3B77A

Crystal structure of a ph domain containing bacterial protein (exig_2160) from exiguobacterium sibiricum 255-15 at 2.42 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
188
Chain Sequence
DIGQVIHPDDFDKAAADDYVLHEDGEKIYFLIKSKTDEYCFTNLALVHLDGESASKRVLYRYPYAHYPIRHVMFETAGTVDLDVEIKFEIGGKHYSIDVDKKQLEHVKDLYKALLAIAEKQYEGQKMLEFANSSLNHSVTILGGLRQGDMNVPQTFKDLSQESFDWLQGHYYKWNQKDFGSFYEKYIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacterial pleckstrin homology domains: a prokaryotic origin for the PH domain.
pubmed doi rcsb
source organism Exiguobacterium sibiricum
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 56
structure length 188
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11724 YvbH_ext YvbH-like oligomerisation region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3b77A02
2.30.29.50 Mainly Beta Roll PH-domain like Bacterial Pleckstrin homology domain 3b77A01
1F23A 1SZTA 4FIPC 4G2KA 3HSAA 1Y4MA 1K33A 1K34A 1QR8A 4JGSA 3WFVA 3CP1A 5HFLA 4E2LA 3H01A 5KA5A 1QCEA 4JF3A 4N21A 2LP7A 2MK3A 2X7RB 3B8MA 1I5XA 1MOFA 1JPXA 2M7WA 3M99B 4JPRA 3MHHC 3B8NA 4FJCC 2EZPA 5CN0A 1DF4A 3CYOA 3B77A 5HFMA 1Y66A 1DF5A 2P6JA 3P30A 5KA6A 5CMUA 4FK5C 1DLBA 2EBOA 3GWOA 1JQ0A 1EBOA 2OT5A 4N23A 5H9CA 3K9AA 1QBZA 3DCXA 1QR9A 3MHSC 1MG1A 1I5YA 1ENVA 2EZOA
chains in the Genus database with same CATH superfamily
4UCSA 4A5KA 4EFEA 2R72A 2LW7A 4WFAV 4DR7O 4WSFA 2HHHB 2V1DA 3OGIB 1WPBA 5IE9A 2W0XA 4CS3A 4ZI7A 5EZYA 4X1YB 3JD3A 3WG7C 2EBOA 3VQWA 1NQTA 2LW1A 4F4LA 1YTFB 4AILC 3JD2A 5EYPA 2C2AA 4XBFA 4OX9B 4LF7B 4HDOA 1ZC4B 2B1IA 3EHBB 1H2GA 4Q6GA 3SPJA 2ILMA 1OCCB 4PA4A 1AR5A 3QNEA 3CHXA 1RP3B 1UPQA 2YI8A 4R6ZA 3ML4A 2ZR2A 2Z0PA 4DXAB 2QKSA 2BTQB 1MA1A 1N8RW 2IBZH 3ZIAG 3ZX6A 4LF8O 2V7QG 4DV1O 4HB4B 4WJ7A 3SPHA 1VQLV 2X6AA 4E2LA 2ZNIA 1B3QA 3L72H 4OPHA 1BMFG 4YXWG 2GUZB 2DQ0A 1CP9A 2RVBB 3LDEA 2LO1A 4G28B 1VQ5V 3RYIB 5C79A 4EB6B 5JH7A 2OCCB 2IJHA 3CX5F 4DV2B 4IL6Z 3UKMA 4Z1MG 1KKCA 2Q73A 3ABKB 1BCCH 2QGNA 2RDCA 4R7CA 2GUMA 1EAZA 1I7FA 2DTCA 3CRRA 1HR0O 1K92A 2YT0A 5EYPB 3VQXA 4FJCC 2UXCO 2UXCB 1V5MA 2P7TC 2PUSA 3HKDA 5EBLC 2W6IG 3GWOA 4H0LB 1N33O 2CRFA 3ZHVA 1S72V 4YJ3B 1IBKB 3JCUZ 4DV1B 3D3QA 5EK0A 2Q4PA 3JASA 3OEHG 2AGAA 2F93B 1WI1A 3OUSA 4LWSB 4TUYA 4JI8B 3A98B 3ZN1A 5CA3A 5CLLB 2Q0AA 4W4LA 1WJZA 4LFAO 1GN2A 3N2GA 1SGHA 2EINB 1VQ8V 4UV8A 1TVKA 5KAIZ 2Y48A 4RUEA 2A0LA 1G1XB 3KSYA 2NZ8B 2PY5A 4K0KB 5IT9N 2CTWA 3ZEDA 3RYHB 1RJ2A 2QKAA 2RRFA 3FB7C 2ZIMA 2LG1A 3QG5A 3UZTA 4GCZA 4CYEA 2X7RB 4TYZA 2YIAA 1OCRB 4PJ0Z 5EBWC 5C93A 3PZDA 4J7ZA 5IJ9B 2QTOA 1NI8A 4LFCO 3F7VC 1V55C 2P4VA 4X1KA 2Q7HA 4YL8A 4PI2A 1DDWA 3CIKA 5FL7G 3F5TA 4IIJB 1ZLZA 1VQ7V 3E22A 5KA5A 1SHCA 4JV5O 2ZIOA 3N27A 1X59A 1LUVA 3ABLC 2V4DA 4X8AA 1WB7A 5ITZB 2N23A 4KHBB 3L71H 2F4VB 3LNMB 4KXRA 1NI2A 1P5TA 2YI9A 3ABMB 2ZNJA 2UXXA 2ZDIA 3M7MX 2Q6AA 3STZC 3OEEG 2VQFB 2CH7B 4CBCA 4IYIA 4DV5O 4HSIA 3NR7A 2MWNB 5LOVB 5GONA 3KKYA 3HKCA 4O2BA 1FAOA 2QE7G 2GCLA 4F7HA 3FB8C 3CCEV 2E74B 2KG7B 4NTXA 1G8MA 3TCAA 4H33A 4A6FA 3IFXA 3JSLA 1K5DB 4WBNA 4G27B 4ZIBA 1XBLA 1K9MW 2Q5ZA 1KB9F 1JCHA 3BFRA 4BIOA 2QWPB 1OCRC 1YHQV 4FFBA 3IC9A 3G6EV 1SZTA 1F4MA 4WFFA 4B7EA 4DR4O 1BQZA 2Q7GA 4YY3O 5D3WA 4B6HA 3SPIA 4A6HA 4O4IA 2YT2A 2X18A 1BSMA 5HE3A 1P4RA 1AQCA 4OT1A 1MI1A 4MTFA 1NH2B 5C8YA 2Z59A 3SJAC 1MNGA 5JP4A 4D7TA 4CH3A 5C5BB 3H1IH 3HKDB 2M6YA 3AK1A 3O96A 4C7UA 5J2UB 5HE1A 4ABMA 4CH6A 2CY4A 4AI8A 2P4KA 4N21A 3ZHQA 1SQBH 5IRSA 3BA8A 1M56B 1W1HA 2FJLA 4DRXB 4JAVA 5KX5A 3QTCA 3S3XA 4J7JA 1H38A 5DI9B 1XL4A 5JH7B 2OWOA 4QGPA 2HVJC 2PF4E 3FAVA 4Q20A 1MSDA 2E2XA 1FAFA 4JF3A 1HNXB 4J41A 1MIZB 3SYPA 4GX0A 3ZRWA 4L6EA 2JEUA 1Q6IA 4Z1VA 3G9WA 1KECA 1TAEA 3P3NA 2WAMA 1GC7A 2JS5A 2KIGA 2D9VA 3STLC 4DR5B 4B3RB 3E8HA 5CB4A 1Y74B 2DKQA 3HR0A 4X66O 2IJJA 4DO2A 3JAKB 1I2HA 1VF5B 1WNSA 3NWAA 2GJYA 5KQ1A 2LOZA 2Z13A 2YXHA 1FKAO 5CBHA 3SGIA 4J9ZB 4O2BB 1LUWA 2HR3A 2QM7A 5DH9B 1AI5A 4X20A 5GONB 1F4NA 1ZAUA 3W7UA 4GOUA 4JI7O 3TETA 4IT5A 5C16A 2IH3C 3JAWA 2AXTZ 2EMSA 3K08A 2EX3A 3F7YC 2FL4A 3ABTA 1DROA 1BTKA 1TXDA 3CXBB 3ZRSA 3SYOA 1QLEB 5D3XA 4HAXB 3QO5A 3KG2A 1X11A 1VF6A 2BOCC 1AI4A 1W2BU 1FGYA 1J19A 2Q0OC 3RYHA 2Z5UA 5KQ4A 5JLJB 3BABA 4CHJA 3UQ8A 1IBMO 4PDVA 3ETDA 4HDQA 1GTOA 3D8CA 3KCYA 1Y5OA 4TQFA 3PJSK 1SS3A 3G67A 1P84F 2QWRB 1OV9A 3B8NA 3T4ZA 4JI2O 2D11A 1XR0B 4JI5B 2COAA 4U7OA 1H8HG 5CA0B 4IFSA 4F7GA 3JD1A 1FXKA 4J7KA 1EBOA 3T1CA 3FVCA 1VP7A 4NYKA 5B5EZ 1G4YB 5KHGA 2WLIA 2AHZA 4X64O 1EN6A 4K8ZA 1YF2A 1GK9A 1SA0B 3H1HH 1YDXA 3AG4B 3CRQA 1XDCA 2EILC 1IBLO 2AL6A 3CRMA 5C5BA 4I50B 5LGNA 3PP2A 3BPZA 1I7AA 4B3SO 3ZJZA 3PVUA 3A0HZ 4QJ4B 3ULCA 5CA1B 3DXEA 1CXZB 4UVCA 1QC6A 1QVFU 2KG7A 4JAAA 2YIBA 5LP6B 5DN6G 1RSOA 4MT8A 1IXBA 4MVZA 4LFBO 5EIBC 1L1FA 1W59A 4NXMO 4X62B 3K04A 2D9YA 2PI5A 1OCCC 3KZ1A 2QSAA 1DDMA 3FYEB 4H8SA 3RGBA 1N0NA 1SF9A 2ZE7A 1Q82W 3CWBH 1FJGO 1I94O 1VQNV 1ZUQA 1WGQA 5KCVA 1KUQA 4TKNA 4WF9V 5M4YB 4P30A 4O4IB 4ASUG 4G2KA 3LJUX 4I9QA 1U27A 2D2CB 4EKUA 4IHJA 3LSUA 2XAQA 4HBNA 2XOKG 2ADPA 2PYLA 5LMUB 1KI1B 2MK3A 5EC2C 5KLVH 4K81A 5D5PA 1S5JA 4LF9O 3TXSA 3OR7C 2DHJA 2JRIA 3B77A 2QKCA 3E86A 4UCVA 2DLWA 4HAUB 1XHZA 3E22B 3SPCA 2ARHA 3D8EA 3SNHA 4DBBA 1M57B 3E8FA 2N05A 2JGUA 5ITZA 4KHBA 4DR1O 4U3JB 3T1HB 2GTSA 3Q4HB 3R65A 2Z4DA 2FYUH 5LMNB 3TW1A 3ETEA 1OCZC 4RQFA 2FKXA 4IOYX 3CXCU 4QPKA 3WU2Z 3R66A 2GDSA 4GMXB 3TCUA 1BHBA 1NTVA 3UT5A 1H4RA 2R9RB 3K5OA 1EN4A 2P6JA 1XEQA 2L1CA 3CEIA 1OCZB 2CDYA 2LOXA 5KHHA 4JI1O 1VARA 5LP6C 3N7CA 2ZKMX 2I5FA 2KR0A 5B1NA 4DR6B 4MVOA 1PL4A 2OTJV 2H94A 2OIGA 3LNNA 1KZGA 3EXAA 4HB3B 3ODWA 1R3IC 4WVFB 3K59A 1OY2A 3WYFB 3JAMN 3P7ZA 2L6LA 4D6TH 3DSQA 1RM1C 5J3TA 1ROPA 1VEWA 1U5FA 4MK0A 5FPOA 2AZ2A 1VQMV 4X20B 3ZBHA 4RWUA 3ETGA 1RFYA 1DF5A 4BIZA 2PZ1A 2F1MA 2UVMA 3E89A 3FFQA 3JAKA 2F43G 4QJ5B 1W1DA 4U7NA 3ZCCA 1MAIA 1PFJA 4K2OA 1KQSU 3SO6A 4Z2NA 4TV9B 3CE2A 1Y67A 4B7KA 1SERA 3HKBB 2N74A 1JOYA 1WN7A 3AG2B 4B08A 2VRWB 4B3MB 1QLEC 1B04A 2KGXB 4LF5B 4JASA 1V54B 2DJVA 5IJ0B 4P7IA 3ASNB 4MTOA 2KUPA 3K9AA 3G6BA 4BW5A 4LNUB 1LR1A 3JSNA 4GMVA 3H01A 1F51A 4KL1A 1X1GA 3D3IA 1N36B 4K2PA 3RVZA 3F0WA 5KHJA 3H1JH 5J3YA 4JYAO 1XNRB 5GOWB 5KA6A 4DW1A 5D27A 3RYFA 1U5DA 3HKEB 3ZMUA 2HHHO 3ULBA 1HW7A 3B40A 4CC6A 3PVLA 2YEVA 3K3WA 4LH7A 4GN1A 4NR1A 1EFRG 4I4TA 1H2KA 1OJHA 4DV3B 2PYJA 1HP8A 2JS3A 3T06A 2P90A 1BGYH 3CMEV 1NH2D 1GKFA 5KUMA 5C8YB 1M56C 5H2FZ 3ZMTA 3JALB 4X1IB 1Q43A 2X6CA 1SA0A 4EMOA 1R3KC 3K57A 2NBVA 1PPJH 4A6KA 3DXRB 1VIBA 2CUGA 4UCUA 4UVAA 3CCRV 5KAFZ 4CSQA 4DV0B 1OZ0A 4B3SB 4LFAB 3VOUA 5B1BC 1KP2A 1W0KG 3CP1A 1P6SA 1V54C 1I94B 4GKJB 4OXSA 5JQGA 1NS1A 1GM9A 4ZKIA 1FHWA 4FZ1A 4H13B 4P2ZA 1XMQB 4FPPA 2QWQB 4DR2B 3CCSV 4GLXA 2Z0OA 1OHHG 3C3SA 5EZYB 4LF9B 2Q69A 2EIMB 5JHGA 2HJFC 3RYFB 3NXSA 3DXRA 1WP8A 5B66Z 5L3CA 2QWOB 5LYJB 4RQEA 2Z3YA 2DMXA 2N0YA 2IW5A 4WFEA 2PTMA 4HATB 3BHPA 2XAJA 3AJ4A 3JARA 4JZ2A 2BCJA 2JEXA 4FLWA 2LKOA 5BY1A 2OT5A 3CJHA 3DGEA 2M14A 4P9PA 4DV0O 1XUQA 5D5QA 2VWKA 4JI0O 3U11A 1Z5VA 3G80A 4JGSA 4NXNO 4PV1B 1R73A 2BCCH 4PELA 3I56V 3OMIB 1DGSA 5LA6A 4TWKA 3TVVA 4UUJC 1Z87A 1DF4A 2COFA 5LHHA 2UUCB 5CMUA 2RCVA 4UCRA 4LF4O 3A8QA 1K3EA 1ENVA 1SC5B 2R0DA 1BE3H 4O4HA 1QCEA 1TVKB 3J80N 1JFFA 2EIJB 1NVPB 3AU5A 1PNKA 2WPDG 3WB1A 3KRWA 5KMGB 5LP6A 1WA8A 2D3OW 5KHKA 2YXLA 4UB6Z 3HQCA 5AG2A 3H1KH 1AP6A 1AP5A 4EFBA 1YXBA 2GV9A 1JMKC 2DQ3A 1SQVH 4EB6A 4YHHO 5DECA 3ASNC 4ZBMA 1NTZH 3K5NA 5GW7A 1VQ6V 4X89A 4CC5A 2HVKC 1RPOA 1TJ6A 3ZMSA 5CLQB 4YIOA 2DA0A 2UUBO 3QWMA 1S0VA 5D3YA 2VKIA 1DLBA 1N33B 3JATA 3CXHF 4LF4B 3VOQA 1WA8B 1IBKO 4GX5A 5D3VA 4ZI7B 5IWAB 3GYOA 5IYCO 2XHBA 4FZ0A 2Q8VA 1K7DA 3GVMA 4X88A 3TXQA 3T1HO 3BRCA 3IGAC 3UT5B 4DR3B 2D9ZA 2PZSA 3W7TA 1COWG 2D2QA 4L87A 1YSCA 1DTOA 2KIEA 3A0BZ 2COCA 4PA3A 4PA9A 2YC0A 1GN4A 1XQ8A 3K5MA 3HB3B 4K8XA 1N3HA 5CB4B 3D8DA 2MKRA 2VRZA 3IC7A 2EC1A 1EZVH 5IYZA 1ZM0A 4JI5O 1EM1A 4DV6B 3AG7A 2QTSA 2EZOA 4JI6B 2UZSA 3D36C 1FXVA 3SJBC 3KY9A 1UFIA 4HAZB 3NSUA 2P0HA 3GWKC 2YS8A 2WSSG 5CBGA 4J9YB 1M7RA 4DUYO 4TV8A 4JTAB 1V61A 4GXBA 2NN4A 3QO8A 2ZE8A 2QM4A 2X0LA 2ZE5A 4LR3A 4U3FH 3LDDA 1IBLB 3W7XA 4DUZO 2AW9A 4I55A 3HPLC 2W2WA 3VIAA 5IWAO 1AROP 4D7SA 3D36A 3MD0A 4PI0A 2RGNB 4BWAA 2PGGA 1WAZA 3APQA 1K5GB 1GC6A 3D8FA 2VSZA 5IY5C 5B1AB 2DHKA 1R6NA 2A06H 4FM1A 2RQ6A 2D9WA 3X2QB 4X66B 4O4HB 4UFZA 1BT8A 4K0KO 3WB0A 3ZRWB 2KSDA 3KCXA 4JI6O 3RVYA 2D10A 5JCOC 4LF8B 4PA7A 1X05A 2J0JA 2P67A 2ATKC 2N04A 2ZDIC 4O2AB 3X23A 4JTCB 3BY6A 2DFKA 1SQQH 2ELAA 5L81A 1HNWB 3Q4HA 2ADZA 2O57A 3K0GA 2RUKB 3E8GA 3ZS8C 3S3WA 1MSWD 2DWEC 4LWSA 4B3TB 1R3LC 4FLYA 3NW8A 1FXHA 5LOPB 4DV6O 5CA0A 5L3EA 4LF6B 2XNDG 4DR4B 1J0WA 2JGDB 4X65O 1NBMG 1K4DC 5CBFA 2Q7EA 2MDXA 1M90W 5L3BA 1FB8A 4YJ2B 3T1YO 2Y8FA 4FLUA 2R70A 3OANA 4FFBB 3FEHA 4QNHB 1E79G 2RJZA 4PDRA 2KKWA 4PA6A 1K4CC 1QR9A 2Y4UA 1N0JA 2ZXWB 3K58A 3OMAB 1VF6C 2WLHA 1W0JG 4L1RA 3MAQA 5LXTB 2UUAO 1SZXA 4MVMA 1EVHA 2DYNA 4KUMA 2HG5C 5HE2A 4WFHA 3WB2A 3BVOA 3SYAA 2NNUA 1XMOB 1Q86W 4QXAB 1NU2A 1D5AA 4TT3G 4F6RA 4NXMB 5EFXA 5L3DA 5H6QA 1H8EG 3APOA 3P3PA 4DV7O 3UM7A 2H3OA 1Y4MA 2GHYA 1RRPB 3BAAA 3K9SA 1MIXA 3ICXA 1XL6A 2LYDA 1FXKB 5IJ0A 4DRXA 4TV9A 4EKWA 2P8VA 1ZX3A 2Y69C 3FD9A 3SUZA 4L8JA 2EZPA 1UNRA 3G71V 1GN3A 2LQTA 5JWPA 2QWNB 1VQ4V 3QO7A 3FB6C 1JFFB 1RM1B 2XASA 2UU9B 2ODMA 1YEWA 1ZVRA 1QBZA 1XILA 4R8CA 4I5SA 1YTFD 4IGGA 4EJNA 2YIDA 2OQBA 4HAVB 2DE0X 4YY3B 3HKEA 4NTWA 4O4LA 3ZMVA 1MOFA 1EF1A 4DR1B 1Q6HA 1MZFA 1FHXA 1LW3A 4MY6A 3RYCB 1IXMA 5LXTA 2ZPYA 4UVBA 2W2XD 1O9HA 4MS2A 5LYJA 1MG1A 3O65A 4O2AA 2J0MA 4DIXA 4ZHQB 2I5CA 4K35A 2BTOA 4MT7A 1Q81W 4JI0B 3MPXA 1O9GA 3VQVA 1YJWV 3UO3A 2E5LO 2IJIA 4UCTA 4DV4B 1Q90D 5DHFB 3ODXA 2JDIG 3OFNG 3AU4A 2IJKA 3RCPA 4GZUA 1JPXA 1HWYA 3GB7C 5H5NA 1SRYA 1N34B 2DHIA 2GCJA 2F23A 4GZRB 4FLTA 3U8ZA 2UXBB 2UXBO 2DYQA 1Z2GA 2CE4A 1URFA 4HAWB 1S77D 1AJNA 2ADQB 1FYJA 2E75B 1AVMA 5J9PC 2HLDG 3A0RA 3I5DA 3L75H 3VQYA 2H7DA 5DEDA 4J80A 1P3RA 1QNMA 4DK1A 4YIPA 2WLMA 1QQGA 1GM8A 2ZT9B 3ZHTA 2E76B 2FB5A 5K1PA 3CC4V 2H7EA 1HNXO 1M93A 1DBHA 5JJJB 2QKMA 5IYDO 3U10A 3FKSG 3HKCB 2QA4V 1QU7A 1Y74A 3L73H 4DV2O 5LOVA 2CTQA 4H37A 1ZSPA 2WLKA 3L9DA 4HAYB 1WP7A 4IYHA 2WA4A 1KZ7A 1BZKA 3THOA 4B3RO 3CPWU 4H44B 1NR1A 2FMLA 3HSAA 1NT2B 3OD4A 4MTXA 2ZXWC 1XNRO 4WBNB 1WJMA 4GPTB 4MVUA 4R50A 5FPRA 3N2GB 4I0XB 5JHHA 2ETNA 1T5EA 4QE7A 1BWNA 2ZE6A 1YITV 3CYOA 1OCOB 2J59M 1YJNV 5LHGA 1GMGA 3QVNA 3J81N 3HIEA 3BINA 2W0FC 2YRYA 3CC7V 3JCZA 3A8TA 3CB2A 3EFFK 2XQNM 4Z2MB 4LF5O 3P6AA 5GTHZ 4OX9O 2LJ2A 3A2FA 2K49A 4DV4O 3OT7A 4BIUA 2GS0A 2BSKA 3B2EE 4QJFB 1VMGA 1YZBA 2A3QA 1US6A 2VWJA 4XDLA 3OHMB 3OE7G 2ZR3A 3E35A 4F6EA 2P0DA 4WFBV 5J2UA 1XNQB 1XNQO 3FAVB 3W7WA 4GUNA 3ABUA 1IZ3A 2K8EA 3FX7A 2IFSA 3ZHSA 4X64B 4GKKB 3W7SA 1AR1B 3ODOA 3HK0A 3AG3C 5KMGA 1K8AW 3FM8C 2AHYA 4QPJA 4J42A 5KX5B 4UCOA 2CGOA 2OTXA 2EJ7A 2KQXA 2M7WA 1U96A 2JP2A 1V5PA 4I4TB 4B3TO 3ZVRA 3U12A 3GYPA 5LHIA 1DYNA 3M1IB 3M8AA 4PDMA 1AILA 5C6RA 1P7BA 4HB0B 3WG7B 1GH6A 4X1IA 4EEQA 1KC8W 2ELBA 3ABKC 4DK0A 2YIBD 3RYCA 5IDJA 3PEGA 3T1YB 1UEFA 2XUMA 2HEPA 2K2JA 3DTUB 4RUFA 2A79B 4BAYA 4BW9A 1EGXA 2W2XC 1Q6UA 2KCJA 2WA3A 4BBKA 3MHHC 1MMMA 5J2TB 4BR6A 3E8BA 1H2LA 4GKJO 5H9CA 1H2SB 5JQGB 4JYAB 1J5EB 1V88A 3KRXA 4B3MO 2QM8A 1AI7A 2EMTA 1TUEB 1PMSA 1RPRA 2K1EA 3RWRD 2OIEA 1H2NA 2UUCO 1M7EA 4FM0A 2A7WA 2CAZC 3LSSA 5A9GA 1K5SA 1L0NH 2ZINA 2Y4TA 4ZOLA 4LNUA 3B8MA 3TK1A 1XKEA 4Z2WA 4MVSA 2EIJC 1ZYIA 1N32O 1EZJA 4HB2B 1UNQA 3B09A 2FJUB 2WLNA 1WPXA 4ICGA 1XD4A 3NWDA 1B6QA 4FIPC 4O4JA 4YJ2A 4JTDB 1HNZO 3AG3B 2EINC 4DXWA 3TO1A 4HZ3A 4X1YA 1PV0A 1N4CA 5IYBO 1OQNA 2W6JG 1K73W 2YEVB 4X9QA 1XMQO 1I5XA 5BR8B 3LSQA 4XDJA 3QF7A 2HP8A 1EN5A 1SESA 1V5UA 2Q9LA 1X1FA 2R2YA 3MHSC 3MDBC 1S5LZ 1NJIW 1F23A 2Y0IA 3OM3B 4KHAA 2WLJA 2G35A 3SYQA 1W1GA 3KZIZ 1K97A 3RBZA 5CN0A 2AEHA 3OMNB 4FMTA 1F7YA 4ZRIA 4ZHQA 3OUFA 2MFQA 1LNQA 1NVPD 1PD3A 2XAHA 1XOUA 4NXNB 1AWEA 2CK3G 5BXZA 4TUYB 2KUQA 1PLSA 1Q3EA 2XTAA 3SR2C 1PNMA 3WFVA 1IURA 5HFLA 1R3JC 1RSOB 2JK5C 3BA9A 3CD6V 4O4JB 4FLZA 5FNVB 1K5QA 4LFCB 4GYCB 2RMKB 2QDOA 5K1XA 5LL6Y 1M9NA 1JR9A 1TGOA 2R9IA 4KAXB 2UUBB 3ML0A 2DYSB 1Y76A 3T2MA 3QIJA 4QIWF 4JV5B 3PN1A 4JYYA 3CC2V 3ABLB 3G4SV 5L3GA 4JPRA 1Q8IA 3TGUH 3F5WC 2Z0AA 3X2QC 4RAIA 1KKDA 1FFXA 1NTKH 2BSKB 3ABMC 4ZOLB 5FNVA 5FLXN 1HR0B 1MPHA 5FI0A 2GBOA 1V55B 3ZHUA 1MZEA 5DHAB 4JZGA 2EULA 2Z0QA 3O9OA 5B3SB 3K5LA 2LULA 5KHIA 4JYBA 2ZKOA 4XWXA 1KP3A 2WLIB 3UO2A 1PM9A 4LF6O 1V89A 2OCHA 2IU0A 3ASOC 1BS3A 4X65B 4I9WA 4CH5A 2DYRC 3BCCH 4TQDA 4NY0A 3K03A 4LBEC 1WVHA 1YI2V 1FS0G 1MABG 5LG4B 2XT9A 1FGZA 5CA1A 3N2KB 1GG3A 2CY5A 4JI8O 3CRAA 3VBBA 3JD0A 2BTQA 2BOBC 2R09A 3JD4A 4WCEV 1N36O 1ZL8B 2P22C 5DM6V 2UZRA 5I2SA 1XODA 4CHMA 3T4DA 4OPAA 3SJQC 1AB3A 1TQZA 4DYLA 1FXKC 1SQGA 2B9ZA 4N23A 2B5UA 1WJ1A 4QJ3B 2QR4A 2P0FA 5L3FA 2YSUB 1YVWA 2MW2B 2YSZA 1XCGA 1PL0A 1V9PA 1AJQA 4HNAB 2BE3A 1NZ6A 1KBHA 3U7DA 1JVMA 1YJ9V 1X86A 1Y19B 3SJCC 2Y7BA 4NB5A 5HFMA 3SYXA 1T77A 5BZBA 4CZZA 1XHXA 4DR2O 3RN4A 2F66C 1FFTB 1P7GA 4FFKA 1ZC3B 2EJRA 4MW8A 4LFBB 2YXYA 2LFRA 4LCUC 3CRCA 3L70H 4JI3B 3NWFA 1UPGA 5IY5B 1KMIZ 5BMVB 1Q5OA 1M1KW 1E1RG 4QE9A 4FLXA 1WGUA 4NSWA 3PVWA 2Y8GA 2D9XA 4DV5B 2RNBA 1L8DA 1A32A 1I08A 2DYSC 1Z5WA 4MW3A 1GN6A 2P06A 3DC6A 1M4UA 1AI6A 3FB5C 1DK1A 4I50A 3CS5A 4DX90 3H9VA 2RN9A 4ZRKA 3IAYA 3SYCA 4KFMA 3OAAG 2EJ8A 3BJIA 4OSNA 1NR7A 1IRSA 3AK3A 5F2VO 2Q67A 1VF7A 5TISZ 4TOIA 1XX0A 3ZHRA 4E4EA 2G38A 4RO2A 1JQ0A 1P49A 1B55A 3CCLV 2ROZB 1QHTA 3HW2B 4PD4F 4MSWC 4PDLA 5J3QA 3J7AU 4A5UB 2DX5A 2F4VO 3OGCC 3JARB 1TUBA 3E83A 4F6RB 5J2TA 2JJ1G 2UXDO 1K34A 1VQ9V 1FHOA 5IYZB 2E3CA 1KD1W 2LP7A 4FVMA 3EVKA 3RT3C 1MKEA 3M99B 3AG1B 1QQCA 1BTNA 4FM2A 4YONA 1BHAA 2JVDA 2VQEO 1BL8A 3ZN0A 2RLOA 4GNKB 1FD9A 3AG1C 4UB8Z 1ZL8A 5EBMC 3JALA 2YVCA 1K33A 1N34O 4I55B 2YF0A 5LMUO 2HTHB 4PNKA 1JX9A 3DXCA 1R6TA 2CH7A 4K17A 2I1KA 2YT1A 1D2DA 3ZMZA 2RNRB 4IHJB 4HAMA 5E79Z 2JGDA 3I55V 1ORQC 4HHVA 3TFMA 4MTGA 2M38A 3A58A 1R6KA 1YIJV 2RSGA 3IJ4A 4DW0A 4A6FB 5JJEB 2DYRB 1PP9H 4Y94A 3B4SA 4DR3O 4LF7O 3K06A 4KP4A 4YHHB 4GX2A 1FOEA 2CODA 2Q13A 1SQXH 4TSFG 1L0LH 1MK7B 2VQFO 1S3JA 1H2MA 4GT1A 5HE0A 2EILB 1TUBB 4JYCA 1YCIA 1Y66A 1PNLA 3AG4C 2XAGA 2EIKC 5E1AC 1VQPV 3JYCA 3H1LH 3SPGA 1B06A 2Y69B 4AQYB 1KU9A 1AJPA 3RW0A 2ITCC 4KHPO 3CCVV 2QJ1A 3C3TA 3JATB 5LMNO 4X1KB 4DR5O 1QVGU 1IBMB 5JVDB 1SKVA 1S76D 2A9HA 3L74H 3JAWB 1NTMH 4DX8A 4OGQB 5LA6B 2QKLA 2E5LB 2X6BA 1JA8A 1GO3F 4JI4O 4JI4B 2WLLA 3LDCA 4JI1B 3SDLA 3OTOO 3OTOB 2IM9A 2CAYA 1PKXA 4UV9A 2J0KA 5LGTA 2UU9O 2Z14A 4JI7B 3BEHA 1UPRA 3CCJV 2CTPA 4DUYB 3ZRXA 4HYOA 2ZD9A 1M5IA 5B1AC 1D5NA 2UXNA 2ZCEA 2DN6A 3N2KA 4P9OA 3V5WA 1BQ0A 1UJWB 2D4QA 4LP8A 1UNPA 4TV8B 2GSMB 2CTRA 2Y0PA 3DCXA 4AQYO 4LC1A 3ETQA 1BAKA 1GRJA 1SETA 4JAUA 2HE7A 3U0ZA 2WLLB 1XREA 2OCCC 1X4TA 5JJNB 2DOSA 5B1OA 1WLEA 4JI3O 1VQKV 2IYBA 3PG7A 2K2UA 5B1BB 1NU1H 4FK5C 2Q68A 1G6UA 4WFGA 1Q7YW 5FI1A 2GUZA 3A8PA 3OR6C 3E2EA 1GM7A 1KYOF 3P32A 4DR6O 4MVQA 4NVPA 4XDKA 1THZA 4CH4A 2VS0A 3AK2A 2ZM6O 2ZM6B 2XAFA 3CCUV 3RFRA 1OMWA 1OCOC 5A2QN 2I1JA 5B3SC 1WB8A 1J5EO 2V76A 2LGQA 4IIJA 1VQOV 2YICA 3IVFA 4DUZB 1WG7A 1HNWO 2B1GA 1I0HA 1QLNA 3DC5A 1ZTEA 2F95B 2DWDC 3SV1A 1U2BA 5LBQA 1JJ2U 1N32B 4NTYA 1CEZA 3UCSC 2EIMC 3F5RA 4W4KA 2YS1A 2DN9A 3CJHB 2DX1A 1ISNA 1ZSQA 1J95A 3WA0A 4UXNA 2IH1C 4GX1A 2UXDB 1R1BA 2JIZG 3K79A 4NKGB 1Y76B 4X62O 3HKBA 1U5GA 4O4LB 2WWWA 2HFEC 2P5OA 2LGWA 2IU3A 1NTYA 3AEIA 2PI4A 1E1QG 3DXDA 3ZDTA 2YDEA 2FTKA 3MDSA 4D6WA 2KB1A 2DKPA 1HDJA 5I2MA 4KVGB 4J11A 4GKKO 1U5EA 1AR4A 3AG2C 3ASOB 1NKDA 4D0NB 1IDSA 2DW4A 4K3AA 1XMOO 3K0DA 2OTLV 3FYIB 4C0AA 3ZRVA 3FSSA 5EIBD 2K9PA 4JI2B 5IJ9A 2ROVA 1E5WA 4MVRA 4IAPA 4KHOA 3CSXA 1XI1A 2ZQMA 1FJGB 1IX9A 1CPYA 5DIFB 2LFSA 1FFXB 3TJTA 4F7UP 4PHZA 3OTFA 2GTAA 4AHCA 1IVSA 2HJDA 1TA8A 2ITDC 1FPOA 2AZ0A 2HKOA 2YUAA 5KUKA 3CMAV 3P30A 3PSCA 2NR5A 5BMVA 5LONB 4I0XA 4FLVA 2YS5A 3RYIA 5BR8O 3OW2U 5GTIZ 1Q67A 4DV3O 3C90A 3QBVB 3LUTB 2UUAB 4DR7B 2CGNA 2K00A 2JJ2G 3CCQV 5JCOA 1MK9B 4LH6A 2QEXV 4KHPB 1H10A 1HNZB 2OYQA 1LB1A 4HNAA 2EIKB 1JJOA 5JVDA 1S5HC 4DV7B 1U97A 2YS3A 2NLJC 1QR8A 4CS4A 2L2IA 4ZRJA 5EC1C 1U29A 4YJ3A 1SQFA 4J10A 1DDVA 4U3JA 3JASB 2NMBA 2H8PC 1ZWIC 2R9AA 2VQEB 1GAXA 2L35A 3CCMV 4PQ0A 5LGUA 4CS2A 1M57C 1SQPH 1I5YA 4I7ZB 1Y6XA 5H6RA
chains in the Genus database with same CATH topology
4ASUG 4G2KA 5L3EA 3VBBA 2XNDG 2XAQA 4WFAV 3JD0A 1NBMG 1K4DC 2V1DA 2XOKG 5CBFA 2BOBC 2MK3A 1M90W 3JD4A 5EC2C 4WCEV 5L3BA 5DM6V 3OR7C 3B77A 3JD3A 3E86A 3T4DA 3WG7C 4QNHB 1E79G 3SJQC 2EBOA 4PDRA 1FXKC 3SPCA 4N23A 1NQTA 4PA6A 2B5UA 1K4CC 1M57B 1QR9A 3E8FA 4F4LA 5L3FA 1YTFB 2YSUB 2ZXWB 3JD2A 3OMAB 2C2AA 4XBFA 2WLHA 1W0JG 3R65A 1PL0A 2B1IA 3EHBB 1AJQA 1H2GA 4MVMA 3ETEA 1OCCB 4PA4A 1OCZC 1JVMA 3SPJA 4RQFA 1YJ9V 4KUMA 2HG5C 3CXCU 4QPKA 3QNEA 4WFHA 3TCUA 1BHBA 3SYAA 2NNUA 5HFMA 1Q86W 2R9RB 2P6JA 4R6ZA 4TT3G 5BZBA 4CZZA 2ZR2A 2QKSA 1OCZB 1N8RW 5L3DA 1FFTB 3ZIAG 5H6QA 1H8EG 5B1NA 4MVOA 3UM7A 2V7QG 2EJRA 4MW8A 2OTJV 3SPHA 4LCUC 2LFRA 1VQLV 1Y4MA 2GHYA 2H94A 2X6AA 4E2LA 5IY5B 1XL6A 1BMFG 4YXWG 1FXKB 2DQ0A 4EKWA 1M1KW 1CP9A 2Y69C 3LDEA 1E1RG 4G28B 4QE9A 1VQ5V 2EZPA 1R3IC 3G71V 1VQ4V 3QO7A 3FB6C 2OCCB 2IJHA 2DYSC 2XASA 1RM1B 4MW3A 3UKMA 4Z1MG 1RM1C 1QBZA 3FB5C 1AI6A 3ABKB 4R8CA 1ROPA 4R7CA 4I5SA 1YTFD 3SYCA 4KFMA 3OAAG 1VQMV 1K92A 3ZMVA 1NR7A 1MOFA 4FJCC 3ETGA 2Q67A 2P7TC 1IXMA 1DF5A 5EBLC 4BIZA 2W6IG 4UVBA 3GWOA 4RO2A 1JQ0A 1S72V 3CCLV 3E89A 2F43G 4U7NA 4MS2A 3ZCCA 1MG1A 4MSWC 4PDLA 1KQSU 5EK0A 3OGCC 3OEHG 3E83A 1Q81W 1SERA 2JJ1G 1K34A 1YJWV 1VQ9V 2IJIA 1JOYA 1KD1W 3OUSA 2JDIG 3OFNG 2LP7A 3AG2B 2IJKA 3ZN1A 5CA3A 1JPXA 3M99B 1QLEC 1HWYA 3AG1B 3GB7C 1SRYA 4JASA 1BHAA 1V54B 1BL8A 3ZN0A 2EINB 3ASNB 4MTOA 1VQ8V 4UV8A 1S77D 1AJNA 2Y48A 4RUEA 2A0LA 3K9AA 5J9PC 4BW5A 3AG1C 2HLDG 3A0RA 5EBMC 1K33A 2WLMA 1GM8A 3FB7C 3H01A 1F51A 4GCZA 3D3IA 1JX9A 3CC4V 3RVZA 2X7RB 1OCRB 5EBWC 5C93A 3ZMZA 4HAMA 5IYDO 3I55V 1ORQC 2QTOA 3FKSG 5KA6A 2QA4V 3F7VC 1V55C 3ZMUA 4MTGA 4H37A 1R6KA 2WLKA 1YIJV 5FL7G 2DYRB 2YEVA 3K3WA 1EFRG 3CPWU 1NR1A 1VQ7V 3HSAA 3K06A 4KP4A 2ZXWC 4GX2A 4MTXA 5KA5A 4MVUA 4R50A 4TSFG 2P90A 3CMEV 1NH2D 3ABLC 4X8AA 1GKFA 1S3JA 4GT1A 1M56C 5KUMA 2EILB 3ZMTA 4QE7A 3LNMB 2X6CA 4JYCA 1YITV 3CYOA 1OCOB 1R3KC 1Y66A 1PNLA 1YJNV 3AG4C 5LHGA 1GMGA 2XAGA 3ABMB 2EIKC 5E1AC 1VQPV 2UXXA 2ZDIA 3JYCA 2Q6AA 3STZC 3OEEG 2W0FC 4CBCA 3SPGA 4UVAA 3CCRV 3JCZA 3CC7V 2Y69B 3EFFK 1AJPA 3RW0A 1OZ0A 3VOUA 2ITCC 5B1BC 3CCVV 1KP2A 1W0KG 3CP1A 1V54C 2QE7G 3FB8C 4BIUA 3CCEV 1QVGU 4QJFB 4OXSA 1G8MA 4H33A 3IFXA 1GM9A 4XDLA 1S76D 4G27B 2A9HA 3OE7G 2ZR3A 3E35A 4WFBV 4ZKIA 1K9MW 4P2ZA 1JCHA 4FPPA 2X6BA 3CCSV 1GO3F 3W7WA 3ABUA 1OHHG 2WLLA 3LDCA 5H6RA 1YHQV 1OCRC 3W7SA 1AR1B 3G6EV 1SZTA 2Q69A 1F4MA 2EIMB 3AG3C 2HJFC 4WFFA 1K8AW 3NXSA 1PKXA 2AHYA 4QPJA 4UV9A 5LGTA 5L3CA 3BEHA 4RQEA 2Z3YA 3CCJV 3SPIA 2M7WA 2IW5A 3ZRXA 4HYOA 2ZD9A 4WFEA 5B1AC 2UXNA 5LHIA 1P4RA 2XAJA 4P9OA 1UJWB 4PDMA 2JEXA 4MTFA 1NH2B 4LP8A 1P7BA 2OT5A 2GSMB 3WG7B 3DGEA 1KC8W 3DCXA 4P9PA 4LC1A 3ABKC 5IDJA 4JGSA 1R73A 3DTUB 1SETA 4JAUA 2A79B 4N21A 4PELA 4RUFA 3OMIB 4BAYA 3I56V 2WLLB 2OCCC 4TWKA 4UUJC 5B1OA 3MHHC 1M56B 1DF4A 1WLEA 5LHHA 1VQKV 5CMUA 5B1BB 3E8BA 4FK5C 4JAVA 2Q68A 4WFGA 5H9CA 1Q7YW 1K3EA 3OR6C 3E2EA 1GM7A 1ENVA 3P32A 1H38A 4MVQA 1XL4A 2QM8A 4XDKA 1AI7A 1THZA 1TUEB 1RPRA 2K1EA 2XAFA 3CCUV 2HVJC 1OCOC 3LSSA 4Q20A 1K5SA 1QCEA 4JF3A 2EIJB 1NVPB 1PNKA 2WPDG 5B3SC 3B8MA 3TK1A 3SYPA 4GX0A 4MVSA 2EIJC 3ZRWA 2D3OW 1EZJA 2JEUA 1VQOV 1KECA 2WLNA 1WPXA 2B1GA 2WAMA 1QLNA 3STLC 2DWDC 1B6QA 5LBQA 2DQ3A 1JJ2U 4FIPC 3E8HA 1CEZA 4JTDB 2EIMC 3AG3B 2EINC 3ASNC 4DXWA 4HZ3A 4ZBMA 2IJJA 5IYBO 4DO2A 5GW7A 1VQ6V 2W6JG 4X89A 1K73W 2YEVB 2HVKC 1J95A 1I5XA 1RPOA 3ZMSA 4UXNA 2IH1C 4GX1A 5CBHA 3LSQA 1S0VA 3K79A 2JIZG 4XDJA 4J9ZB 2QM7A 2HR3A 1AI5A 1DLBA 1F4NA 1SESA 2WWWA 3W7UA 2HFEC 4GX5A 3MHSC 2IU3A 5IYCO 3AEIA 3TETA 4X88A 1K7DA 2IH3C 1NJIW 1F23A 2PI4A 1E1QG 2FTKA 3K08A 3IGAC 3OM3B 2KB1A 3F7YC 2WLJA 3ABTA 3W7TA 1COWG 3ZRSA 3SYOA 3SYQA 1QLEB 3AG2C 3ASOB 1NKDA 4L87A 3QO5A 1YSCA 3KG2A 1K97A 3RBZA 1DTOA 5CN0A 3OMNB 2BOCC 2DW4A 4FMTA 4PA9A 4PA3A 1AI4A 1W2BU 3HB3B 3OUFA 1LNQA 1NVPD 3K0DA 2Z5UA 3IC7A 1PD3A 2OTLV 2XAHA 3FYIB 3ZRVA 2CK3G 4PDVA 2EZOA 3ETDA 1FXVA 4MVRA 1GTOA 1PNMA 3WFVA 5HFLA 1R3JC 2ZQMA 3PJSK 2WSSG 5CBGA 1CPYA 4J9YB 2JK5C 2LFSA 3CD6V 4JTAB 3B8NA 2ITDC 3T4ZA 3QO8A 1K5QA 2HKOA 4U7OA 2X0LA 5KUKA 3P30A 3CMAV 1H8HG 3LDDA 3JD1A 3W7XA 1FXKA 1EBOA 3HPLC 3T1CA 1M9NA 1G4YB 1AROP 2R9IA 3D36A 2WLIA 3ML0A 3OW2U 2AHZA 2DYSB 3MD0A 3T2MA 1GK9A 3AG4B 4QIWF 3LUTB 2EILC 3CC2V 3ABLB 3G4SV 5LGNA 2JJ2G 3CCQV 5L3GA 4JPRA 3ZJZA 3F5WC 5IY5C 2QEXV 5B1AB 3X2QC 4UVCA 1R6NA 4RAIA 1KKDA 1QVFU 3X2QB 2EIKB 3ABMC 3ZRWB 5DN6G 1S5HC 3RVYA 4MT8A 1V55B 4MVZA 4PA7A 2NLJC 1QR8A 5EC1C 5B3SB 1L1FA 2P67A 2ATKC 2ZDIC 4JYBA 1KP3A 2WLIB 3BY6A 3K04A 4JTCB 2PI5A 1OCCC 2IU0A 3ASOC 4I9WA 3FYEB 2DYRC 2H8PC 1ZWIC 3K03A 1Q82W 3K0GA 4LBEC 3CCMV 1VQNV 3E8GA 5LGUA 1MSWD 1M57C 2DWEC 1YI2V 1FS0G 1I5YA 1MABG 1R3LC 4WF9V 1FXHA 4P30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F23 A;  1SZT A;  4FIP C;  4G2K A;  3HSA A;  1Y4M A;  1K33 A;  1K34 A;  1QR8 A;  4JGS A;  3WFV A;  3CP1 A;  5HFL A;  4E2L A;  3H01 A;  5KA5 A;  1QCE A;  4JF3 A;  4N21 A;  2LP7 A;  2MK3 A;  2X7R B;  3B8M A;  1I5X A;  1MOF A;  1JPX A;  2M7W A;  3M99 B;  4JPR A;  3MHH C;  3B8N A;  4FJC C;  2EZP A;  5CN0 A;  1DF4 A;  3CYO A;  3B77 A;  5HFM A;  1Y66 A;  1DF5 A;  2P6J A;  3P30 A;  5KA6 A;  5CMU A;  4FK5 C;  1DLB A;  2EBO A;  3GWO A;  1JQ0 A;  1EBO A;  2OT5 A;  4N23 A;  5H9C A;  3K9A A;  1QBZ A;  3DCX A;  1QR9 A;  3MHS C;  1MG1 A;  1I5Y A;  1ENV A;  2EZO A; 
#chains in the Genus database with same CATH topology
 4UCS A;  4A5K A;  4EFE A;  2R72 A;  2LW7 A;  4WFA V;  4DR7 O;  4WSF A;  2HHH B;  2V1D A;  3OGI B;  1WPB A;  5IE9 A;  2W0X A;  4CS3 A;  4ZI7 A;  5EZY A;  4X1Y B;  3JD3 A;  3WG7 C;  2EBO A;  3VQW A;  1NQT A;  2LW1 A;  4F4L A;  1YTF B;  4AIL C;  3JD2 A;  5EYP A;  2C2A A;  4XBF A;  4OX9 B;  4LF7 B;  4HDO A;  1ZC4 B;  2B1I A;  3EHB B;  1H2G A;  4Q6G A;  3SPJ A;  2ILM A;  1OCC B;  4PA4 A;  1AR5 A;  3QNE A;  3CHX A;  1RP3 B;  1UPQ A;  2YI8 A;  4R6Z A;  3ML4 A;  2ZR2 A;  2Z0P A;  4DXA B;  2QKS A;  2BTQ B;  1MA1 A;  1N8R W;  2IBZ H;  3ZIA G;  3ZX6 A;  4LF8 O;  2V7Q G;  4DV1 O;  4HB4 B;  4WJ7 A;  3SPH A;  1VQL V;  2X6A A;  4E2L A;  2ZNI A;  1B3Q A;  3L72 H;  4OPH A;  1BMF G;  4YXW G;  2GUZ B;  2DQ0 A;  1CP9 A;  2RVB B;  3LDE A;  2LO1 A;  4G28 B;  1VQ5 V;  3RYI B;  5C79 A;  4EB6 B;  5JH7 A;  2OCC B;  2IJH A;  3CX5 F;  4DV2 B;  4IL6 Z;  3UKM A;  4Z1M G;  1KKC A;  2Q73 A;  3ABK B;  1BCC H;  2QGN A;  2RDC A;  4R7C A;  2GUM A;  1EAZ A;  1I7F A;  2DTC A;  3CRR A;  1HR0 O;  1K92 A;  2YT0 A;  5EYP B;  3VQX A;  4FJC C;  2UXC O;  2UXC B;  1V5M A;  2P7T C;  2PUS A;  3HKD A;  5EBL C;  2W6I G;  3GWO A;  4H0L B;  1N33 O;  2CRF A;  3ZHV A;  1S72 V;  4YJ3 B;  1IBK B;  3JCU Z;  4DV1 B;  3D3Q A;  5EK0 A;  2Q4P A;  3JAS A;  3OEH G;  2AGA A;  2F93 B;  1WI1 A;  3OUS A;  4LWS B;  4TUY A;  4JI8 B;  3A98 B;  3ZN1 A;  5CA3 A;  5CLL B;  2Q0A A;  4W4L A;  1WJZ A;  4LFA O;  1GN2 A;  3N2G A;  1SGH A;  2EIN B;  1VQ8 V;  4UV8 A;  1TVK A;  5KAI Z;  2Y48 A;  4RUE A;  2A0L A;  1G1X B;  3KSY A;  2NZ8 B;  2PY5 A;  4K0K B;  5IT9 N;  2CTW A;  3ZED A;  3RYH B;  1RJ2 A;  2QKA A;  2RRF A;  3FB7 C;  2ZIM A;  2LG1 A;  3QG5 A;  3UZT A;  4GCZ A;  4CYE A;  2X7R B;  4TYZ A;  2YIA A;  1OCR B;  4PJ0 Z;  5EBW C;  5C93 A;  3PZD A;  4J7Z A;  5IJ9 B;  2QTO A;  1NI8 A;  4LFC O;  3F7V C;  1V55 C;  2P4V A;  4X1K A;  2Q7H A;  4YL8 A;  4PI2 A;  1DDW A;  3CIK A;  5FL7 G;  3F5T A;  4IIJ B;  1ZLZ A;  1VQ7 V;  3E22 A;  5KA5 A;  1SHC A;  4JV5 O;  2ZIO A;  3N27 A;  1X59 A;  1LUV A;  3ABL C;  2V4D A;  4X8A A;  1WB7 A;  5ITZ B;  2N23 A;  4KHB B;  3L71 H;  2F4V B;  3LNM B;  4KXR A;  1NI2 A;  1P5T A;  2YI9 A;  3ABM B;  2ZNJ A;  2UXX A;  2ZDI A;  3M7M X;  2Q6A A;  3STZ C;  3OEE G;  2VQF B;  2CH7 B;  4CBC A;  4IYI A;  4DV5 O;  4HSI A;  3NR7 A;  2MWN B;  5LOV B;  5GON A;  3KKY A;  3HKC A;  4O2B A;  1FAO A;  2QE7 G;  2GCL A;  4F7H A;  3FB8 C;  3CCE V;  2E74 B;  2KG7 B;  4NTX A;  1G8M A;  3TCA A;  4H33 A;  4A6F A;  3IFX A;  3JSL A;  1K5D B;  4WBN A;  4G27 B;  4ZIB A;  1XBL A;  1K9M W;  2Q5Z A;  1KB9 F;  1JCH A;  3BFR A;  4BIO A;  2QWP B;  1OCR C;  1YHQ V;  4FFB A;  3IC9 A;  3G6E V;  1SZT A;  1F4M A;  4WFF A;  4B7E A;  4DR4 O;  1BQZ A;  2Q7G A;  4YY3 O;  5D3W A;  4B6H A;  3SPI A;  4A6H A;  4O4I A;  2YT2 A;  2X18 A;  1BSM A;  5HE3 A;  1P4R A;  1AQC A;  4OT1 A;  1MI1 A;  4MTF A;  1NH2 B;  5C8Y A;  2Z59 A;  3SJA C;  1MNG A;  5JP4 A;  4D7T A;  4CH3 A;  5C5B B;  3H1I H;  3HKD B;  2M6Y A;  3AK1 A;  3O96 A;  4C7U A;  5J2U B;  5HE1 A;  4ABM A;  4CH6 A;  2CY4 A;  4AI8 A;  2P4K A;  4N21 A;  3ZHQ A;  1SQB H;  5IRS A;  3BA8 A;  1M56 B;  1W1H A;  2FJL A;  4DRX B;  4JAV A;  5KX5 A;  3QTC A;  3S3X A;  4J7J A;  1H38 A;  5DI9 B;  1XL4 A;  5JH7 B;  2OWO A;  4QGP A;  2HVJ C;  2PF4 E;  3FAV A;  4Q20 A;  1MSD A;  2E2X A;  1FAF A;  4JF3 A;  1HNX B;  4J41 A;  1MIZ B;  3SYP A;  4GX0 A;  3ZRW A;  4L6E A;  2JEU A;  1Q6I A;  4Z1V A;  3G9W A;  1KEC A;  1TAE A;  3P3N A;  2WAM A;  1GC7 A;  2JS5 A;  2KIG A;  2D9V A;  3STL C;  4DR5 B;  4B3R B;  3E8H A;  5CB4 A;  1Y74 B;  2DKQ A;  3HR0 A;  4X66 O;  2IJJ A;  4DO2 A;  3JAK B;  1I2H A;  1VF5 B;  1WNS A;  3NWA A;  2GJY A;  5KQ1 A;  2LOZ A;  2Z13 A;  2YXH A;  1FKA O;  5CBH A;  3SGI A;  4J9Z B;  4O2B B;  1LUW A;  2HR3 A;  2QM7 A;  5DH9 B;  1AI5 A;  4X20 A;  5GON B;  1F4N A;  1ZAU A;  3W7U A;  4GOU A;  4JI7 O;  3TET A;  4IT5 A;  5C16 A;  2IH3 C;  3JAW A;  2AXT Z;  2EMS A;  3K08 A;  2EX3 A;  3F7Y C;  2FL4 A;  3ABT A;  1DRO A;  1BTK A;  1TXD A;  3CXB B;  3ZRS A;  3SYO A;  1QLE B;  5D3X A;  4HAX B;  3QO5 A;  3KG2 A;  1X11 A;  1VF6 A;  2BOC C;  1AI4 A;  1W2B U;  1FGY A;  1J19 A;  2Q0O C;  3RYH A;  2Z5U A;  5KQ4 A;  5JLJ B;  3BAB A;  4CHJ A;  3UQ8 A;  1IBM O;  4PDV A;  3ETD A;  4HDQ A;  1GTO A;  3D8C A;  3KCY A;  1Y5O A;  4TQF A;  3PJS K;  1SS3 A;  3G67 A;  1P84 F;  2QWR B;  1OV9 A;  3B8N A;  3T4Z A;  4JI2 O;  2D11 A;  1XR0 B;  4JI5 B;  2COA A;  4U7O A;  1H8H G;  5CA0 B;  4IFS A;  4F7G A;  3JD1 A;  1FXK A;  4J7K A;  1EBO A;  3T1C A;  3FVC A;  1VP7 A;  4NYK A;  5B5E Z;  1G4Y B;  5KHG A;  2WLI A;  2AHZ A;  4X64 O;  1EN6 A;  4K8Z A;  1YF2 A;  1GK9 A;  1SA0 B;  3H1H H;  1YDX A;  3AG4 B;  3CRQ A;  1XDC A;  2EIL C;  1IBL O;  2AL6 A;  3CRM A;  5C5B A;  4I50 B;  5LGN A;  3PP2 A;  3BPZ A;  1I7A A;  4B3S O;  3ZJZ A;  3PVU A;  3A0H Z;  4QJ4 B;  3ULC A;  5CA1 B;  3DXE A;  1CXZ B;  4UVC A;  1QC6 A;  1QVF U;  2KG7 A;  4JAA A;  2YIB A;  5LP6 B;  5DN6 G;  1RSO A;  4MT8 A;  1IXB A;  4MVZ A;  4LFB O;  5EIB C;  1L1F A;  1W59 A;  4NXM O;  4X62 B;  3K04 A;  2D9Y A;  2PI5 A;  1OCC C;  3KZ1 A;  2QSA A;  1DDM A;  3FYE B;  4H8S A;  3RGB A;  1N0N A;  1SF9 A;  2ZE7 A;  1Q82 W;  3CWB H;  1FJG O;  1I94 O;  1VQN V;  1ZUQ A;  1WGQ A;  5KCV A;  1KUQ A;  4TKN A;  4WF9 V;  5M4Y B;  4P30 A;  4O4I B;  4ASU G;  4G2K A;  3LJU X;  4I9Q A;  1U27 A;  2D2C B;  4EKU A;  4IHJ A;  3LSU A;  2XAQ A;  4HBN A;  2XOK G;  2ADP A;  2PYL A;  5LMU B;  1KI1 B;  2MK3 A;  5EC2 C;  5KLV H;  4K81 A;  5D5P A;  1S5J A;  4LF9 O;  3TXS A;  3OR7 C;  2DHJ A;  2JRI A;  3B77 A;  2QKC A;  3E86 A;  4UCV A;  2DLW A;  4HAU B;  1XHZ A;  3E22 B;  3SPC A;  2ARH A;  3D8E A;  3SNH A;  4DBB A;  1M57 B;  3E8F A;  2N05 A;  2JGU A;  5ITZ A;  4KHB A;  4DR1 O;  4U3J B;  3T1H B;  2GTS A;  3Q4H B;  3R65 A;  2Z4D A;  2FYU H;  5LMN B;  3TW1 A;  3ETE A;  1OCZ C;  4RQF A;  2FKX A;  4IOY X;  3CXC U;  4QPK A;  3WU2 Z;  3R66 A;  2GDS A;  4GMX B;  3TCU A;  1BHB A;  1NTV A;  3UT5 A;  1H4R A;  2R9R B;  3K5O A;  1EN4 A;  2P6J A;  1XEQ A;  2L1C A;  3CEI A;  1OCZ B;  2CDY A;  2LOX A;  5KHH A;  4JI1 O;  1VAR A;  5LP6 C;  3N7C A;  2ZKM X;  2I5F A;  2KR0 A;  5B1N A;  4DR6 B;  4MVO A;  1PL4 A;  2OTJ V;  2H94 A;  2OIG A;  3LNN A;  1KZG A;  3EXA A;  4HB3 B;  3ODW A;  1R3I C;  4WVF B;  3K59 A;  1OY2 A;  3WYF B;  3JAM N;  3P7Z A;  2L6L A;  4D6T H;  3DSQ A;  1RM1 C;  5J3T A;  1ROP A;  1VEW A;  1U5F A;  4MK0 A;  5FPO A;  2AZ2 A;  1VQM V;  4X20 B;  3ZBH A;  4RWU A;  3ETG A;  1RFY A;  1DF5 A;  4BIZ A;  2PZ1 A;  2F1M A;  2UVM A;  3E89 A;  3FFQ A;  3JAK A;  2F43 G;  4QJ5 B;  1W1D A;  4U7N A;  3ZCC A;  1MAI A;  1PFJ A;  4K2O A;  1KQS U;  3SO6 A;  4Z2N A;  4TV9 B;  3CE2 A;  1Y67 A;  4B7K A;  1SER A;  3HKB B;  2N74 A;  1JOY A;  1WN7 A;  3AG2 B;  4B08 A;  2VRW B;  4B3M B;  1QLE C;  1B04 A;  2KGX B;  4LF5 B;  4JAS A;  1V54 B;  2DJV A;  5IJ0 B;  4P7I A;  3ASN B;  4MTO A;  2KUP A;  3K9A A;  3G6B A;  4BW5 A;  4LNU B;  1LR1 A;  3JSN A;  4GMV A;  3H01 A;  1F51 A;  4KL1 A;  1X1G A;  3D3I A;  1N36 B;  4K2P A;  3RVZ A;  3F0W A;  5KHJ A;  3H1J H;  5J3Y A;  4JYA O;  1XNR B;  5GOW B;  5KA6 A;  4DW1 A;  5D27 A;  3RYF A;  1U5D A;  3HKE B;  3ZMU A;  2HHH O;  3ULB A;  1HW7 A;  3B40 A;  4CC6 A;  3PVL A;  2YEV A;  3K3W A;  4LH7 A;  4GN1 A;  4NR1 A;  1EFR G;  4I4T A;  1H2K A;  1OJH A;  4DV3 B;  2PYJ A;  1HP8 A;  2JS3 A;  3T06 A;  2P90 A;  1BGY H;  3CME V;  1NH2 D;  1GKF A;  5KUM A;  5C8Y B;  1M56 C;  5H2F Z;  3ZMT A;  3JAL B;  4X1I B;  1Q43 A;  2X6C A;  1SA0 A;  4EMO A;  1R3K C;  3K57 A;  2NBV A;  1PPJ H;  4A6K A;  3DXR B;  1VIB A;  2CUG A;  4UCU A;  4UVA A;  3CCR V;  5KAF Z;  4CSQ A;  4DV0 B;  1OZ0 A;  4B3S B;  4LFA B;  3VOU A;  5B1B C;  1KP2 A;  1W0K G;  3CP1 A;  1P6S A;  1V54 C;  1I94 B;  4GKJ B;  4OXS A;  5JQG A;  1NS1 A;  1GM9 A;  4ZKI A;  1FHW A;  4FZ1 A;  4H13 B;  4P2Z A;  1XMQ B;  4FPP A;  2QWQ B;  4DR2 B;  3CCS V;  4GLX A;  2Z0O A;  1OHH G;  3C3S A;  5EZY B;  4LF9 B;  2Q69 A;  2EIM B;  5JHG A;  2HJF C;  3RYF B;  3NXS A;  3DXR A;  1WP8 A;  5B66 Z;  5L3C A;  2QWO B;  5LYJ B;  4RQE A;  2Z3Y A;  2DMX A;  2N0Y A;  2IW5 A;  4WFE A;  2PTM A;  4HAT B;  3BHP A;  2XAJ A;  3AJ4 A;  3JAR A;  4JZ2 A;  2BCJ A;  2JEX A;  4FLW A;  2LKO A;  5BY1 A;  2OT5 A;  3CJH A;  3DGE A;  2M14 A;  4P9P A;  4DV0 O;  1XUQ A;  5D5Q A;  2VWK A;  4JI0 O;  3U11 A;  1Z5V A;  3G80 A;  4JGS A;  4NXN O;  4PV1 B;  1R73 A;  2BCC H;  4PEL A;  3I56 V;  3OMI B;  1DGS A;  5LA6 A;  4TWK A;  3TVV A;  4UUJ C;  1Z87 A;  1DF4 A;  2COF A;  5LHH A;  2UUC B;  5CMU A;  2RCV A;  4UCR A;  4LF4 O;  3A8Q A;  1K3E A;  1ENV A;  1SC5 B;  2R0D A;  1BE3 H;  4O4H A;  1QCE A;  1TVK B;  3J80 N;  1JFF A;  2EIJ B;  1NVP B;  3AU5 A;  1PNK A;  2WPD G;  3WB1 A;  3KRW A;  5KMG B;  5LP6 A;  1WA8 A;  2D3O W;  5KHK A;  2YXL A;  4UB6 Z;  3HQC A;  5AG2 A;  3H1K H;  1AP6 A;  1AP5 A;  4EFB A;  1YXB A;  2GV9 A;  1JMK C;  2DQ3 A;  1SQV H;  4EB6 A;  4YHH O;  5DEC A;  3ASN C;  4ZBM A;  1NTZ H;  3K5N A;  5GW7 A;  1VQ6 V;  4X89 A;  4CC5 A;  2HVK C;  1RPO A;  1TJ6 A;  3ZMS A;  5CLQ B;  4YIO A;  2DA0 A;  2UUB O;  3QWM A;  1S0V A;  5D3Y A;  2VKI A;  1DLB A;  1N33 B;  3JAT A;  3CXH F;  4LF4 B;  3VOQ A;  1WA8 B;  1IBK O;  4GX5 A;  5D3V A;  4ZI7 B;  5IWA B;  3GYO A;  5IYC O;  2XHB A;  4FZ0 A;  2Q8V A;  1K7D A;  3GVM A;  4X88 A;  3TXQ A;  3T1H O;  3BRC A;  3IGA C;  3UT5 B;  4DR3 B;  2D9Z A;  2PZS A;  3W7T A;  1COW G;  2D2Q A;  4L87 A;  1YSC A;  1DTO A;  2KIE A;  3A0B Z;  2COC A;  4PA3 A;  4PA9 A;  2YC0 A;  1GN4 A;  1XQ8 A;  3K5M A;  3HB3 B;  4K8X A;  1N3H A;  5CB4 B;  3D8D A;  2MKR A;  2VRZ A;  3IC7 A;  2EC1 A;  1EZV H;  5IYZ A;  1ZM0 A;  4JI5 O;  1EM1 A;  4DV6 B;  3AG7 A;  2QTS A;  2EZO A;  4JI6 B;  2UZS A;  3D36 C;  1FXV A;  3SJB C;  3KY9 A;  1UFI A;  4HAZ B;  3NSU A;  2P0H A;  3GWK C;  2YS8 A;  2WSS G;  5CBG A;  4J9Y B;  1M7R A;  4DUY O;  4TV8 A;  4JTA B;  1V61 A;  4GXB A;  2NN4 A;  3QO8 A;  2ZE8 A;  2QM4 A;  2X0L A;  2ZE5 A;  4LR3 A;  4U3F H;  3LDD A;  1IBL B;  3W7X A;  4DUZ O;  2AW9 A;  4I55 A;  3HPL C;  2W2W A;  3VIA A;  5IWA O;  1ARO P;  4D7S A;  3D36 A;  3MD0 A;  4PI0 A;  2RGN B;  4BWA A;  2PGG A;  1WAZ A;  3APQ A;  1K5G B;  1GC6 A;  3D8F A;  2VSZ A;  5IY5 C;  5B1A B;  2DHK A;  1R6N A;  2A06 H;  4FM1 A;  2RQ6 A;  2D9W A;  3X2Q B;  4X66 B;  4O4H B;  4UFZ A;  1BT8 A;  4K0K O;  3WB0 A;  3ZRW B;  2KSD A;  3KCX A;  4JI6 O;  3RVY A;  2D10 A;  5JCO C;  4LF8 B;  4PA7 A;  1X05 A;  2J0J A;  2P67 A;  2ATK C;  2N04 A;  2ZDI C;  4O2A B;  3X23 A;  4JTC B;  3BY6 A;  2DFK A;  1SQQ H;  2ELA A;  5L81 A;  1HNW B;  3Q4H A;  2ADZ A;  2O57 A;  3K0G A;  2RUK B;  3E8G A;  3ZS8 C;  3S3W A;  1MSW D;  2DWE C;  4LWS A;  4B3T B;  1R3L C;  4FLY A;  3NW8 A;  1FXH A;  5LOP B;  4DV6 O;  5CA0 A;  5L3E A;  4LF6 B;  2XND G;  4DR4 B;  1J0W A;  2JGD B;  4X65 O;  1NBM G;  1K4D C;  5CBF A;  2Q7E A;  2MDX A;  1M90 W;  5L3B A;  1FB8 A;  4YJ2 B;  3T1Y O;  2Y8F A;  4FLU A;  2R70 A;  3OAN A;  4FFB B;  3FEH A;  4QNH B;  1E79 G;  2RJZ A;  4PDR A;  2KKW A;  4PA6 A;  1K4C C;  1QR9 A;  2Y4U A;  1N0J A;  2ZXW B;  3K58 A;  3OMA B;  1VF6 C;  2WLH A;  1W0J G;  4L1R A;  3MAQ A;  5LXT B;  2UUA O;  1SZX A;  4MVM A;  1EVH A;  2DYN A;  4KUM A;  2HG5 C;  5HE2 A;  4WFH A;  3WB2 A;  3BVO A;  3SYA A;  2NNU A;  1XMO B;  1Q86 W;  4QXA B;  1NU2 A;  1D5A A;  4TT3 G;  4F6R A;  4NXM B;  5EFX A;  5L3D A;  5H6Q A;  1H8E G;  3APO A;  3P3P A;  4DV7 O;  3UM7 A;  2H3O A;  1Y4M A;  2GHY A;  1RRP B;  3BAA A;  3K9S A;  1MIX A;  3ICX A;  1XL6 A;  2LYD A;  1FXK B;  5IJ0 A;  4DRX A;  4TV9 A;  4EKW A;  2P8V A;  1ZX3 A;  2Y69 C;  3FD9 A;  3SUZ A;  4L8J A;  2EZP A;  1UNR A;  3G71 V;  1GN3 A;  2LQT A;  5JWP A;  2QWN B;  1VQ4 V;  3QO7 A;  3FB6 C;  1JFF B;  1RM1 B;  2XAS A;  2UU9 B;  2ODM A;  1YEW A;  1ZVR A;  1QBZ A;  1XIL A;  4R8C A;  4I5S A;  1YTF D;  4IGG A;  4EJN A;  2YID A;  2OQB A;  4HAV B;  2DE0 X;  4YY3 B;  3HKE A;  4NTW A;  4O4L A;  3ZMV A;  1MOF A;  1EF1 A;  4DR1 B;  1Q6H A;  1MZF A;  1FHX A;  1LW3 A;  4MY6 A;  3RYC B;  1IXM A;  5LXT A;  2ZPY A;  4UVB A;  2W2X D;  1O9H A;  4MS2 A;  5LYJ A;  1MG1 A;  3O65 A;  4O2A A;  2J0M A;  4DIX A;  4ZHQ B;  2I5C A;  4K35 A;  2BTO A;  4MT7 A;  1Q81 W;  4JI0 B;  3MPX A;  1O9G A;  3VQV A;  1YJW V;  3UO3 A;  2E5L O;  2IJI A;  4UCT A;  4DV4 B;  1Q90 D;  5DHF B;  3ODX A;  2JDI G;  3OFN G;  3AU4 A;  2IJK A;  3RCP A;  4GZU A;  1JPX A;  1HWY A;  3GB7 C;  5H5N A;  1SRY A;  1N34 B;  2DHI A;  2GCJ A;  2F23 A;  4GZR B;  4FLT A;  3U8Z A;  2UXB B;  2UXB O;  2DYQ A;  1Z2G A;  2CE4 A;  1URF A;  4HAW B;  1S77 D;  1AJN A;  2ADQ B;  1FYJ A;  2E75 B;  1AVM A;  5J9P C;  2HLD G;  3A0R A;  3I5D A;  3L75 H;  3VQY A;  2H7D A;  5DED A;  4J80 A;  1P3R A;  1QNM A;  4DK1 A;  4YIP A;  2WLM A;  1QQG A;  1GM8 A;  2ZT9 B;  3ZHT A;  2E76 B;  2FB5 A;  5K1P A;  3CC4 V;  2H7E A;  1HNX O;  1M93 A;  1DBH A;  5JJJ B;  2QKM A;  5IYD O;  3U10 A;  3FKS G;  3HKC B;  2QA4 V;  1QU7 A;  1Y74 A;  3L73 H;  4DV2 O;  5LOV A;  2CTQ A;  4H37 A;  1ZSP A;  2WLK A;  3L9D A;  4HAY B;  1WP7 A;  4IYH A;  2WA4 A;  1KZ7 A;  1BZK A;  3THO A;  4B3R O;  3CPW U;  4H44 B;  1NR1 A;  2FML A;  3HSA A;  1NT2 B;  3OD4 A;  4MTX A;  2ZXW C;  1XNR O;  4WBN B;  1WJM A;  4GPT B;  4MVU A;  4R50 A;  5FPR A;  3N2G B;  4I0X B;  5JHH A;  2ETN A;  1T5E A;  4QE7 A;  1BWN A;  2ZE6 A;  1YIT V;  3CYO A;  1OCO B;  2J59 M;  1YJN V;  5LHG A;  1GMG A;  3QVN A;  3J81 N;  3HIE A;  3BIN A;  2W0F C;  2YRY A;  3CC7 V;  3JCZ A;  3A8T A;  3CB2 A;  3EFF K;  2XQN M;  4Z2M B;  4LF5 O;  3P6A A;  5GTH Z;  4OX9 O;  2LJ2 A;  3A2F A;  2K49 A;  4DV4 O;  3OT7 A;  4BIU A;  2GS0 A;  2BSK A;  3B2E E;  4QJF B;  1VMG A;  1YZB A;  2A3Q A;  1US6 A;  2VWJ A;  4XDL A;  3OHM B;  3OE7 G;  2ZR3 A;  3E35 A;  4F6E A;  2P0D A;  4WFB V;  5J2U A;  1XNQ B;  1XNQ O;  3FAV B;  3W7W A;  4GUN A;  3ABU A;  1IZ3 A;  2K8E A;  3FX7 A;  2IFS A;  3ZHS A;  4X64 B;  4GKK B;  3W7S A;  1AR1 B;  3ODO A;  3HK0 A;  3AG3 C;  5KMG A;  1K8A W;  3FM8 C;  2AHY A;  4QPJ A;  4J42 A;  5KX5 B;  4UCO A;  2CGO A;  2OTX A;  2EJ7 A;  2KQX A;  2M7W A;  1U96 A;  2JP2 A;  1V5P A;  4I4T B;  4B3T O;  3ZVR A;  3U12 A;  3GYP A;  5LHI A;  1DYN A;  3M1I B;  3M8A A;  4PDM A;  1AIL A;  5C6R A;  1P7B A;  4HB0 B;  3WG7 B;  1GH6 A;  4X1I A;  4EEQ A;  1KC8 W;  2ELB A;  3ABK C;  4DK0 A;  2YIB D;  3RYC A;  5IDJ A;  3PEG A;  3T1Y B;  1UEF A;  2XUM A;  2HEP A;  2K2J A;  3DTU B;  4RUF A;  2A79 B;  4BAY A;  4BW9 A;  1EGX A;  2W2X C;  1Q6U A;  2KCJ A;  2WA3 A;  4BBK A;  3MHH C;  1MMM A;  5J2T B;  4BR6 A;  3E8B A;  1H2L A;  4GKJ O;  5H9C A;  1H2S B;  5JQG B;  4JYA B;  1J5E B;  1V88 A;  3KRX A;  4B3M O;  2QM8 A;  1AI7 A;  2EMT A;  1TUE B;  1PMS A;  1RPR A;  2K1E A;  3RWR D;  2OIE A;  1H2N A;  2UUC O;  1M7E A;  4FM0 A;  2A7W A;  2CAZ C;  3LSS A;  5A9G A;  1K5S A;  1L0N H;  2ZIN A;  2Y4T A;  4ZOL A;  4LNU A;  3B8M A;  3TK1 A;  1XKE A;  4Z2W A;  4MVS A;  2EIJ C;  1ZYI A;  1N32 O;  1EZJ A;  4HB2 B;  1UNQ A;  3B09 A;  2FJU B;  2WLN A;  1WPX A;  4ICG A;  1XD4 A;  3NWD A;  1B6Q A;  4FIP C;  4O4J A;  4YJ2 A;  4JTD B;  1HNZ O;  3AG3 B;  2EIN C;  4DXW A;  3TO1 A;  4HZ3 A;  4X1Y A;  1PV0 A;  1N4C A;  5IYB O;  1OQN A;  2W6J G;  1K73 W;  2YEV B;  4X9Q A;  1XMQ O;  1I5X A;  5BR8 B;  3LSQ A;  4XDJ A;  3QF7 A;  2HP8 A;  1EN5 A;  1SES A;  1V5U A;  2Q9L A;  1X1F A;  2R2Y A;  3MHS C;  3MDB C;  1S5L Z;  1NJI W;  1F23 A;  2Y0I A;  3OM3 B;  4KHA A;  2WLJ A;  2G35 A;  3SYQ A;  1W1G A;  3KZI Z;  1K97 A;  3RBZ A;  5CN0 A;  2AEH A;  3OMN B;  4FMT A;  1F7Y A;  4ZRI A;  4ZHQ A;  3OUF A;  2MFQ A;  1LNQ A;  1NVP D;  1PD3 A;  2XAH A;  1XOU A;  4NXN B;  1AWE A;  2CK3 G;  5BXZ A;  4TUY B;  2KUQ A;  1PLS A;  1Q3E A;  2XTA A;  3SR2 C;  1PNM A;  3WFV A;  1IUR A;  5HFL A;  1R3J C;  1RSO B;  2JK5 C;  3BA9 A;  3CD6 V;  4O4J B;  4FLZ A;  5FNV B;  1K5Q A;  4LFC B;  4GYC B;  2RMK B;  2QDO A;  5K1X A;  5LL6 Y;  1M9N A;  1JR9 A;  1TGO A;  2R9I A;  4KAX B;  2UUB B;  3ML0 A;  2DYS B;  1Y76 A;  3T2M A;  3QIJ A;  4QIW F;  4JV5 B;  3PN1 A;  4JYY A;  3CC2 V;  3ABL B;  3G4S V;  5L3G A;  4JPR A;  1Q8I A;  3TGU H;  3F5W C;  2Z0A A;  3X2Q C;  4RAI A;  1KKD A;  1FFX A;  1NTK H;  2BSK B;  3ABM C;  4ZOL B;  5FNV A;  5FLX N;  1HR0 B;  1MPH A;  5FI0 A;  2GBO A;  1V55 B;  3ZHU A;  1MZE A;  5DHA B;  4JZG A;  2EUL A;  2Z0Q A;  3O9O A;  5B3S B;  3K5L A;  2LUL A;  5KHI A;  4JYB A;  2ZKO A;  4XWX A;  1KP3 A;  2WLI B;  3UO2 A;  1PM9 A;  4LF6 O;  1V89 A;  2OCH A;  2IU0 A;  3ASO C;  1BS3 A;  4X65 B;  4I9W A;  4CH5 A;  2DYR C;  3BCC H;  4TQD A;  4NY0 A;  3K03 A;  4LBE C;  1WVH A;  1YI2 V;  1FS0 G;  1MAB G;  5LG4 B;  2XT9 A;  1FGZ A;  5CA1 A;  3N2K B;  1GG3 A;  2CY5 A;  4JI8 O;  3CRA A;  3VBB A;  3JD0 A;  2BTQ A;  2BOB C;  2R09 A;  3JD4 A;  4WCE V;  1N36 O;  1ZL8 B;  2P22 C;  5DM6 V;  2UZR A;  5I2S A;  1XOD A;  4CHM A;  3T4D A;  4OPA A;  3SJQ C;  1AB3 A;  1TQZ A;  4DYL A;  1FXK C;  1SQG A;  2B9Z A;  4N23 A;  2B5U A;  1WJ1 A;  4QJ3 B;  2QR4 A;  2P0F A;  5L3F A;  2YSU B;  1YVW A;  2MW2 B;  2YSZ A;  1XCG A;  1PL0 A;  1V9P A;  1AJQ A;  4HNA B;  2BE3 A;  1NZ6 A;  1KBH A;  3U7D A;  1JVM A;  1YJ9 V;  1X86 A;  1Y19 B;  3SJC C;  2Y7B A;  4NB5 A;  5HFM A;  3SYX A;  1T77 A;  5BZB A;  4CZZ A;  1XHX A;  4DR2 O;  3RN4 A;  2F66 C;  1FFT B;  1P7G A;  4FFK A;  1ZC3 B;  2EJR A;  4MW8 A;  4LFB B;  2YXY A;  2LFR A;  4LCU C;  3CRC A;  3L70 H;  4JI3 B;  3NWF A;  1UPG A;  5IY5 B;  1KMI Z;  5BMV B;  1Q5O A;  1M1K W;  1E1R G;  4QE9 A;  4FLX A;  1WGU A;  4NSW A;  3PVW A;  2Y8G A;  2D9X A;  4DV5 B;  2RNB A;  1L8D A;  1A32 A;  1I08 A;  2DYS C;  1Z5W A;  4MW3 A;  1GN6 A;  2P06 A;  3DC6 A;  1M4U A;  1AI6 A;  3FB5 C;  1DK1 A;  4I50 A;  3CS5 A;  4DX9 0;  3H9V A;  2RN9 A;  4ZRK A;  3IAY A;  3SYC A;  4KFM A;  3OAA G;  2EJ8 A;  3BJI A;  4OSN A;  1NR7 A;  1IRS A;  3AK3 A;  5F2V O;  2Q67 A;  1VF7 A;  5TIS Z;  4TOI A;  1XX0 A;  3ZHR A;  4E4E A;  2G38 A;  4RO2 A;  1JQ0 A;  1P49 A;  1B55 A;  3CCL V;  2ROZ B;  1QHT A;  3HW2 B;  4PD4 F;  4MSW C;  4PDL A;  5J3Q A;  3J7A U;  4A5U B;  2DX5 A;  2F4V O;  3OGC C;  3JAR B;  1TUB A;  3E83 A;  4F6R B;  5J2T A;  2JJ1 G;  2UXD O;  1K34 A;  1VQ9 V;  1FHO A;  5IYZ B;  2E3C A;  1KD1 W;  2LP7 A;  4FVM A;  3EVK A;  3RT3 C;  1MKE A;  3M99 B;  3AG1 B;  1QQC A;  1BTN A;  4FM2 A;  4YON A;  1BHA A;  2JVD A;  2VQE O;  1BL8 A;  3ZN0 A;  2RLO A;  4GNK B;  1FD9 A;  3AG1 C;  4UB8 Z;  1ZL8 A;  5EBM C;  3JAL A;  2YVC A;  1K33 A;  1N34 O;  4I55 B;  2YF0 A;  5LMU O;  2HTH B;  4PNK A;  1JX9 A;  3DXC A;  1R6T A;  2CH7 A;  4K17 A;  2I1K A;  2YT1 A;  1D2D A;  3ZMZ A;  2RNR B;  4IHJ B;  4HAM A;  5E79 Z;  2JGD A;  3I55 V;  1ORQ C;  4HHV A;  3TFM A;  4MTG A;  2M38 A;  3A58 A;  1R6K A;  1YIJ V;  2RSG A;  3IJ4 A;  4DW0 A;  4A6F B;  5JJE B;  2DYR B;  1PP9 H;  4Y94 A;  3B4S A;  4DR3 O;  4LF7 O;  3K06 A;  4KP4 A;  4YHH B;  4GX2 A;  1FOE A;  2COD A;  2Q13 A;  1SQX H;  4TSF G;  1L0L H;  1MK7 B;  2VQF O;  1S3J A;  1H2M A;  4GT1 A;  5HE0 A;  2EIL B;  1TUB B;  4JYC A;  1YCI A;  1Y66 A;  1PNL A;  3AG4 C;  2XAG A;  2EIK C;  5E1A C;  1VQP V;  3JYC A;  3H1L H;  3SPG A;  1B06 A;  2Y69 B;  4AQY B;  1KU9 A;  1AJP A;  3RW0 A;  2ITC C;  4KHP O;  3CCV V;  2QJ1 A;  3C3T A;  3JAT B;  5LMN O;  4X1K B;  4DR5 O;  1QVG U;  1IBM B;  5JVD B;  1SKV A;  1S76 D;  2A9H A;  3L74 H;  3JAW B;  1NTM H;  4DX8 A;  4OGQ B;  5LA6 B;  2QKL A;  2E5L B;  2X6B A;  1JA8 A;  1GO3 F;  4JI4 O;  4JI4 B;  2WLL A;  3LDC A;  4JI1 B;  3SDL A;  3OTO O;  3OTO B;  2IM9 A;  2CAY A;  1PKX A;  4UV9 A;  2J0K A;  5LGT A;  2UU9 O;  2Z14 A;  4JI7 B;  3BEH A;  1UPR A;  3CCJ V;  2CTP A;  4DUY B;  3ZRX A;  4HYO A;  2ZD9 A;  1M5I A;  5B1A C;  1D5N A;  2UXN A;  2ZCE A;  2DN6 A;  3N2K A;  4P9O A;  3V5W A;  1BQ0 A;  1UJW B;  2D4Q A;  4LP8 A;  1UNP A;  4TV8 B;  2GSM B;  2CTR A;  2Y0P A;  3DCX A;  4AQY O;  4LC1 A;  3ETQ A;  1BAK A;  1GRJ A;  1SET A;  4JAU A;  2HE7 A;  3U0Z A;  2WLL B;  1XRE A;  2OCC C;  1X4T A;  5JJN B;  2DOS A;  5B1O A;  1WLE A;  4JI3 O;  1VQK V;  2IYB A;  3PG7 A;  2K2U A;  5B1B B;  1NU1 H;  4FK5 C;  2Q68 A;  1G6U A;  4WFG A;  1Q7Y W;  5FI1 A;  2GUZ A;  3A8P A;  3OR6 C;  3E2E A;  1GM7 A;  1KYO F;  3P32 A;  4DR6 O;  4MVQ A;  4NVP A;  4XDK A;  1THZ A;  4CH4 A;  2VS0 A;  3AK2 A;  2ZM6 O;  2ZM6 B;  2XAF A;  3CCU V;  3RFR A;  1OMW A;  1OCO C;  5A2Q N;  2I1J A;  5B3S C;  1WB8 A;  1J5E O;  2V76 A;  2LGQ A;  4IIJ A;  1VQO V;  2YIC A;  3IVF A;  4DUZ B;  1WG7 A;  1HNW O;  2B1G A;  1I0H A;  1QLN A;  3DC5 A;  1ZTE A;  2F95 B;  2DWD C;  3SV1 A;  1U2B A;  5LBQ A;  1JJ2 U;  1N32 B;  4NTY A;  1CEZ A;  3UCS C;  2EIM C;  3F5R A;  4W4K A;  2YS1 A;  2DN9 A;  3CJH B;  2DX1 A;  1ISN A;  1ZSQ A;  1J95 A;  3WA0 A;  4UXN A;  2IH1 C;  4GX1 A;  2UXD B;  1R1B A;  2JIZ G;  3K79 A;  4NKG B;  1Y76 B;  4X62 O;  3HKB A;  1U5G A;  4O4L B;  2WWW A;  2HFE C;  2P5O A;  2LGW A;  2IU3 A;  1NTY A;  3AEI A;  2PI4 A;  1E1Q G;  3DXD A;  3ZDT A;  2YDE A;  2FTK A;  3MDS A;  4D6W A;  2KB1 A;  2DKP A;  1HDJ A;  5I2M A;  4KVG B;  4J11 A;  4GKK O;  1U5E A;  1AR4 A;  3AG2 C;  3ASO B;  1NKD A;  4D0N B;  1IDS A;  2DW4 A;  4K3A A;  1XMO O;  3K0D A;  2OTL V;  3FYI B;  4C0A A;  3ZRV A;  3FSS A;  5EIB D;  2K9P A;  4JI2 B;  5IJ9 A;  2ROV A;  1E5W A;  4MVR A;  4IAP A;  4KHO A;  3CSX A;  1XI1 A;  2ZQM A;  1FJG B;  1IX9 A;  1CPY A;  5DIF B;  2LFS A;  1FFX B;  3TJT A;  4F7U P;  4PHZ A;  3OTF A;  2GTA A;  4AHC A;  1IVS A;  2HJD A;  1TA8 A;  2ITD C;  1FPO A;  2AZ0 A;  2HKO A;  2YUA A;  5KUK A;  3CMA V;  3P30 A;  3PSC A;  2NR5 A;  5BMV A;  5LON B;  4I0X A;  4FLV A;  2YS5 A;  3RYI A;  5BR8 O;  3OW2 U;  5GTI Z;  1Q67 A;  4DV3 O;  3C90 A;  3QBV B;  3LUT B;  2UUA B;  4DR7 B;  2CGN A;  2K00 A;  2JJ2 G;  3CCQ V;  5JCO A;  1MK9 B;  4LH6 A;  2QEX V;  4KHP B;  1H10 A;  1HNZ B;  2OYQ A;  1LB1 A;  4HNA A;  2EIK B;  1JJO A;  5JVD A;  1S5H C;  4DV7 B;  1U97 A;  2YS3 A;  2NLJ C;  1QR8 A;  4CS4 A;  2L2I A;  4ZRJ A;  5EC1 C;  1U29 A;  4YJ3 A;  1SQF A;  4J10 A;  1DDV A;  4U3J A;  3JAS B;  2NMB A;  2H8P C;  1ZWI C;  2R9A A;  2VQE B;  1GAX A;  2L35 A;  3CCM V;  4PQ0 A;  5LGU A;  4CS2 A;  1M57 C;  1SQP H;  1I5Y A;  4I7Z B;  1Y6X A;  5H6R A; 
#chains in the Genus database with same CATH homology
 4ASU G;  4G2K A;  5L3E A;  3VBB A;  2XND G;  2XAQ A;  4WFA V;  3JD0 A;  1NBM G;  1K4D C;  2V1D A;  2XOK G;  5CBF A;  2BOB C;  2MK3 A;  1M90 W;  3JD4 A;  5EC2 C;  4WCE V;  5L3B A;  5DM6 V;  3OR7 C;  3B77 A;  3JD3 A;  3E86 A;  3T4D A;  3WG7 C;  4QNH B;  1E79 G;  3SJQ C;  2EBO A;  4PDR A;  1FXK C;  3SPC A;  4N23 A;  1NQT A;  4PA6 A;  2B5U A;  1K4C C;  1M57 B;  1QR9 A;  3E8F A;  4F4L A;  5L3F A;  1YTF B;  2YSU B;  2ZXW B;  3JD2 A;  3OMA B;  2C2A A;  4XBF A;  2WLH A;  1W0J G;  3R65 A;  1PL0 A;  2B1I A;  3EHB B;  1AJQ A;  1H2G A;  4MVM A;  3ETE A;  1OCC B;  4PA4 A;  1OCZ C;  1JVM A;  3SPJ A;  4RQF A;  1YJ9 V;  4KUM A;  2HG5 C;  3CXC U;  4QPK A;  3QNE A;  4WFH A;  3TCU A;  1BHB A;  3SYA A;  2NNU A;  5HFM A;  1Q86 W;  2R9R B;  2P6J A;  4R6Z A;  4TT3 G;  5BZB A;  4CZZ A;  2ZR2 A;  2QKS A;  1OCZ B;  1N8R W;  5L3D A;  1FFT B;  3ZIA G;  5H6Q A;  1H8E G;  5B1N A;  4MVO A;  3UM7 A;  2V7Q G;  2EJR A;  4MW8 A;  2OTJ V;  3SPH A;  4LCU C;  2LFR A;  1VQL V;  1Y4M A;  2GHY A;  2H94 A;  2X6A A;  4E2L A;  5IY5 B;  1XL6 A;  1BMF G;  4YXW G;  1FXK B;  2DQ0 A;  4EKW A;  1M1K W;  1CP9 A;  2Y69 C;  3LDE A;  1E1R G;  4G28 B;  4QE9 A;  1VQ5 V;  2EZP A;  1R3I C;  3G71 V;  1VQ4 V;  3QO7 A;  3FB6 C;  2OCC B;  2IJH A;  2DYS C;  2XAS A;  1RM1 B;  4MW3 A;  3UKM A;  4Z1M G;  1RM1 C;  1QBZ A;  3FB5 C;  1AI6 A;  3ABK B;  4R8C A;  1ROP A;  4R7C A;  4I5S A;  1YTF D;  3SYC A;  4KFM A;  3OAA G;  1VQM V;  1K92 A;  3ZMV A;  1NR7 A;  1MOF A;  4FJC C;  3ETG A;  2Q67 A;  2P7T C;  1IXM A;  1DF5 A;  5EBL C;  4BIZ A;  2W6I G;  4UVB A;  3GWO A;  4RO2 A;  1JQ0 A;  1S72 V;  3CCL V;  3E89 A;  2F43 G;  4U7N A;  4MS2 A;  3ZCC A;  1MG1 A;  4MSW C;  4PDL A;  1KQS U;  5EK0 A;  3OGC C;  3OEH G;  3E83 A;  1Q81 W;  1SER A;  2JJ1 G;  1K34 A;  1YJW V;  1VQ9 V;  2IJI A;  1JOY A;  1KD1 W;  3OUS A;  2JDI G;  3OFN G;  2LP7 A;  3AG2 B;  2IJK A;  3ZN1 A;  5CA3 A;  1JPX A;  3M99 B;  1QLE C;  1HWY A;  3AG1 B;  3GB7 C;  1SRY A;  4JAS A;  1BHA A;  1V54 B;  1BL8 A;  3ZN0 A;  2EIN B;  3ASN B;  4MTO A;  1VQ8 V;  4UV8 A;  1S77 D;  1AJN A;  2Y48 A;  4RUE A;  2A0L A;  3K9A A;  5J9P C;  4BW5 A;  3AG1 C;  2HLD G;  3A0R A;  5EBM C;  1K33 A;  2WLM A;  1GM8 A;  3FB7 C;  3H01 A;  1F51 A;  4GCZ A;  3D3I A;  1JX9 A;  3CC4 V;  3RVZ A;  2X7R B;  1OCR B;  5EBW C;  5C93 A;  3ZMZ A;  4HAM A;  5IYD O;  3I55 V;  1ORQ C;  2QTO A;  3FKS G;  5KA6 A;  2QA4 V;  3F7V C;  1V55 C;  3ZMU A;  4MTG A;  4H37 A;  1R6K A;  2WLK A;  1YIJ V;  5FL7 G;  2DYR B;  2YEV A;  3K3W A;  1EFR G;  3CPW U;  1NR1 A;  1VQ7 V;  3HSA A;  3K06 A;  4KP4 A;  2ZXW C;  4GX2 A;  4MTX A;  5KA5 A;  4MVU A;  4R50 A;  4TSF G;  2P90 A;  3CME V;  1NH2 D;  3ABL C;  4X8A A;  1GKF A;  1S3J A;  4GT1 A;  1M56 C;  5KUM A;  2EIL B;  3ZMT A;  4QE7 A;  3LNM B;  2X6C A;  4JYC A;  1YIT V;  3CYO A;  1OCO B;  1R3K C;  1Y66 A;  1PNL A;  1YJN V;  3AG4 C;  5LHG A;  1GMG A;  2XAG A;  3ABM B;  2EIK C;  5E1A C;  1VQP V;  2UXX A;  2ZDI A;  3JYC A;  2Q6A A;  3STZ C;  3OEE G;  2W0F C;  4CBC A;  3SPG A;  4UVA A;  3CCR V;  3JCZ A;  3CC7 V;  2Y69 B;  3EFF K;  1AJP A;  3RW0 A;  1OZ0 A;  3VOU A;  2ITC C;  5B1B C;  3CCV V;  1KP2 A;  1W0K G;  3CP1 A;  1V54 C;  2QE7 G;  3FB8 C;  4BIU A;  3CCE V;  1QVG U;  4QJF B;  4OXS A;  1G8M A;  4H33 A;  3IFX A;  1GM9 A;  4XDL A;  1S76 D;  4G27 B;  2A9H A;  3OE7 G;  2ZR3 A;  3E35 A;  4WFB V;  4ZKI A;  1K9M W;  4P2Z A;  1JCH A;  4FPP A;  2X6B A;  3CCS V;  1GO3 F;  3W7W A;  3ABU A;  1OHH G;  2WLL A;  3LDC A;  5H6R A;  1YHQ V;  1OCR C;  3W7S A;  1AR1 B;  3G6E V;  1SZT A;  2Q69 A;  1F4M A;  2EIM B;  3AG3 C;  2HJF C;  4WFF A;  1K8A W;  3NXS A;  1PKX A;  2AHY A;  4QPJ A;  4UV9 A;  5LGT A;  5L3C A;  3BEH A;  4RQE A;  2Z3Y A;  3CCJ V;  3SPI A;  2M7W A;  2IW5 A;  3ZRX A;  4HYO A;  2ZD9 A;  4WFE A;  5B1A C;  2UXN A;  5LHI A;  1P4R A;  2XAJ A;  4P9O A;  1UJW B;  4PDM A;  2JEX A;  4MTF A;  1NH2 B;  4LP8 A;  1P7B A;  2OT5 A;  2GSM B;  3WG7 B;  3DGE A;  1KC8 W;  3DCX A;  4P9P A;  4LC1 A;  3ABK C;  5IDJ A;  4JGS A;  1R73 A;  3DTU B;  1SET A;  4JAU A;  2A79 B;  4N21 A;  4PEL A;  4RUF A;  3OMI B;  4BAY A;  3I56 V;  2WLL B;  2OCC C;  4TWK A;  4UUJ C;  5B1O A;  3MHH C;  1M56 B;  1DF4 A;  1WLE A;  5LHH A;  1VQK V;  5CMU A;  5B1B B;  3E8B A;  4FK5 C;  4JAV A;  2Q68 A;  4WFG A;  5H9C A;  1Q7Y W;  1K3E A;  3OR6 C;  3E2E A;  1GM7 A;  1ENV A;  3P32 A;  1H38 A;  4MVQ A;  1XL4 A;  2QM8 A;  4XDK A;  1AI7 A;  1THZ A;  1TUE B;  1RPR A;  2K1E A;  2XAF A;  3CCU V;  2HVJ C;  1OCO C;  3LSS A;  4Q20 A;  1K5S A;  1QCE A;  4JF3 A;  2EIJ B;  1NVP B;  1PNK A;  2WPD G;  5B3S C;  3B8M A;  3TK1 A;  3SYP A;  4GX0 A;  4MVS A;  2EIJ C;  3ZRW A;  2D3O W;  1EZJ A;  2JEU A;  1VQO V;  1KEC A;  2WLN A;  1WPX A;  2B1G A;  2WAM A;  1QLN A;  3STL C;  2DWD C;  1B6Q A;  5LBQ A;  2DQ3 A;  1JJ2 U;  4FIP C;  3E8H A;  1CEZ A;  4JTD B;  2EIM C;  3AG3 B;  2EIN C;  3ASN C;  4DXW A;  4HZ3 A;  4ZBM A;  2IJJ A;  5IYB O;  4DO2 A;  5GW7 A;  1VQ6 V;  2W6J G;  4X89 A;  1K73 W;  2YEV B;  2HVK C;  1J95 A;  1I5X A;  1RPO A;  3ZMS A;  4UXN A;  2IH1 C;  4GX1 A;  5CBH A;  3LSQ A;  1S0V A;  3K79 A;  2JIZ G;  4XDJ A;  4J9Z B;  2QM7 A;  2HR3 A;  1AI5 A;  1DLB A;  1F4N A;  1SES A;  2WWW A;  3W7U A;  2HFE C;  4GX5 A;  3MHS C;  2IU3 A;  5IYC O;  3AEI A;  3TET A;  4X88 A;  1K7D A;  2IH3 C;  1NJI W;  1F23 A;  2PI4 A;  1E1Q G;  2FTK A;  3K08 A;  3IGA C;  3OM3 B;  2KB1 A;  3F7Y C;  2WLJ A;  3ABT A;  3W7T A;  1COW G;  3ZRS A;  3SYO A;  3SYQ A;  1QLE B;  3AG2 C;  3ASO B;  1NKD A;  4L87 A;  3QO5 A;  1YSC A;  3KG2 A;  1K97 A;  3RBZ A;  1DTO A;  5CN0 A;  3OMN B;  2BOC C;  2DW4 A;  4FMT A;  4PA9 A;  4PA3 A;  1AI4 A;  1W2B U;  3HB3 B;  3OUF A;  1LNQ A;  1NVP D;  3K0D A;  2Z5U A;  3IC7 A;  1PD3 A;  2OTL V;  2XAH A;  3FYI B;  3ZRV A;  2CK3 G;  4PDV A;  2EZO A;  3ETD A;  1FXV A;  4MVR A;  1GTO A;  1PNM A;  3WFV A;  5HFL A;  1R3J C;  2ZQM A;  3PJS K;  2WSS G;  5CBG A;  1CPY A;  4J9Y B;  2JK5 C;  2LFS A;  3CD6 V;  4JTA B;  3B8N A;  2ITD C;  3T4Z A;  3QO8 A;  1K5Q A;  2HKO A;  4U7O A;  2X0L A;  5KUK A;  3P30 A;  3CMA V;  1H8H G;  3LDD A;  3JD1 A;  3W7X A;  1FXK A;  1EBO A;  3HPL C;  3T1C A;  1M9N A;  1G4Y B;  1ARO P;  2R9I A;  3D36 A;  2WLI A;  3ML0 A;  3OW2 U;  2AHZ A;  2DYS B;  3MD0 A;  3T2M A;  1GK9 A;  3AG4 B;  4QIW F;  3LUT B;  2EIL C;  3CC2 V;  3ABL B;  3G4S V;  5LGN A;  2JJ2 G;  3CCQ V;  5L3G A;  4JPR A;  3ZJZ A;  3F5W C;  5IY5 C;  2QEX V;  5B1A B;  3X2Q C;  4UVC A;  1R6N A;  4RAI A;  1KKD A;  1QVF U;  3X2Q B;  2EIK B;  3ABM C;  3ZRW B;  5DN6 G;  1S5H C;  3RVY A;  4MT8 A;  1V55 B;  4MVZ A;  4PA7 A;  2NLJ C;  1QR8 A;  5EC1 C;  5B3S B;  1L1F A;  2P67 A;  2ATK C;  2ZDI C;  4JYB A;  1KP3 A;  2WLI B;  3BY6 A;  3K04 A;  4JTC B;  2PI5 A;  1OCC C;  2IU0 A;  3ASO C;  4I9W A;  3FYE B;  2DYR C;  2H8P C;  1ZWI C;  3K03 A;  1Q82 W;  3K0G A;  4LBE C;  3CCM V;  1VQN V;  3E8G A;  5LGU A;  1MSW D;  1M57 C;  2DWE C;  1YI2 V;  1FS0 G;  1I5Y A;  1MAB G;  1R3L C;  4WF9 V;  1FXH A;  4P30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...