE A;  2MK3 A;  3B8M A;  3GWO A;  3H01 A;  3P30 A;  4JF3 A;  3M99 B;  5KA6 A;  1DF5 A;  3DCX A;  1QR9 A;  3B8N A;  1DF4 A;  4JPR A;  1DLB A;  5KA5 A;  1ENV A;  4JGS A;  2EZP A;  4FJC C;  1MG1 A;  2OT5 A;  4FK5 C;  1I5Y A;  1JPX A;  1Y4M A;  4G2K A;  1Y66 A;  5H9C A;  1EBO A; 
#chains in the Genus database with same CATH topology
 4O4H B;  2YS8 A;  4OGQ B;  1R3I C;  2W6I G;  4DV5 B;  1VQ4 V;  3DXD A;  2UUC B;  1WI1 A;  3ABL C;  3RGB A;  2YVC A;  1TUB B;  3OAA G;  1SGH A;  1Q7Y W;  4DUY B;  3CYO A;  4TSF G;  5FI1 A;  1PPJ H;  2RNR B;  1XI1 A;  4W4K A;  3GVM A;  2D9V A;  2Q67 A;  1X86 A;  2VQF B;  3ZX6 A;  4IHJ A;  4J7J A;  4GMV A;  2YS5 A;  1IBM B;  4IHJ B;  1ISN A;  3ZMV A;  5KA6 A;  5LP6 B;  5KHI A;  3AG3 C;  2VQE O;  5LOV B;  2IYB A;  3N7C A;  3WG7 C;  1WLE A;  4U7O A;  4DXW A;  4IOY X;  2IU3 A;  4MVO A;  1R3K C;  1Y66 A;  4U3F H;  3TFM A;  3RVZ A;  1KP2 A;  5C8Y A;  4B3M O;  4R6Z A;  3ABM C;  1SQQ H;  1PLS A;  4FPP A;  4NXN O;  2H7D A;  4TOI A;  3AK1 A;  3K79 A;  1IVS A;  1DK1 A;  1H38 A;  2ITC C;  5BY1 A;  4LFB O;  3C3T A;  4Q20 A;  1L1F A;  2AEH A;  5CB4 A;  4HB3 B;  3DGE A;  4QJ5 B;  3ZVR A;  2ZE6 A;  3DXR B;  2NLJ C;  4JI5 B;  3C90 A;  5JH7 A;  3T2M A;  1IBK O;  3OEE G;  2COF A;  4L1R A;  5DN6 G;  1VF7 A;  1XMQ O;  1EBO A;  5EIB D;  3EVK A;  1ZC4 B;  2KKW A;  5KAF Z;  3JSN A;  2Z4D A;  1QC6 A;  1NVP B;  3CE2 A;  4X65 B;  2OCC B;  2CH7 A;  3CME V;  2QKL A;  3AG7 A;  4KXR A;  3F7V C;  3QO7 A;  3CCR V;  2P90 A;  2YDE A;  3C3S A;  2Q68 A;  2E3C A;  5B1A C;  2NNU A;  3DC5 A;  2CH7 B;  3LNM B;  3UKM A;  1Y4M A;  2COC A;  3BAB A;  1LB1 A;  5DI9 B;  4K35 A;  5B66 Z;  1W0K G;  1O9G A;  2RMK B;  2E5L B;  2EIL C;  3KRX A;  2DE0 X;  4YY3 B;  4B3R B;  4ZHQ A;  3T1Y B;  2AW9 A;  4DX8 A;  2AXT Z;  3ML0 A;  5IRS A;  1YDX A;  3RT3 C;  1B06 A;  4ZHQ B;  2UXD O;  2Q4P A;  2EIK B;  4F7U P;  3BIN A;  2PI4 A;  5BMV A;  1DBH A;  3NWA A;  1URF A;  1OCR B;  2YI8 A;  1N3H A;  3IVF A;  4JAV A;  1IBM O;  5LBQ A;  1BHB A;  1MK9 B;  2QTO A;  2C2A A;  2QE7 G;  5IY5 C;  3ZHV A;  2JS3 A;  2LOX A;  4ZKI A;  4PDL A;  3APQ A;  4I55 A;  4QGP A;  3K06 A;  1ZUQ A;  5BMV B;  1U2B A;  1Z2G A;  5JJE B;  1BQ0 A;  1OCO C;  2QKS A;  3CCL V;  2F1M A;  4I55 B;  4EB6 A;  2R09 A;  1LUW A;  2IJK A;  2YXH A;  1KZG A;  3WYF B;  3A98 B;  5LMU O;  1W59 A;  1MSD A;  1EF1 A;  2XAS A;  3RYC A;  5CBG A;  3SO6 A;  3UM7 A;  1YJN V;  1YVW A;  4EB6 B;  1E79 G;  2GBO A;  3LDC A;  5K1X A;  2Y8F A;  5CLL B;  2OYQ A;  4A6F B;  4MT7 A;  4J42 A;  4JI5 O;  1PL0 A;  1NR1 A;  3ETG A;  4L8J A;  4JPR A;  3ML4 A;  5EYP B;  3P32 A;  5DHF B;  5J2U B;  2QWQ B;  4G2K A;  2CAZ C;  5LHI A;  1NTV A;  2A79 B;  4NXM B;  4HB2 B;  2YT0 A;  3CCE V;  4PA3 A;  1QQG A;  2QEX V;  3HKD B;  1N8R W;  1FHX A;  1X59 A;  3B09 A;  4L87 A;  1AP6 A;  5D27 A;  2EJR A;  2Q73 A;  2O57 A;  2OWO A;  3B4S A;  1VQ7 V;  4R7C A;  3SYC A;  5D3W A;  5DHA B;  2BOB C;  2RGN B;  4FJC C;  1AIL A;  1ZL8 B;  4MVU A;  4FM0 A;  4GCZ A;  3UZT A;  1OY2 A;  2HG5 C;  1UNQ A;  2YEV A;  2XAQ A;  5KHG A;  4OPH A;  2D9W A;  1FOE A;  4IGG A;  4ZRI A;  4YY3 O;  1SKV A;  3BRC A;  5IT9 N;  2D3O W;  5GW7 A;  1M4U A;  1CXZ B;  4CZZ A;  2YEV B;  1WVH A;  4MTG A;  4RO2 A;  3FFQ A;  3HKE A;  2JGU A;  1W1G A;  4UVB A;  5GTH Z;  4K8X A;  1KKC A;  2XQN M;  3HKE B;  5J9P C;  2HHH O;  1R6N A;  1MAI A;  3X2Q C;  2UZS A;  5A9G A;  3ODO A;  1NTK H;  3RCP A;  1V54 C;  3P3N A;  4NY0 A;  1GG3 A;  1QNM A;  1AI4 A;  3K59 A;  4A6H A;  3M99 B;  5DEC A;  4GN1 A;  1XMO B;  3JAL A;  3ZRV A;  1K4D C;  3KZI Z;  1K5Q A;  1U29 A;  3RWR D;  2ZKO A;  1NVP D;  1HWY A;  1K92 A;  1UNR A;  2DN9 A;  3N2K A;  2UXX A;  2GUM A;  4HB4 B;  1K73 W;  2ELB A;  5F2V O;  1NU1 H;  2L1C A;  2WAM A;  1EZV H;  2R2Y A;  3HSA A;  2W6J G;  1VMG A;  3X23 A;  2R9R B;  2AZ2 A;  3LDD A;  4MVQ A;  2LW1 A;  2EIM B;  4DR4 O;  4B3S B;  3UO2 A;  3JAR B;  2DOS A;  5LHG A;  4FLY A;  4NXM O;  1GC6 A;  3H1K H;  4FK5 C;  2K2J A;  4WFH A;  4QJF B;  2YIA A;  2WLJ A;  2VWK A;  1FHW A;  1UFI A;  1WP8 A;  4TUY B;  1WA8 B;  3CP1 A;  1HNW O;  4R50 A;  3IC7 A;  3FAV A;  1KZ7 A;  3JAK A;  3KRW A;  2GCL A;  1VQ8 V;  2X6A A;  1ZSP A;  1KQS U;  4FZ0 A;  4DR6 B;  2HJD A;  1M7R A;  1YF2 A;  2BCC H;  2LW7 A;  1XEQ A;  5B1O A;  3SJB C;  5LXT B;  3VQY A;  2YT1 A;  1I7F A;  3LSS A;  1VQO V;  4H13 B;  3H1L H;  2LFS A;  3PVW A;  3ETE A;  3A0R A;  3L74 H;  1YEW A;  2J0K A;  4XDJ A;  3K04 A;  4I0X B;  4DV0 B;  1BZK A;  1M57 C;  4AI8 A;  3WU2 Z;  1P4R A;  4TQD A;  1X11 A;  3EFF K;  4UUJ C;  3ODW A;  3ABK C;  4NYK A;  1GH6 A;  5LL6 Y;  1LNQ A;  2N04 A;  3WA0 A;  1NKD A;  3H9V A;  2KUQ A;  2UUA B;  4KFM A;  4DV7 B;  5L3G A;  3J7A U;  1P7G A;  4TWK A;  2UZR A;  2Y48 A;  1RRP B;  1KEC A;  2QJ1 A;  2LGQ A;  1Q8I A;  3U0Z A;  4KHB A;  5BXZ A;  1Q5O A;  1CEZ A;  5IJ0 A;  2D2C B;  3PJS K;  3B8M A;  5D3V A;  1NJI W;  5IDJ A;  4KHB B;  1IUR A;  4L6E A;  3A8T A;  1AJN A;  3OTO B;  4DV1 O;  5IJ0 B;  5I2S A;  1Z5V A;  1PP9 H;  1K97 A;  2HR3 A;  3H1I H;  1HW7 A;  2NN4 A;  3K5M A;  3ZED A;  2UXC B;  2P5O A;  4JI6 O;  4EMO A;  4CBC A;  4CC6 A;  2Y8G A;  1W0J G;  1THZ A;  3J81 N;  2EIN B;  3E2E A;  4LF5 B;  2QTS A;  2HE7 A;  1FXK A;  1WJ1 A;  2HKO A;  3B77 A;  4UCS A;  2A0L A;  4O4L A;  2DX1 A;  4AQY B;  1I94 B;  1DDW A;  1OV9 A;  3G4S V;  1SHC A;  2GUZ B;  2JJ1 G;  2G35 A;  1MAB G;  4LF8 B;  4O4L B;  1NTZ H;  3TXQ A;  5CA1 A;  3ZRW B;  1NTY A;  3UCS C;  4GT1 A;  5I2M A;  1N4C A;  5KHH A;  2QM4 A;  2P4V A;  4JI1 O;  5CA1 B;  1XOD A;  3ASN B;  1DRO A;  1F4M A;  3PN1 A;  2EZO A;  4LWS A;  5EC1 C;  4OX9 B;  5JHH A;  2DMX A;  3QF7 A;  4OSN A;  1O9H A;  3K9S A;  4IIJ B;  2JIZ G;  1IRS A;  1JVM A;  2IBZ H;  1XNQ O;  3CCM V;  2X0L A;  4LWS B;  1QLE B;  2XUM A;  1I5Y A;  3OM3 B;  4WFF A;  3JD1 A;  4JI3 B;  3BPZ A;  3ULC A;  1GRJ A;  2KUP A;  2Q6A A;  1WPX A;  4UV8 A;  2JP2 A;  4K81 A;  3VOQ A;  3H1J H;  2W0X A;  2DYR C;  4X1K A;  1V5U A;  3I55 V;  4K0K O;  3QIJ A;  1UNP A;  4K17 A;  2CDY A;  1TVK B;  1G4Y B;  2GTS A;  4X1K B;  2UUA O;  4PDR A;  4GNK B;  3A2F A;  4TT3 G;  1P49 A;  5C93 A;  1FYJ A;  3JAS A;  5J3Y A;  3FKS G;  1A32 A;  4WFG A;  3ZHR A;  1KKD A;  3ABL B;  4I50 A;  4AHC A;  4CH5 A;  4PQ0 A;  3E8B A;  4DO2 A;  4RWU A;  1GN2 A;  1G6U A;  1XOU A;  4F6E A;  4IL6 Z;  1MNG A;  2Y4U A;  4JYC A;  4Y94 A;  4I50 B;  3E8H A;  1XHX A;  1NT2 B;  2QDO A;  4LFA O;  1ZAU A;  2QM7 A;  1S5H C;  4JAA A;  5H6Q A;  4CSQ A;  3UT5 A;  2DWE C;  2JEU A;  4TV8 B;  1VQN V;  4E4E A;  3CC4 V;  3JAM N;  2QA4 V;  3OE7 G;  2KGX B;  5IYD O;  2PF4 E;  4UB8 Z;  1VIB A;  3CJH A;  1PV0 A;  4FZ1 A;  2BOC C;  2XT9 A;  3CSX A;  3O65 A;  1QVG U;  1H2N A;  1ZWI C;  4O4I B;  3AG3 B;  4P30 A;  4AQY O;  2BSK A;  3HR0 A;  3CJH B;  5FLX N;  1LUV A;  4MW3 A;  3GYO A;  1BCC H;  3T4Z A;  3L73 H;  3TVV A;  5LG4 B;  5HE2 A;  2XND G;  2UUB O;  2F43 G;  4EJN A;  2VQE B;  2JGD B;  2LGW A;  2Q8V A;  1FAF A;  2N0Y A;  3OT7 A;  1FXK C;  3ABM B;  2ZQM A;  3I56 V;  1XNR O;  4GYC B;  3E83 A;  1XHZ A;  4UCT A;  4F7H A;  3E22 A;  1K34 A;  1J5E O;  3CCV V;  2D4Q A;  3CCQ V;  4B3M B;  2D9X A;  4XBF A;  1HR0 O;  4O4J A;  4Z2N A;  2CY4 A;  2LYD A;  1T5E A;  3PVL A;  2EIJ C;  2RQ6 A;  3E22 B;  3M7M X;  5FPO A;  4HBN A;  3NR7 A;  4LFB B;  1M9N A;  4EKW A;  3QVN A;  3AG1 C;  4O4J B;  4JI2 O;  1FKA O;  1XRE A;  2EBO A;  2X7R B;  3SYP A;  1WGU A;  1XMQ B;  4N21 A;  2Z5U A;  5B1N A;  2WLI A;  2YUA A;  3KG2 A;  1SQG A;  4U3J B;  5B1B C;  1WP7 A;  5B1A B;  1ZTE A;  4FLV A;  4GLX A;  2WLI B;  1DLB A;  4OXS A;  2P0F A;  4DX9 0;  1U5D A;  1DGS A;  4UVC A;  4ZOL A;  1DTO A;  1KC8 W;  4EEQ A;  2EIL B;  4G27 B;  4CH4 A;  4FLW A;  2DLW A;  5EFX A;  4FM2 A;  3LSQ A;  1SF9 A;  1HNZ O;  5J2T B;  5EK0 A;  3LDE A;  2FJU B;  4ZOL B;  3IC9 A;  4ZRK A;  4MW8 A;  4WCE V;  4JTD B;  3ZS8 C;  1S76 D;  2D10 A;  4YON A;  2RVB B;  1H2G A;  2ADQ B;  3Q4H A;  3FM8 C;  1XBL A;  1Q81 W;  1AJP A;  1GM9 A;  4HAZ B;  2E75 B;  3ZIA G;  4GX5 A;  4J10 A;  2PYJ A;  5IY5 B;  3Q4H B;  1EGX A;  4N23 A;  2UXD B;  4HZ3 A;  2Z0Q A;  1YJ9 V;  1MIZ B;  2J59 M;  2V1D A;  3BJI A;  1XDC A;  1K5S A;  2M6Y A;  4QPK A;  1OCO B;  3UQ8 A;  2A06 H;  1GAX A;  4I9Q A;  1EN4 A;  2YC0 A;  3JCU Z;  5CBH A;  3NSU A;  1M90 W;  3HW2 B;  3RYI A;  4J9Y B;  2DWD C;  3OHM B;  2ETN A;  3CB2 A;  5LMU B;  3RW0 A;  2XAG A;  1S5J A;  4EKU A;  3SJQ C;  2YI9 A;  5HFM A;  1X1G A;  2DHI A;  5GON A;  4CH3 A;  2DYQ A;  2IH3 C;  5C8Y B;  5D5Q A;  3B8N A;  1EVH A;  1DF4 A;  3AJ4 A;  1AB3 A;  4CH6 A;  2AGA A;  4DR7 B;  2ELA A;  4J41 A;  2B9Z A;  2DYS C;  4HSI A;  5KUK A;  1TAE A;  5CB4 B;  4DR2 O;  4H0L B;  5JH7 B;  5JHG A;  1HDJ A;  4J7Z A;  2OTX A;  1YXB A;  3P6A A;  2AZ0 A;  4WVF B;  3HKB A;  4BIZ A;  1FB8 A;  2Q5Z A;  3U7D A;  3V5W A;  3AK3 A;  1F51 A;  1X1F A;  3HKB B;  4NSW A;  4GZR B;  4KHP O;  2BTQ A;  3IGA C;  2JDI G;  4Z1M G;  3UO3 A;  3MDS A;  1XL4 A;  4XDK A;  2BTO A;  2P7T C;  1YIJ V;  1NZ6 A;  2MFQ A;  1AI5 A;  3AK2 A;  4X89 A;  2ZE5 A;  1P7B A;  5C16 A;  2BTQ B;  1EN5 A;  2DFK A;  3TCA A;  5FPR A;  3DCX A;  3VBB A;  4DW1 A;  4DYL A;  5JJJ B;  2N23 A;  3L75 H;  5KA5 A;  2X6B A;  1H8E G;  3X2Q B;  1W1H A;  3T06 A;  3PEG A;  1NS1 A;  2LFR A;  1Y76 A;  4HAW B;  3DTU B;  1V54 B;  4NTX A;  1BAK A;  1WJZ A;  3N2G A;  2GTA A;  1W2B U;  3K9A A;  3FYI B;  2HHH B;  4JYA O;  1Y76 B;  4QE7 A;  4JTC B;  2UVM A;  4PA7 A;  1V89 A;  3N2G B;  3WB1 A;  1JMK C;  2CTR A;  2IH1 C;  3FB6 C;  4J11 A;  1RM1 C;  3K5L A;  3FVC A;  3G9W A;  3MPX A;  2DHK A;  4C7U A;  4B3T O;  4JI0 O;  5JVD A;  3T1H O;  1NTM H;  2B1G A;  2PZ1 A;  1FFX A;  1R3L C;  2ZKM X;  1E1R G;  4QXA B;  5AG2 A;  5M4Y B;  5JVD B;  1BTN A;  3JSL A;  4NB5 A;  1GMG A;  5L3F A;  3CC7 V;  3RYC B;  3D8D A;  1EAZ A;  2WLH A;  1P3R A;  4DR7 O;  2ADP A;  1VQP V;  4RUE A;  1KBH A;  1GM8 A;  1IBL O;  4HYO A;  3FB5 C;  2GSM B;  4DR4 B;  3TET A;  3KCY A;  3SJA C;  2BCJ A;  4PD4 F;  1AVM A;  3U12 A;  3OUS A;  2YIB A;  4K2P A;  2LJ2 A;  4I7Z B;  3R66 A;  1BE3 H;  1OCC C;  1HNW B;  3HK0 A;  1VF6 A;  1GTO A;  3MD0 A;  2A3Q A;  3SJC C;  1X05 A;  1K3E A;  1FS0 G;  2WSS G;  3OMI B;  3ZN1 A;  2DTC A;  4GPT B;  4JTA B;  2ZM6 B;  1NQT A;  4MS2 A;  5C79 A;  1LW3 A;  1QLN A;  1XX0 A;  1P5T A;  1VF5 B;  4LF4 B;  1M57 B;  4KVG B;  1FGY A;  4W4L A;  4P2Z A;  3JCZ A;  5LGN A;  3ABK B;  4IYH A;  3W7X A;  1Q82 W;  4YL8 A;  1XUQ A;  1FAO A;  4UFZ A;  3OW2 U;  1AJQ A;  4WFA V;  5KQ4 A;  2OCH A;  1MZF A;  2I1K A;  2K49 A;  1BL8 A;  4EFE A;  2ZIN A;  3B40 A;  5CBF A;  2Z3Y A;  3MDB C;  1IXM A;  1AP5 A;  4GOU A;  2KIE A;  4ZRJ A;  1N0J A;  1VQ9 V;  1GN4 A;  4HNA A;  3CRQ A;  4Q6G A;  3DSQ A;  2E2X A;  3PP2 A;  1UPG A;  1K9M W;  1S3J A;  2JK5 C;  2EC1 A;  4KHO A;  5EC2 C;  2CAY A;  4IFS A;  1R1B A;  1V88 A;  1NR7 A;  3KZ1 A;  4WF9 V;  1JFF A;  4WBN A;  4TV9 A;  1FFT B;  4DV1 B;  3ZJZ A;  1S0V A;  2RNB A;  1JQ0 A;  3JAL B;  1SET A;  1UPR A;  2XTA A;  2DYN A;  4I9W A;  1JFF B;  4WBN B;  4TV9 B;  1JJ2 U;  3SNH A;  4XWX A;  4JI6 B;  4MT8 A;  2VS0 A;  1Q6I A;  3N2K B;  3QO5 A;  3PZD A;  4D6T H;  4D7T A;  2OQB A;  4K3A A;  2DKQ A;  1B3Q A;  1IXB A;  1MG1 A;  3JD0 A;  3W7T A;  4X1Y A;  4QJ4 B;  4A5U B;  1D5A A;  5D5P A;  1SC5 B;  1B04 A;  5LOP B;  2M7W A;  2D9Z A;  2Z13 A;  2LP7 A;  2I1J A;  5KHJ A;  1H2S B;  4H44 B;  4X1Y B;  1M56 C;  3SYA A;  1V55 C;  4JF3 A;  4UB6 Z;  1ZYI A;  3THO A;  5B3S C;  3K57 A;  1K7D A;  3A58 A;  2ZM6 O;  1OJH A;  4JI1 B;  3FAV B;  3JAK B;  4IT5 A;  1SA0 A;  2KCJ A;  2CGO A;  3ETQ A;  4KHA A;  5H9C A;  4LF4 O;  1RPO A;  1DDM A;  2DYR B;  1XNQ B;  2AL6 A;  1L0L H;  1VQ5 V;  2FML A;  1VF6 C;  2ZE8 A;  2EJ7 A;  2P6J A;  2HFE C;  4LH7 A;  1KU9 A;  4P9P A;  4CC5 A;  1BTK A;  1SQP H;  3CC2 V;  2PZS A;  1HP8 A;  2ZIM A;  4JI8 B;  1X4T A;  5L3B A;  4K0K B;  3EHB B;  3D36 A;  1ZX3 A;  3BEH A;  4DR5 O;  4ZBM A;  4ASU G;  1R3J C;  3RBZ A;  4PA6 A;  4BIU A;  1I7A A;  1TXD A;  2AHZ A;  1D5N A;  3SGI A;  4GKK O;  1PFJ A;  3CX5 F;  1Z87 A;  1FPO A;  4MTX A;  1SQF A;  1RFY A;  3TJT A;  5IJ9 A;  1U96 A;  5KAI Z;  4LH6 A;  5DIF B;  2OTJ V;  3G80 A;  4CS2 A;  3SYO A;  1BSM A;  1SQX H;  4DUZ O;  5D3X A;  3U8Z A;  2KIG A;  4HAU B;  4LFA B;  5B5E Z;  1P6S A;  1FHO A;  4UXN A;  4MVZ A;  3L71 H;  4DK1 A;  3CPW U;  1BQZ A;  1COW G;  5H6R A;  5TIS Z;  3CWB H;  3IJ4 A;  2Q69 A;  1QBZ A;  4LR3 A;  3O9O A;  3CCS V;  3CD6 V;  5KX5 A;  1R6T A;  2DX5 A;  3FEH A;  3ICX A;  2R70 A;  3BCC H;  3KKY A;  2OIG A;  4JZG A;  1FXK B;  5KX5 B;  4ABM A;  2V76 A;  4P9O A;  2KR0 A;  3DXC A;  3CRM A;  2L6L A;  4LP8 A;  3HB3 B;  2UUB B;  2HVJ C;  5GTI Z;  4JI7 O;  2Y7B A;  3ZMS A;  3CXC U;  2XOK G;  1VQ6 V;  4PA9 A;  2GHY A;  3ASO C;  1XNR B;  4NVP A;  2HTH B;  2EIJ B;  3J80 N;  1KP3 A;  3VOU A;  1DF5 A;  1LR1 A;  4DV6 B;  3NXS A;  1J5E B;  1ZVR A;  2A7W A;  3AG1 B;  2ZR3 A;  4FM1 A;  2QR4 A;  2WPD G;  5C6R A;  2B1I A;  1HR0 B;  4Z2M B;  4FLU A;  4A5K A;  3L9D A;  4LNU A;  2LO1 A;  2PYL A;  1XCG A;  1E1Q G;  2Y69 B;  4NKG B;  4HDO A;  3G67 A;  5LMN O;  1WN7 A;  4JI2 B;  3GWK C;  2IW5 A;  2G38 A;  4LNU B;  4JI8 O;  5B1B B;  5L3C A;  2RSG A;  2PTM A;  2DJV A;  3JAW A;  4DR3 B;  3B2E E;  5KHK A;  3ZHT A;  5LA6 A;  4DXA B;  3FYE B;  4PJ0 Z;  2WLL A;  5LA6 B;  5J3T A;  4K8Z A;  3OEH G;  2K2U A;  2M38 A;  2XAF A;  3OD4 A;  2F66 C;  4QJ3 B;  4DIX A;  1Y67 A;  4X20 A;  2WLL B;  1AR1 B;  5KCV A;  1MA1 A;  2FL4 A;  2RN9 A;  5DM6 V;  3D36 C;  4PDM A;  3JAS B;  1PKX A;  3D3I A;  4GXB A;  1GKF A;  3NWF A;  5KLV H;  3A8P A;  4CS3 A;  3GWO A;  1V5M A;  2GDS A;  1HNZ B;  2FYU H;  2VRW B;  1P84 F;  2CK3 G;  5ITZ A;  1UPQ A;  4HAT B;  4XDL A;  3SPC A;  3RYH A;  4H33 A;  4X66 O;  1AWE A;  2IJI A;  2WLM A;  3AG4 C;  1XR0 B;  5ITZ B;  2Z59 A;  2FTK A;  2QKC A;  3UT5 B;  5IWA B;  2ZIO A;  2W2X C;  3MAQ A;  3ZRS A;  1OMW A;  2COD A;  1K4C C;  4NR1 A;  4PI0 A;  5A2Q N;  3DXE A;  2IM9 A;  3CRC A;  1QVF U;  4C0A A;  3ETD A;  3K03 A;  2YT2 A;  3K08 A;  1PNL A;  3ABT A;  1S72 V;  1OHH G;  1J0W A;  2DA0 A;  2RLO A;  2RDC A;  2BSK B;  4FFK A;  2ATK C;  5CA0 A;  3CXB B;  1Y5O A;  1OCZ C;  2Z0P A;  3SPJ A;  5J3Q A;  4QE9 A;  2IFS A;  2EX3 A;  1VAR A;  4YIP A;  2QWN B;  3VQX A;  5CA0 B;  4DV6 O;  4KUM A;  3P30 A;  4LF9 O;  3CCJ V;  2MKR A;  4YJ3 A;  1N33 O;  2DYS B;  1Q67 A;  2CUG A;  4KAX B;  4QPJ A;  2A9H A;  2DQ3 A;  1JPX A;  3CHX A;  2GS0 A;  1MI1 A;  2CGN A;  4BR6 A;  1U27 A;  4GX1 A;  4TKN A;  1TQZ A;  4GUN A;  2D2Q A;  3FX7 A;  5EBL C;  4DR3 O;  4MVM A;  1BWN A;  2Y69 C;  4QNH B;  2UXB O;  1QHT A;  3LNN A;  3M8A A;  3U10 A;  4DR2 B;  4BBK A;  2Z0A A;  3F7Y C;  4JZ2 A;  1FXH A;  1VQL V;  2QM8 A;  4FMT A;  1IX9 A;  2W2X D;  1U5E A;  2B5U A;  3ZHS A;  3E8F A;  1BT8 A;  2ARH A;  3AG2 C;  2NBV A;  2KQX A;  4TYZ A;  3SV1 A;  2BE3 A;  1YTF B;  3G6B A;  2RUK B;  4TQF A;  4HAX B;  4ZI7 A;  4JI4 O;  1AQC A;  3S3X A;  3MHH C;  1OZ0 A;  4LFC B;  1M1K W;  1QR8 A;  1WGQ A;  3K3W A;  2VKI A;  4KHP B;  3QNE A;  1RSO A;  4JV5 B;  4Z1V A;  1H2L A;  4J9Z B;  2KG7 A;  5BR8 O;  3D8F A;  2FB5 A;  2NMB A;  5LGT A;  3F5R A;  1MSW D;  3K5N A;  2YS3 A;  3A0B Z;  1TA8 A;  1RSO B;  1TJ6 A;  2YS1 A;  3CRR A;  2UXN A;  2KG7 B;  5IYZ A;  5IWA O;  1XIL A;  2YIC A;  1KI1 B;  1BGY H;  4U7N A;  2I5C A;  5IYZ B;  3JD4 A;  2CTQ A;  2HVK C;  1RM1 B;  5EIB C;  5FNV A;  1GC7 A;  5KQ1 A;  2UU9 O;  2ZXW C;  2ROV A;  2NR5 A;  4JYA B;  3VQW A;  1GN3 A;  1DDV A;  4JGS A;  3W7W A;  3A0H Z;  3QO8 A;  5FNV B;  3ZMZ A;  2P0D A;  4B3T B;  4JI0 B;  3T1H B;  1H4R A;  4MK0 A;  3CRA A;  5LP6 A;  1MMM A;  1F23 A;  3RYI B;  1BS3 A;  1KYO F;  1GO3 F;  5LOV A;  2ZPY A;  2L35 A;  5HE3 A;  3HKC A;  4YIO A;  3CIK A;  2PI5 A;  4R8C A;  1ZM0 A;  1PNK A;  5IYB O;  2YXL A;  3HKC B;  5IE9 A;  2XHB A;  4RAI A;  3TK1 A;  2EUL A;  1HNX O;  1RP3 B;  3K58 A;  5GON B;  4CHM A;  1PM9 A;  3WB0 A;  3BY6 A;  1IBL B;  4PHZ A;  1GK9 A;  1U97 A;  2KSD A;  3OR7 C;  1OCC B;  3W7U A;  2K00 A;  2IJJ A;  3DXR A;  4X1I A;  4BW9 A;  3A8Q A;  2WLN A;  4FLX A;  2MDX A;  1SQV H;  2HJF C;  2JS5 A;  3SPG A;  1N32 O;  4X1I B;  1ROP A;  4IAP A;  4F6R A;  2CRF A;  3F5W C;  2COA A;  2ITD C;  2OIE A;  2WWW A;  4LF6 O;  1K5D B;  3TW1 A;  1S5L Z;  2Q7H A;  3P3P A;  4LFC O;  1ZSQ A;  1Q90 D;  4F6R B;  1AR4 A;  3F0W A;  2Q13 A;  3FD9 A;  4LF7 B;  4JV5 O;  1Q43 A;  1Y19 B;  2GCJ A;  2PUS A;  2QWR B;  4PDV A;  4YJ2 A;  2PY5 A;  4MY6 A;  3ODX A;  3P7Z A;  2Q0A A;  3D3Q A;  4FVM A;  2E76 B;  1UEF A;  3D8C A;  4DV5 O;  3K0D A;  4I4T A;  2LQT A;  4YJ2 B;  2UUC O;  1IDS A;  2YSZ A;  4DUY O;  3BA8 A;  2DQ0 A;  2M14 A;  4I4T B;  3PG7 A;  3STL C;  2H94 A;  1Q6H A;  5CMU A;  5C5B A;  1YIT V;  1K5G B;  1VQK V;  2VQF O;  4OT1 A;  5LYJ A;  1ZLZ A;  4X9Q A;  3FB8 C;  1Y6X A;  2ADZ A;  5C5B B;  2I5F A;  2K9P A;  4GZU A;  4EFB A;  1MZE A;  5LYJ B;  1FJG B;  3N27 A;  1WG7 A;  2HLD G;  4DRX A;  3IAY A;  1JR9 A;  1FFX B;  1W1D A;  4WJ7 A;  2PGG A;  1EFR G;  2H3O A;  3WB2 A;  4DRX B;  1L8D A;  5LP6 C;  3OTF A;  1YTF D;  1MKE A;  1XD4 A;  3AU5 A;  1TGO A;  4A6F A;  2LG1 A;  2JJ2 G;  2RCV A;  5GOW B;  1M56 B;  1Q3E A;  1V55 B;  4PNK A;  5EYP A;  5B3S B;  5J2U A;  1PMS A;  4HAM A;  1KMI Z;  2WA4 A;  1NH2 B;  1SQB H;  2ZDI A;  3SPI A;  2HP8 A;  2J0M A;  4DR1 B;  3NWD A;  3HKD A;  3R65 A;  3GB7 C;  2HEP A;  3IFX A;  4NTY A;  4HAY B;  4CHJ A;  3CMA V;  2Q7E A;  4LF7 O;  1WB8 A;  1SZX A;  4GKJ B;  1H10 A;  2NZ8 B;  4X65 O;  2VRZ A;  4YHH B;  4QIW F;  1Y74 A;  4H8S A;  3WFV A;  2EMT A;  4DW0 A;  4O2A A;  5LHH A;  1XQ8 A;  5L3D A;  2CY5 A;  1ZL8 A;  5IYC O;  2JEX A;  3E8G A;  2FJL A;  2V7Q G;  1Y74 B;  1XKE A;  2OCC C;  1U5G A;  3OMA B;  2FKX A;  3OUF A;  4O2A B;  4LCU C;  1G1X B;  3D8E A;  1TUE B;  1YI2 V;  1D2D A;  1KD1 W;  3OR6 C;  1L0N H;  4LBE C;  2E5L O;  4DR5 B;  4DV4 B;  2W2W A;  4MTF A;  3OAN A;  1MOF A;  3CXH F;  4B3R O;  1N0N A;  4RUF A;  5LGU A;  1DYN A;  1OQN A;  3T1Y O;  1SER A;  2N74 A;  2WA3 A;  1JX9 A;  2DW4 A;  1V5P A;  4UCU A;  4GKK B;  3HPL C;  3ZMU A;  2MW2 B;  4HNA B;  1Q6U A;  4F4L A;  4KL1 A;  3K0G A;  1FJG O;  5H2F Z;  1IZ3 A;  2QKM A;  5DED A;  4DV2 B;  4DUZ B;  4X62 B;  2YF0 A;  4J7K A;  1KUQ A;  3BAA A;  4B7E A;  3BFR A;  1ZC3 B;  2CTP A;  1WJM A;  1RPR A;  2ZD9 A;  2EIK C;  2LOZ A;  5LON B;  4ICG A;  3APO A;  5E1A C;  2D11 A;  1GM7 A;  1OCR C;  2YXY A;  4UCV A;  2JRI A;  3E89 A;  5L3E A;  4BWA A;  2ZR2 A;  1VEW A;  4FFB A;  4DK0 A;  3ZHQ A;  3LJU X;  1ENV A;  4PV1 B;  3BA9 A;  4FLT A;  3QBV B;  3ZN0 A;  2F4V B;  2EJ8 A;  1SS3 A;  3L72 H;  1J19 A;  1UJW B;  4FFB B;  3ULB A;  4JAS A;  1NU2 A;  3VQV A;  4LC1 A;  2ZNJ A;  3ASO B;  2R72 A;  1I5X A;  3JAR A;  5E79 Z;  4JI7 B;  1R6K A;  5JQG A;  4OPA A;  3O96 A;  5JWP A;  2IJH A;  3SDL A;  2ZT9 B;  3OMN B;  4MVS A;  4DR1 O;  4TUY A;  1WA8 A;  1ORQ C;  5HE0 A;  2P4K A;  4DV3 B;  3ABU A;  5JQG B;  4GKJ O;  3FB7 C;  1I2H A;  3ZMT A;  4K2O A;  3SYQ A;  4YHH O;  1SRY A;  1JCH A;  3AU4 A;  1PD3 A;  2K8E A;  3RVY A;  1PL4 A;  1SA0 B;  5LMN B;  2ZDI C;  1AR5 A;  1CP9 A;  2ILM A;  2ROZ B;  5LXT A;  1MPH A;  2RRF A;  2N05 A;  4PA4 A;  4B7K A;  4DBB A;  2K1E A;  2ODM A;  2LKO A;  2GJY A;  3U11 A;  1RJ2 A;  1NI2 A;  4DV4 O;  2EZP A;  3JYC A;  2OT5 A;  4I0X A;  4WFE A;  2QKA A;  4D0N B;  2Q7G A;  4JYB A;  1H2M A;  2QWO B;  2YSU B;  1YHQ V;  4D7S A;  1YJW V;  1EN6 A;  3OGC C;  4MVR A;  1PNM A;  1M93 A;  2ZE7 A;  1J95 A;  2EMS A;  2JVD A;  4FLZ A;  3DC6 A;  4DV2 O;  1WAZ A;  5HE1 A;  1NBM G;  1M7E A;  3AG4 B;  4X62 O;  2Q0O C;  4BAY A;  1T77 A;  1I08 A;  1B55 A;  5IJ9 B;  3F5T A;  4D6W A;  4X88 A;  3OGI B;  1AI6 A;  4NTW A;  4X66 B;  1YSC A;  1GN6 A;  4A6K A;  4ZIB A;  3TCU A;  1NH2 D;  1XMO O;  4FIP C;  2KB1 A;  2YIB D;  4JAU A;  3SYX A;  4F7G A;  2F4V O;  4I5S A;  1FGZ A;  3AEI A;  3LSU A;  1S77 D;  5CA3 A;  3SPH A;  1OCZ B;  5FI0 A;  4H37 A;  4X64 B;  1NI8 A;  5JJN B;  3TO1 A;  4CYE A;  2IU0 A;  5BZB A;  2ZCE A;  3JAT A;  3VIA A;  3RN4 A;  2VSZ A;  4HB0 B;  2CTW A;  2GUZ A;  2H7E A;  1FD9 A;  4E2L A;  3JD3 A;  1K8A W;  4B3S O;  1MIX A;  3KY9 A;  2V4D A;  2MK3 A;  4DV3 O;  1ARO P;  3JAT B;  4HHV A;  4PI2 A;  5FL7 G;  3ZRW A;  4X8A A;  2YRY A;  4LF9 B;  2EIM C;  2F23 A;  4GMX B;  1N33 B;  2X18 A;  5KUM A;  1CPY A;  2P8V A;  4BIO A;  1XL6 A;  1H2K A;  3L70 H;  2DHJ A;  2WLK A;  3TGU H;  3W7S A;  4GX2 A;  4IIJ A;  3RFR A;  3G6E V;  3CS5 A;  1YCI A;  5JCO A;  5DH9 B;  2ZNI A;  1QU7 A;  2Y0P A;  1Z5W A;  4DR6 O;  5HFL A;  3TXS A;  4UVA A;  2UXB B;  2F95 B;  4JYY A;  4B08 A;  3AG2 B;  2F93 B;  2P06 A;  1N34 B;  1I0H A;  3JAW B;  4HAV B;  5EZY A;  2Y0I A;  4UV9 A;  1JJO A;  5K1P A;  1US6 A;  5EBW C;  2XAJ A;  2DKP A;  2H8P C;  2L2I A;  4DV0 O;  3E35 A;  2P0H A;  5EZY B;  1TVK A;  4MSW C;  1QQC A;  1Q86 W;  3QG5 A;  1R73 A;  5CN0 A;  4JI4 B;  1BHA A;  3KCX A;  3I5D A;  1YZB A;  2E74 B;  5KMG A;  4X20 B;  4DV7 O;  2R0D A;  1N36 B;  1JA8 A;  2R9I A;  4O2B A;  5BR8 B;  2DN6 A;  2AHY A;  2QGN A;  5KMG B;  2P67 A;  2Z14 A;  3SR2 C;  3NW8 A;  4MTO A;  4O2B B;  1K33 A;  1MK7 B;  3MHS C;  5EBM C;  1WNS A;  3RYH B;  4TV8 A;  3CCU V;  3HQC A;  4KP4 A;  2ZXW B;  3OTO O;  1E5W A;  2RJZ A;  1VP7 A;  4J80 A;  5CLQ B;  3H1H H;  4WFB V;  3PSC A;  3ZCC A;  4YXW G;  4X64 O;  2UU9 B;  2Y4T A;  4IYI A;  4P7I A;  2UXC O;  2OTL V;  2YID A;  3M1I B;  4O4I A;  4HDQ A;  1EM1 A;  4LF5 O;  3KSY A;  1V61 A;  5JP4 A;  1SES A;  2VWJ A;  3BHP A;  3LUT B;  2W0F C;  1FXV A;  2D9Y A;  1I94 O;  2JGD A;  3T1C A;  3WG7 B;  1KB9 F;  2EIN C;  3EXA A;  2CE4 A;  1EZJ A;  2Z0O A;  4LF8 O;  4WSF A;  2GV9 A;  1JOY A;  2J0J A;  3E86 A;  1BMF G;  2R9A A;  4AIL C;  4YJ3 B;  4UCO A;  2Q9L A;  1F4N A;  4GX0 A;  4UCR A;  1HNX B;  2XAH A;  4OX9 O;  4BW5 A;  1H8H G;  4RQE A;  2LUL A;  1SZT A;  3ZRX A;  2MWN B;  3OFN G;  3GYP A;  3ZHU A;  3ZDT A;  1U5F A;  1F7Y A;  3PVU A;  1QCE A;  4NXN B;  1N34 O;  1WPB A;  4RQF A;  3K5O A;  3STZ C;  4CS4 A;  3T4D A;  3ASN C;  3FSS A;  4B6H A;  4JI3 O;  2P22 C;  3JD2 A;  1N32 B;  4PEL A;  4Z2W A;  5JCO C;  1VQM V;  3BVO A;  1V9P A;  1IBK B;  2QSA A;  3RYF A;  3S3W A;  4U3J A;  1QLE C;  4LF6 B;  3CEI A;  5H5N A;  3SUZ A;  4G28 B;  1WB7 A;  3RYF B;  5D3Y A;  1N36 O;  3H01 A;  5JLJ B;  4ZI7 B;  1B6Q A;  3G71 V;  5L81 A;  1QR9 A;  3QWM A;  2QWP B;  2X6C A;  4O4H A;  3QTC A;  1G8M A;  1AI7 A;  3ZBH A;  5J2T A;  3HIE A;  1TUB A;  1M5I A; 
#chains in the Genus database with same CATH homology
 3JD1 A;  2Q6A A;  1WPX A;  4UV8 A;  1R3I C;  2M7W A;  2W6I G;  1VQ4 V;  2DYR C;  2HLD G;  2LP7 A;  3ABL C;  3OAA G;  3I55 V;  1Q7Y W;  3CYO A;  1M56 C;  3SYA A;  4TSF G;  1V55 C;  4JF3 A;  5B3S C;  1K7D A;  1G4Y B;  1EFR G;  4PDR A;  4TT3 G;  5C93 A;  1YTF D;  2Q67 A;  3FKS G;  5H9C A;  1RPO A;  4WFG A;  1KKD A;  2DYR B;  3ABL B;  1VQ5 V;  2JJ2 G;  3E8B A;  4DO2 A;  1M56 B;  2P6J A;  1V55 B;  2HFE C;  4P9P A;  5B3S B;  4JYC A;  4HAM A;  3CC2 V;  3E8H A;  5L3B A;  3ZMV A;  5KA6 A;  1NH2 B;  3AG3 C;  3EHB B;  2QM7 A;  1S5H C;  2ZDI A;  3D36 A;  5H6Q A;  3SPI A;  2DWE C;  2JEU A;  3BEH A;  1VQN V;  4ZBM A;  3WG7 C;  3CC4 V;  1WLE A;  4U7O A;  4ASU G;  4DXW A;  1R3J C;  3RBZ A;  3R65 A;  2IU3 A;  3GB7 C;  3IFX A;  4PA6 A;  2QA4 V;  4MVO A;  3OE7 G;  1R3K C;  1Y66 A;  4BIU A;  5IYD O;  3CMA V;  3RVZ A;  1KP2 A;  2AHZ A;  2BOC C;  4QIW F;  4R6Z A;  3ABM C;  3WFV A;  4FPP A;  1QVG U;  5LHH A;  1ZWI C;  3K79 A;  4MTX A;  5L3D A;  3AG3 B;  5IYC O;  2JEX A;  4P30 A;  1H38 A;  2ITC C;  3E8G A;  4Q20 A;  2V7Q G;  1L1F A;  2OTJ V;  4MW3 A;  2OCC C;  3DGE A;  3T4Z A;  3SYO A;  3OMA B;  3OUF A;  2NLJ C;  4LCU C;  2XND G;  3T2M A;  3OEE G;  2F43 G;  1TUE B;  1YI2 V;  1KD1 W;  5DN6 G;  3OR6 C;  4UXN A;  4LBE C;  1EBO A;  4MVZ A;  1FXK C;  3ABM B;  4MTF A;  3CPW U;  2ZQM A;  3I56 V;  1MOF A;  4RUF A;  3E83 A;  5LGU A;  1COW G;  5H6R A;  1SER A;  1NVP B;  1K34 A;  3CCV V;  1JX9 A;  2DW4 A;  2Q69 A;  1QBZ A;  2OCC B;  3CCQ V;  3CME V;  3CCS V;  3CD6 V;  4XBF A;  3F7V C;  3QO7 A;  3CCR V;  2P90 A;  3HPL C;  3ZMU A;  2EIJ C;  2Q68 A;  5B1A C;  4F4L A;  2NNU A;  3K0G A;  1M9N A;  1FXK B;  3LNM B;  4EKW A;  3AG1 C;  4P9O A;  3UKM A;  1Y4M A;  4LP8 A;  3HB3 B;  2ZD9 A;  1RPR A;  2EIK C;  2HVJ C;  1W0K G;  2EBO A;  2X7R B;  3SYP A;  4N21 A;  3ZMS A;  2EIL C;  2XOK G;  2Z5U A;  4PA9 A;  5E1A C;  5B1N A;  3CXC U;  1VQ6 V;  2WLI A;  2GHY A;  1GM7 A;  1OCR C;  3KG2 A;  3ASO C;  2EIJ B;  5B1B C;  3E89 A;  1KP3 A;  5L3E A;  5B1A B;  3VOU A;  1DF5 A;  2ZR2 A;  3NXS A;  3ML0 A;  2WLI B;  3AG1 B;  1DLB A;  2ZR3 A;  4OXS A;  2WPD G;  2B1I A;  1ENV A;  3ZN0 A;  2EIK B;  4UVC A;  1E1Q G;  2Y69 B;  1DTO A;  1UJW B;  1KC8 W;  2EIL B;  4JAS A;  2PI4 A;  4G27 B;  4LC1 A;  1OCR B;  4JAV A;  3ASO B;  5LBQ A;  1BHB A;  2QTO A;  2IW5 A;  2C2A A;  2QE7 G;  5IY5 C;  1I5X A;  3LSQ A;  5B1B B;  5L3C A;  4ZKI A;  4PDL A;  3LDE A;  5EK0 A;  1R6K A;  3K06 A;  4MW8 A;  4WCE V;  4JTD B;  2IJH A;  3FYE B;  1S76 D;  3OMN B;  4MVS A;  1OCO C;  2QKS A;  1ORQ C;  3CCL V;  1H2G A;  3ABU A;  2IJK A;  1Q81 W;  2WLL A;  1AJP A;  1GM9 A;  3FB7 C;  3ZIA G;  4GX5 A;  3ZMT A;  2XAS A;  3OEH G;  3SYQ A;  5CBG A;  2XAF A;  5IY5 B;  1SRY A;  3UM7 A;  1JCH A;  1YJN V;  4N23 A;  1PD3 A;  1E79 G;  2WLL B;  3LDC A;  4HZ3 A;  3RVY A;  1AR1 B;  1YJ9 V;  5DM6 V;  2ZDI C;  4PDM A;  1PKX A;  2V1D A;  3D3I A;  1CP9 A;  1K5S A;  4QPK A;  1GKF A;  1OCO B;  4PA4 A;  3GWO A;  1PL0 A;  1NR1 A;  3ETG A;  2K1E A;  4JPR A;  2CK3 G;  5CBH A;  4XDL A;  3SPC A;  3P32 A;  1M90 W;  2EZP A;  3JYC A;  2OT5 A;  4H33 A;  4J9Y B;  4G2K A;  2IJI A;  5LHI A;  2WLM A;  3AG4 C;  4WFE A;  2A79 B;  2DWD C;  2FTK A;  3RW0 A;  3CCE V;  4JYB A;  4PA3 A;  2QEX V;  2YSU B;  1YHQ V;  1N8R W;  1YJW V;  2XAG A;  3ZRS A;  4L87 A;  3OGC C;  3SJQ C;  4MVR A;  1PNM A;  5HFM A;  1J95 A;  1K4C C;  2IH3 C;  2EJR A;  3B8N A;  1QVF U;  1DF4 A;  3ETD A;  1VQ7 V;  1NBM G;  4R7C A;  3K03 A;  3AG4 B;  3K08 A;  1PNL A;  3SYC A;  2BOB C;  4FJC C;  4BAY A;  3ABT A;  1S72 V;  1OHH G;  4MVU A;  4GCZ A;  2DYS C;  2ATK C;  2HG5 C;  5KUK A;  2YEV A;  4X88 A;  1AI6 A;  2XAQ A;  1OCZ C;  3SPJ A;  1YSC A;  4QE9 A;  2D3O W;  5GW7 A;  3TCU A;  2YEV B;  4CZZ A;  1NH2 D;  4FIP C;  4MTG A;  2KB1 A;  4KUM A;  4RO2 A;  3P30 A;  4JAU A;  3CCJ V;  4BIZ A;  4UVB A;  2DYS B;  4I5S A;  3AEI A;  1S77 D;  4QPJ A;  5CA3 A;  3SPH A;  2A9H A;  2DQ3 A;  1JPX A;  1OCZ B;  1F51 A;  4H37 A;  5J9P C;  4GX1 A;  1R6N A;  3X2Q C;  3IGA C;  5EBL C;  4MVM A;  2JDI G;  2IU0 A;  4Z1M G;  5BZB A;  2Y69 C;  1XL4 A;  4XDK A;  4QNH B;  2P7T C;  1V54 C;  1YIJ V;  1AI5 A;  4E2L A;  3JD3 A;  1K8A W;  4X89 A;  1P7B A;  2MK3 A;  3F7Y C;  1AI4 A;  1ARO P;  3M99 B;  1FXH A;  3DCX A;  3VBB A;  1VQL V;  5FL7 G;  2QM8 A;  3ZRW A;  4FMT A;  4X8A A;  3ZRV A;  5KA5 A;  1K4D C;  2B5U A;  2X6B A;  1H8E G;  1K5Q A;  2EIM C;  3E8F A;  3X2Q B;  3AG2 C;  5KUM A;  1CPY A;  2LFR A;  1NVP D;  3DTU B;  1HWY A;  1K92 A;  1V54 B;  1YTF B;  1XL6 A;  2WLK A;  2UXX A;  3MHH C;  1OZ0 A;  4GX2 A;  3W7S A;  3K9A A;  3G6E V;  1W2B U;  3FYI B;  1K73 W;  1M1K W;  1QR8 A;  3K3W A;  2WAM A;  3QNE A;  3HSA A;  2W6J G;  4QE7 A;  4JTC B;  4PA7 A;  5HFL A;  2R9R B;  4J9Z B;  4UVA A;  3LDD A;  4MVQ A;  2IH1 C;  2EIM B;  3FB6 C;  5LGT A;  1MSW D;  1RM1 C;  3AG2 B;  5LHG A;  4UV9 A;  2UXN A;  4FK5 C;  4WFH A;  4QJF B;  2B1G A;  2WLJ A;  2XAJ A;  5EBW C;  2H8P C;  1R3L C;  1E1R G;  3E35 A;  3CP1 A;  4R50 A;  3IC7 A;  4U7N A;  4MSW C;  3JD4 A;  1Q86 W;  1R73 A;  5CN0 A;  1GMG A;  1VQ8 V;  5L3F A;  3CC7 V;  1BHA A;  2HVK C;  1RM1 B;  2WLH A;  2X6A A;  1KQS U;  2ZXW C;  1VQP V;  4RUE A;  2R9I A;  1GM8 A;  4JGS A;  3W7W A;  4HYO A;  2AHY A;  3QO8 A;  3FB5 C;  2GSM B;  5B1O A;  3ZMZ A;  3TET A;  2P67 A;  3LSS A;  1VQO V;  4MTO A;  1K33 A;  2LFS A;  3ETE A;  1F23 A;  3OUS A;  3A0R A;  3MHS C;  5EBM C;  1GO3 F;  4XDJ A;  3CCU V;  3K04 A;  4KP4 A;  2ZXW B;  1OCC C;  2PI5 A;  1M57 C;  4R8C A;  1P4R A;  3EFF K;  4UUJ C;  4WFB V;  1GTO A;  1PNK A;  3MD0 A;  5IYB O;  3ZCC A;  3ABK C;  4YXW G;  1K3E A;  1FS0 G;  1LNQ A;  2WSS G;  3OMI B;  4RAI A;  3TK1 A;  1NKD A;  4JTA B;  3ZN1 A;  1NQT A;  4KFM A;  4MS2 A;  2OTL V;  5L3G A;  4TWK A;  3BY6 A;  1QLN A;  2Y48 A;  1KEC A;  1GK9 A;  3OR7 C;  3W7U A;  1OCC B;  1SES A;  1M57 B;  3LUT B;  2W0F C;  2IJJ A;  1FXV A;  1CEZ A;  4P2Z A;  3JCZ A;  5LGN A;  2WLN A;  3PJS K;  3ABK B;  3T1C A;  3B8M A;  3W7X A;  1NJI W;  3WG7 B;  2HJF C;  2EIN C;  5IDJ A;  3SPG A;  1Q82 W;  1AJN A;  1EZJ A;  1ROP A;  3OW2 U;  1JOY A;  3F5W C;  1AJQ A;  4WFA V;  3E86 A;  2ITD C;  2WWW A;  1K97 A;  1BL8 A;  2HR3 A;  5CBF A;  2Z3Y A;  1BMF G;  1IXM A;  1F4N A;  4GX0 A;  2XAH A;  4BW5 A;  4CBC A;  1H8H G;  4RQE A;  1W0J G;  1VQ9 V;  1SZT A;  3ZRX A;  1THZ A;  3OFN G;  2EIN B;  3E2E A;  1FXK A;  2HKO A;  1K9M W;  3B77 A;  1QCE A;  1S3J A;  4PDV A;  2A0L A;  2JK5 C;  4RQF A;  3STZ C;  5EC2 C;  3T4D A;  3ASN C;  3G4S V;  1NR7 A;  3JD2 A;  2JJ1 G;  4WF9 V;  1FFT B;  4PEL A;  1VQM V;  3K0D A;  1MAB G;  3ZJZ A;  1S0V A;  1QLE C;  1JQ0 A;  1SET A;  3ZRW B;  4I9W A;  1JJ2 U;  2DQ0 A;  4GT1 A;  4G28 B;  3STL C;  2H94 A;  5CMU A;  3ASN B;  1F4M A;  4MT8 A;  2EZO A;  5EC1 C;  3H01 A;  1YIT V;  3QO5 A;  1B6Q A;  3G71 V;  1VQK V;  1QR9 A;  2X6C A;  2JIZ G;  1JVM A;  3FB8 C;  1G8M A;  1AI7 A;  2X0L A;  3CCM V;  1MG1 A;  1QLE B;  3JD0 A;  1I5Y A;  3W7T A;  3OM3 B;  4WFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...