3B77A

Crystal structure of a ph domain containing bacterial protein (exig_2160) from exiguobacterium sibiricum 255-15 at 2.42 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
188
Chain Sequence
DIGQVIHPDDFDKAAADDYVLHEDGEKIYFLIKSKTDEYCFTNLALVHLDGESASKRVLYRYPYAHYPIRHVMFETAGTVDLDVEIKFEIGGKHYSIDVDKKQLEHVKDLYKALLAIAEKQYEGQKMLEFANSSLNHSVTILGGLRQGDMNVPQTFKDLSQESFDWLQGHYYKWNQKDFGSFYEKYIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacterial pleckstrin homology domains: a prokaryotic origin for the PH domain.
pubmed doi rcsb
source organism Exiguobacterium sibiricum
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 56
structure length 188
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11724 YvbH_ext YvbH-like oligomerisation region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3b77A02
2.30.29.50 Mainly Beta Roll PH-domain like Bacterial Pleckstrin homology domain 3b77A01
5H9CA 2MK3A 4JGSA 1DF5A 1EBOA 1JQ0A 2EZOA 4JPRA 4N21A 1F23A 1JPXA 1QCEA 1QR9A 1QBZA 4E2LA 1K34A 3HSAA 1K33A 2EZPA 3P30A 5CN0A 1SZTA 2P6JA 3CP1A 4FK5C 5HFMA 1MG1A 1ENVA 3H01A 4N23A 4G2KA 2EBOA 2X7RB 5KA5A 1DLBA 3M99B 2OT5A 1DF4A 3MHHC 2LP7A 3CYOA 5HFLA 4FIPC 3DCXA 1MOFA 5CMUA 3MHSC 1Y4MA 5KA6A 3GWOA 3B8MA 2M7WA 4FJCC 1QR8A 3WFVA 1I5XA 3B77A 4JF3A 3K9AA 3B8NA 1Y66A 1I5YA
chains in the Genus database with same CATH superfamily
1YVWA 3LUTB 3ZHRA 2FJUB 4O4IA 4Q20A 2R09A 4A6FA 4QXAB 2WA4A 2OCHA 3KSYA 4B7EA 3G67A 1M7RA 2XNDG 4LF7B 2FB5A 2EBOA 1PLSA 3K03A 3IFXA 5LXTA 2Y8GA 1DF4A 2YUAA 3OR7C 3UCSC 4X64O 1UNPA 4JV5B 2K2JA 1OCRB 5M4YB 3N2GA 4B3SB 2P8VA 1G8MA 1KZGA 5CBFA 3A8PA 1MZEA 3P7ZA 2YS3A 4DR3B 4UB8Z 3FD9A 1NTYA 1PP9H 4X1KB 2Y4UA 3OAAG 3E8FA 2JJ1G 2GBOA 4EKWA 1K5GB 3OR6C 1YDXA 1HDJA 2QKLA 1R73A 3AG7A 1K97A 1VQLV 5JVDA 4X8AA 5J3TA 1N0JA 3B40A 3RWRD 5BY1A 4J10A 1RPRA 4LC1A 1L8DA 4UVCA 5K1XA 2UXDO 2HJDA 1BWNA 2RGNB 2ATKC 1N3HA 1OV9A 1MZFA 3Q4HA 4UVAA 4NYKA 3SYAA 1COWG 2LJ2A 4IHJB 4WFGA 3SPIA 5EK0A 5EC2C 1QBZA 1K92A 3LNNA 2WLLA 4ZRKA 1HR0O 1OCRC 4MT8A 5B1AC 5HFLA 4RQEA 1SHCA 4K3AA 1PMSA 4QPJA 3APQA 1JCHA 2JEUA 1I2HA 3CC4V 4O4JB 2C2AA 1SQPH 4FFKA 2DLWA 4JI8O 3RT3C 1R1BA 1L0NH 1DF5A 1V9PA 3BY6A 4YY3O 1T5EA 4JI0B 1I08A 4FLXA 1Y19B 3HKEB 2MFQA 1NU1H 1QU7A 1MG1A 2DYRB 5LOVB 1BCCH 2H3OA 2UU9O 1KI1B 4UV9A 3DTUB 4ZIBA 5IT9N 1B06A 1PNMA 3G71V 1AI5A 4RUEA 1A32A 1LW3A 3JATB 5C5BB 4F7UP 2E74B 1FAFA 1NT2B 4NXMO 4MK0A 4WVFB 5JQGB 1GN3A 2XT9A 4P9OA 2FMLA 1B04A 2B5UA 3R66A 3S3XA 4GX2A 2YIBD 3HKBA 4MVOA 2DWEC 1Q6UA 3CCVV 3FX7A 4Z2WA 4TOIA 1I5YA 4JI2B 2QTOA 1W1HA 1QC6A 1IBLB 1WN7A 3B09A 1VQ7V 1R6NA 4DV6O 1V55B 1SQVH 4MS2A 1XHZA 3Q4HB 4YJ2B 4C7UA 2IYBA 2Q73A 3QG5A 1DLBA 5LONB 3RFRA 2DX1A 1R3LC 5FPRA 1N33B 1E79G 2H8PC 3AG3C 3M8AA 2Z59A 4XBFA 4LF4O 3WYFB 1DROA 1U97A 2X18A 4PDMA 1UPGA 1Q7YW 2RSGA 2HEPA 5KAFZ 1AR1B 3ASOC 3VOUA 4MW8A 1MIZB 2CTPA 3PZDA 4PI0A 2MKRA 2CE4A 4B3RB 4A5KA 1ZAUA 4XWXA 2Z3YA 3CYOA 1PM9A 5D3VA 1VF6C 1FHOA 3ASNB 4PQ0A 4JYBA 4PDRA 3TK1A 4B3SO 2X6AA 4BW5A 1ZUQA 1XHXA 3CRAA 4EFBA 1BS3A 3S3WA 3CIKA 2N0YA 5DECA 3ZHUA 1EN4A 1FFXA 4JI7O 2Y69B 3ABTA 4DV4B 1SQXH 3N7CA 3J7AU 5KUKA 4HHVA 1TXDA 4CH5A 2EINC 4EB6B 4MT7A 2QWOB 3B8MA 3JASA 1XNQO 3FYIB 2OTLV 4DRXA 2JGDB 2Z0PA 4EJNA 2YXHA 4DK0A 1BT8A 5D3WA 4P2ZA 4LF8O 4A5UB 3SYXA 2W2WA 1TUBA 5L3CA 3E8BA 1VMGA 2L6LA 4TWKA 2Y7BA 3SYOA 1WGUA 1OCOB 4DR5O 4WBNA 1IBKO 1ZYIA 1M4UA 2RN9A 4HBNA 1IBLO 4DO2A 2LOXA 3WA0A 1Z5VA 1LNQA 3UT5B 2I1KA 5B1BB 4HDQA 2WLJA 3ETDA 4WFAV 4QIWF 1KU9A 3OD4A 1NH2D 3NXSA 5B3SC 4XDKA 4LFBB 3SDLA 5CB4B 2OQBA 1GH6A 1H2KA 4BIUA 4K8XA 2PTMA 1YTFB 5CA3A 2DYQA 2XOKG 5AG2A 2QEXV 2UXCB 3OTFA 2NN4A 3CCLV 4NB5A 2KR0A 2FL4A 4E4EA 4ASUG 3FM8C 2F4VB 3ZMUA 5EZYB 3P6AA 3U8ZA 2LYDA 1JX9A 1O9HA 2VS0A 2UXNA 1BTKA 1YITV 2BOBC 4UCVA 2D2QA 2HVKC 2P6JA 1QVGU 4KHPB 4FK5C 2UXBO 2E2XA 4AI8A 3CXHF 4FM1A 1XMQB 2EILB 1Q8IA 5JJNB 4TUYA 3K57A 2KG7A 2D9YA 3UO2A 3RYHB 5EIBD 5LOVA 3T1HO 2HR3A 4LF9B 4D6WA 2HKOA 2R9AA 3ICXA 4OSNA 2KB1A 4I4TB 4JI5O 1NI2A 3AG4C 1H8HG 1FGYA 1KECA 1XD4A 4DW1A 4GMXB 4D7SA 3ZEDA 1N8RW 2LKOA 3CCMV 1K73W 1U5EA 2OCCB 2IM9A 5BZBA 5B5EZ 4TV9A 4UCUA 1GC7A 3MD0A 3VBBA 2YEVB 1CXZB 4B3MO 2OIEA 1NTMH 1VQPV 3VOQA 2ZQMA 2RQ6A 4KFMA 5H9CA 2EJRA 2Y0IA 5J2UB 5C79A 2YXYA 5L3BA 1SGHA 3TO1A 2MDXA 4DYLA 1E1QG 4YIPA 2ZE7A 5KX5A 3TJTA 2UUAO 4KHAA 3D8FA 3EVKA 3J81N 1UJWB 3JYCA 4WSFA 2ZKMX 3DC6A 3U7DA 3FEHA 2LGWA 3P3NA 3T1YB 1UPQA 2XAJA 3JAKA 2QSAA 3B4SA 2AZ2A 4DV2B 5KHKA 1ZL8B 3F5RA 3H1KH 4DV3B 3AG2B 5BR8B 2L2IA 3VQYA 4DXWA 1Y76B 1RM1B 3ZMSA 5JH7B 3NWAA 1MMMA 2UZSA 1YJNV 2BE3A 2OYQA 1AB3A 4J7KA 2RCVA 1UPRA 4PI2A 2LOZA 5D27A 2YIDA 4OX9B 1AJQA 3ABLC 4X1YA 1X59A 2YC0A 3ZCCA 2JIZG 3E8HA 5LYJB 5K1PA 1WA8A 4DV3O 2DYSC 2ZCEA 3LDDA 4I0XB 4GLXA 2R72A 4UCOA 3UO3A 4WFFA 1SQFA 1G1XB 1XNRB 1I5XA 2W0FC 3D8DA 2YI8A 4Z1VA 3BABA 4JAAA 2AEHA 4JPRA 3I55V 4TKNA 2P06A 4K0KB 2DJVA 1WLEA 4BWAA 3E22B 4OPHA 2UVMA 2YIBA 3E35A 4CZZA 3HR0A 3F7VC 1FYJA 2BOCC 1JFFB 4WF9V 2F93B 2D3OW 4GZUA 2XAHA 2R0DA 2H7EA 1JVMA 4JI5B 4N21A 5L3EA 2KKWA 4UB6Z 2DHJA 1SZTA 1N34O 4W4LA 3L72H 1BMFG 5L3GA 1JR9A 3QF7A 2HJFC 4WFEA 1NR1A 2BCJA 4O4HB 3IC7A 2QKSA 2BTOA 3G4SV 3TCAA 2VRWB 3CX5F 2E3CA 2XUMA 3ZN1A 1I94O 1WGQA 4EMOA 5LG4B 2Q7HA 4UXNA 3CC2V 4I55B 4IIJA 2WLHA 4GZRB 2QKMA 1HNWO 3QWMA 4DV7B 4NTYA 3I56V 4DBBA 1IBKB 3STLC 4K81A 5CMUA 3LJUX 3UKMA 4HB4B 4KL1A 4DR1B 1R6KA 2COFA 5FI0A 3K9SA 4X1YB 1Z87A 2YI9A 1QCEA 1ZC3B 2LW7A 4K35A 2RLOA 4DXAB 2COAA 4BBKA 5LGNA 4K8ZA 4WJ7A 1AJNA 3L71H 4FLZA 4EB6A 5FLXN 5KUMA 4KUMA 5D5QA 1SQQH 1KKCA 4B3TB 1X11A 3OEHG 2K49A 3OUSA 3QNEA 1GMGA 1D2DA 3BFRA 3ETQA 2P7TC 1NTZH 1ZL8A 1FJGB 2ZE8A 4F6EA 4QJ3B 2DKPA 1QR9A 1BQZA 3JAKB 2YF0A 2ZM6B 4JI6O 1OCOC 3NWDA 1WP7A 1HP8A 1O9GA 3DXRA 4HDOA 2XQNM 2G35A 2LP7A 1FXKB 4ZHQB 1GM7A 2V1DA 4DIXA 5L81A 3SJQC 5L3DA 5FI1A 4HATB 4JI7B 1ZSQA 1L1FA 1IXBA 2DE0X 4HNAA 4UVBA 1NTVA 3TXSA 2LFRA 3CE2A 3JARB 5JLJB 4GX5A 4LF4B 3ZRWA 2EINB 1YJ9V 3K06A 3JALA 1FGZA 3K3WA 4AQYO 1WPXA 1N33O 1QVFU 1FJGO 4LH7A 4HB3B 2ZXWB 2Y69C 3SPGA 4JYAB 5LHGA 3MHSC 4HAZB 2EIKB 2MW2B 2RDCA 2XTAA 4FM0A 3SJBC 2JJ2G 1WI1A 3OUFA 1X1GA 1JJ2U 2ADZA 4QNHB 1NTKH 3D36A 3ZRWB 3ASNC 5IYZA 5LL6Y 4LF6O 2VQEO 3ZHTA 4RO2A 4J9YB 3FVCA 3L73H 1U5FA 2Q0AA 1IURA 1X4TA 1QLEB 3N2KA 1BAKA 3U10A 4UCSA 2JRIA 4NXNO 2D11A 1D5NA 3TXQA 3HKCA 1OCCC 5C8YA 3C90A 5JHGA 1OY2A 2LGQA 3BINA 4QE7A 3ASOB 1UEFA 4MY6A 2GCLA 3A8QA 4FM2A 1P84F 3ML0A 4GUNA 1FHXA 3KZ1A 5IJ0B 1JPXA 3ZHVA 4DV6B 1QQGA 5IE9A 5GTHZ 4L8JA 2ADPA 1AR5A 2XAQA 5LA6A 3AG3B 5HFMA 2LULA 4DV7O 4JYCA 3ZHSA 3CRMA 4FLTA 2OIGA 5JJEB 5HE2A 3JCZA 4UUJC 4PELA 1QHTA 1DGSA 4GX1A 1M9NA 3N2KB 1DYNA 5CB4A 4DW0A 1V55C 4DV5O 1EAZA 4H44B 1XUQA 1OZ0A 3X2QC 5GTIZ 3RN4A 3ZRSA 1TAEA 2UUBB 2F23A 3SPHA 3APOA 1VQ4V 1SA0A 1R3IC 1NVPB 2AXTZ 1DDWA 1V88A 4FIPC 3IC9A 4WFBV 4LWSB 3JD2A 2M7WA 1K5QA 5BXZA 2A06H 3ZHQA 3RYFA 2GJYA 4ZOLA 1YEWA 3O65A 4HNAB 3TVVA 3U11A 4X65O 1G6UA 5LGTA 4FLUA 4CHJA 2VQFB 2R2YA 4FZ0A 5C6RA 3RYIA 1DK1A 5IJ9B 4C0AA 5HE3A 2DYRC 1M57B 3E83A 4B08A 1HNZB 4LF5O 3GVMA 1K4CC 3UZTA 3MPXA 2DA0A 4O2AA 5D3XA 2XAFA 2CH7A 4DR3O 5IYCO 1XEQA 5BMVA 3WB1A 4IAPA 3ZMVA 1MK9B 1P4RA 2ZKOA 3HSAA 4CS4A 2K9PA 3QTCA 2QTSA 3N2GB 4TV8B 3AU4A 2B1IA 2UXDB 1Q90D 3L75H 4Q6GA 3A0HZ 2IU3A 2AZ0A 2X6BA 4MTFA 2YS5A 4LF7O 5J9PC 5FNVA 3STZC 1FXVA 1IDSA 5KHGA 1SZXA 2E5LB 1NI8A 4U3JA 5DI9B 3E8GA 2DKQA 2MK3A 1EBOA 2WLMA 4OGQB 3ZN0A 5J2TB 4J80A 1PL4A 5BR8O 4DR4O 5GOWB 2JGUA 3TETA 4LCUC 2Z4DA 3CRCA 1LUVA 1GN6A 5JWPA 3LNMB 1W0JG 3GWOA 2GHYA 4KVGB 5KQ4A 4NKGB 2E76B 3B77A 3SV1A 2A0LA 4R50A 1V5PA 4IIJB 5IRSA 2EC1A 5H2FZ 4U7NA 1XKEA 1H38A 3JARA 2AGAA 3SYQA 2UUAB 4GOUA 2ZINA 4O4LA 4GCZA 4N23A 5H5NA 3RYHA 1VARA 3K5OA 1EM1A 2ZIMA 3RVYA 2HHHO 4PA3A 4LFCO 1J19A 1FS0G 4ZHQA 2QA4V 3PN1A 2J0MA 5EBMC 2A3QA 1PV0A 4MVQA 5C16A 2V76A 1VEWA 5JQGA 4J41A 1XL4A 2W6IG 2Q4PA 3H9VA 2J0KA 1V54B 4L87A 2ETNA 3VQWA 3MAQA 3JCUZ 4NVPA 1F4MA 1K33A 1US6A 2Q6AA 1OCZC 3H01A 1BQ0A 1AR4A 4TQFA 2N23A 4DX90 1IRSA 2LFSA 1TVKB 4MTGA 2P0HA 2PYJA 5HE0A 2P4VA 3JD1A 3AG1B 4FJCC 3E22A 1MSDA 1PPJH 1J5EO 1XX0A 1LUWA 3CJHB 3RYIB 2JS3A 2F1MA 4HAMA 5IYDO 1OCZB 4OPAA 4FFBB 5J2UA 1E5WA 1OQNA 3HIEA 3CHXA 2IJJA 1V54C 3LDEA 1QNMA 3M7MX 2YSUB 3CCJV 2P67A 4IYHA 2QWPB 4P7IA 4O2BA 3GYOA 1V61A 4TV9B 3ABMB 5EFXA 3MDSA 3FKSG 2JK5C 3AK2A 4NSWA 3DGEA 3GYPA 5LYJA 1BHBA 4J42A 3BPZA 4BAYA 4G28B 3EFFK 4HB2B 2D2CB 5A2QN 3ABKC 3JASB 4G2KA 3IJ4A 3SUZA 4K0KO 4DV0O 2YVCA 4BR6A 2D4QA 3IGAC 2KG7B 2X0LA 2M38A 3LDCA 2WSSG 3K5MA 3ZJZA 2DN6A 4X1KA 1DDVA 1Q81W 1B6QA 4FLWA 1BL8A 1Q86W 2QWNB 3G6BA 2CGOA 2V4DA 1EVHA 4YJ3A 2QM7A 5D5PA 4HZ3A 2YXLA 1EFRG 4X62B 1NKDA 2P90A 4FPPA 5LOPB 4TYZA 3SYPA 2HHHB 1E1RG 3HKCB 2ADQB 4X1IB 2RUKB 1SERA 3TW1A 4PDVA 3L70H 4GKKB 3QBVB 4KHOA 1FAOA 1T77A 1Y66A 5ITZB 4AILC 4O4IB 1TUEB 1S5JA 4X20A 2Y4TA 3CEIA 1XR0B 2XASA 1Y74A 3T4DA 1AI6A 1VF5B 4FZ1A 3SJCC 1Y5OA 2DTCA 4DUYB 3WG7C 3E2EA 2CUGA 2COCA 2X6CA 1P7BA 1NZ6A 4R6ZA 4OT1A 3ZDTA 2W2XC 1M57C 4LR3A 1JMKC 3D3IA 3AU5A 3PG7A 2E75B 3T1YO 4B6HA 1V89A 4W4KA 1KUQA 3OMAB 4B3RO 3FB7C 4U3JB 1TQZA 4JI4B 2GSMB 5KA5A 1VQ6V 4B7KA 3NW8A 2CTRA 4JZGA 1X1FA 4CYEA 3K5LA 1I0HA 2JP2A 1WJZA 1VQ5V 3SGIA 4MW3A 4I7ZB 2VQFO 1WB8A 5CA0A 2CODA 3TCUA 1ZSPA 2D9VA 1Y76A 2FJLA 1U96A 4J7ZA 4YJ3B 1WB7A 1SETA 3WB2A 1JQ0A 2CGNA 3QO7A 5KMGA 4LFAB 3LSQA 3DXEA 4F6RA 1ISNA 4O2AB 3F5WC 1IBMO 3SR2C 1SKVA 3BCCH 1GN2A 1BE3H 3OTOO 1HNZO 4LF5B 4ZI7B 3UQ8A 5IYBO 4QJFB 1AQCA 2ZR2A 3T2MA 4JTCB 3ULCA 3K9AA 5IJ9A 4ZRIA 5EYPA 2YS1A 5KX5B 1K4DC 4H0LB 4NY0A 4X65B 4PHZA 5L3FA 2Q13A 2AHZA 1XMQO 4G27B 2GUZA 4DV5B 2IFSA 2BSKB 3EXAA 5GONB 1LR1A 4JI1O 1H8EG 1GM8A 5TISZ 1UNQA 2DQ0A 1SRYA 2W6JG 1FOEA 4RAIA 1RSOA 1K9MW 3CSXA 4NR1A 2D9ZA 1GN4A 2WAMA 4EEQA 3JAMN 4IGGA 5A9GA 2UXCO 4PV1B 3HKDA 4LNUA 2GUZB 1QLEC 1N32B 2WPDG 5KHHA 1ZWIC 4FFBA 2UUBO 1DBHA 4J9ZB 3W7SA 1MPHA 1RSOB 2EIMB 2CTQA 3BJIA 1WVHA 4YY3B 2M14A 4JASA 1M56C 3CS5A 3OM3B 3HKBB 4JI8B 3PVLA 2ZXWC 3T4ZA 3W7UA 2W0XA 2JS5A 4BW9A 3G6EV 4LF6B 3VQXA 1ROPA 2UUCB 3KRWA 3JD4A 3KCYA 3F7YC 1HR0B 4HAXB 3D36C 1Q6IA 3ZMTA 2AHYA 3ZRVA 3KRXA 2EJ8A 2YIAA 4Y94A 4ABMA 4LP8A 4JAVA 4HAWB 1PNLA 1AP5A 1W2BU 3PSCA 2ZPYA 2I5FA 3K58A 2GCJA 3RCPA 3DC5A 3H1JH 5LGUA 4NXNB 4YIOA 1ZC4B 1N36O 2G38A 1XI1A 5KHJA 3C3SA 3AJ4A 2VQEB 5DIFB 2RRFA 2VWJA 2Z13A 3CCRV 3CXCU 3KZIZ 2IBZH 4QE9A 1IXMA 3AG1C 1JJOA 3L9DA 4JYAO 2HFEC 1WJMA 2FKXA 3U12A 4JI6B 1JOYA 2EIJC 3CRQA 2A7WA 4OXSA 4I9WA 1SESA 1TUBB 2YRYA 1W59A 2EJ7A 1F23A 2BTQA 5LP6C 3ULBA 1S76D 5DN6G 1WA8B 4F7GA 4DUYO 3CC7V 3OANA 3OMIB 5B1NA 3FB5C 4HAUB 2GS0A 4GN1A 2RMKB 2JGDA 2HP8A 1I7FA 5I2MA 1AWEA 4JI3O 1FFTB 1M93A 1Y4MA 1RRPB 1N36B 1S5LZ 5JVDB 4ICGA 2PI5A 1BHAA 1XMOB 2ZR3A 3IVFA 3OW2U 2ZM6O 2PZSA 4FLVA 1MNGA 1X05A 1FFXB 3SNHA 1S72V 3AK1A 2ZT9B 4X62O 1YIJV 4DR2B 3P30A 1P5TA 2CH7B 3CP1A 1H2LA 4UCRA 1KP3A 1L0LH 1PD3A 2YS8A 1MIXA 1WG7A 2K2UA 4CH3A 3HB3B 3OT7A 2Z0OA 1Q43A 2B9ZA 2DWDC 1ORQC 2IJKA 2Z0AA 2F95B 3K5NA 1QLNA 2ROVA 1KZ7A 5FPOA 2CRFA 2KCJA 1I94B 4A6FB 1XODA 2RNRB 5EBWC 4RWUA 5CLQB 3HKDB 4LNUB 4ZOLB 2XHBA 5IDJA 2VSZA 1K7DA 2KIEA 4PA6A 2WLLB 4NXMB 3J80N 3ETGA 1W1GA 2QJ1A 4PA9A 1Q3EA 1SC5B 4IHJA 2HG5C 4DUZB 5GONA 4CH4A 4DR6B 1EGXA 4JAUA 3ZX6A 4RQFA 4D7TA 1I7AA 1XCGA 2UU9B 5GW7A 3EHBB 3RBZA 4CC6A 2P0DA 5IWAO 3M99B 4YHHB 1UNRA 2QDOA 4D6TH 1XOUA 5B66Z 3P32A 5FL7G 1AJPA 3W7TA 4TUYB 2PF4E 2QKAA 4KHBB 3D8EA 2R9RB 3QIJA 5IY5C 2W2XD 2A79B 1YHQV 1N34B 4HAYB 5LA6B 3H1LH 3RVZA 3OTOB 5LMNO 1Q6HA 5LP6A 3THOA 2HTHB 1WPBA 4LBEC 1JA8A 2Q8VA 2ELBA 2ROZB 1XNRO 2P4KA 3ZVRA 1R3KC 3D8CA 2LQTA 2Z5UA 3SJAC 2OT5A 2Z0QA 2Q68A 3RYCB 3AEIA 4CSQA 4F6RB 1GM9A 1F4NA 4D0NB 4H37A 3AK3A 3HQCA 4X88A 2PGGA 3A58A 5CBHA 4F4LA 3A0RA 1GO3F 1U29A 2EULA 1HNXO 2BTQB 1EF1A 2RJZA 3X2QB 3AG2C 4R8CA 2ITCC 1XDCA 1VF7A 3UT5A 2ZDIC 1NQTA 4YXWG 2Q7EA 3H1IH 4KXRA 2DHKA 4PA7A 2Y0PA 1KKDA 2IJIA 1PKXA 3A98B 4HYOA 4KAXB 3M1IB 2YT0A 4JGSA 5DHFB 5DHAB 3JD0A 5EC1C 3BEHA 4DV2O 1BTNA 1P3RA 4I5SA 4DR4B 2PI4A 1VQOV 4CH6A 4DR7O 1M56B 2O57A 3T06A 3OEEG 3OGCC 2EIMC 2E5LO 5JH7A 1LB1A 4IT5A 2ZE6A 3FAVA 3IAYA 2OCCC 2YICA 1HNXB 4U7OA 4MTXA 1THZA 1M5IA 3BHPA 2GDSA 5ITZA 4ZKIA 3QO8A 2LG1A 1GAXA 3E86A 1PFJA 3K79A 4X1IA 4GXBA 5LHIA 3RYCA 4NTXA 2NBVA 4JTAB 1NR7A 4U3FH 3KY9A 4TV8A 3LSSA 2Z14A 3SPJA 4MVMA 5LXTB 4QPKA 2PZ1A 2EILC 1P6SA 4YL8A 3FFQA 4H33A 5CLLB 1BZKA 4FMTA 1BSMA 3GWKC 1Q82W 3T1HB 4TSFG 2JDIG 3FYEB 2CY4A 4IYIA 2IH3C 1IX9A 3L74H 4MSWC 1RPOA 1FXKC 1P49A 4O2BB 5KA6A 4MVZA 2QWRB 3PP2A 3JSLA 2GTAA 4KHPO 3NR7A 1XREA 3DXCA 3R65A 1V5UA 5C93A 4YJ2A 2WLIB 1VQ9V 3ZRXA 2ODMA 5CA1B 2Y8FA 2ZE5A 4DUZO 1K34A 1DDMA 2KIGA 2HLDG 5B1BC 2ARHA 4GKJO 2DW4A 3SO6A 3F0WA 1V5MA 4NTWA 2ZIOA 4EFEA 1AROP 2BSKA 2WA3A 4YHHO 4LFBO 5IWAB 1AILA 3OGIB 1EN5A 1MAIA 1J5EB 2KUPA 1VQNV 3ZIAG 5IY5B 1CP9A 1MSWD 1AP6A 1YXBA 1NS1A 2WWWA 3PJSK 5EYPB 3BAAA 2F4VO 5IJ0A 4DR6O 2N04A 5B1OA 1U2BA 1S0VA 2ELAA 3N27A 4O4HA 2CY5A 5CA0B 2VKIA 3CRRA 3K08A 2L35A 3ODXA 1NJIW 5KLVH 3WG7B 1JFFA 2RNBA 3QO5A 3ODWA 4GPTB 4DK1A 4K17A 5EIBC 4P30A 4PNKA 3B8NA 1U5GA 1K5SA 2CAZC 5DEDA 2QM4A 2EZOA 3G9WA 2Q69A 3DXDA 4YONA 5KCVA 1S5HC 2ITDC 5CN0A 1XMOO 4I50A 2KSDA 4LH6A 2A9HA 4DV1O 4O4JA 1GTOA 1XBLA 1OJHA 1P7GA 1H2SB 4KP4A 2JEXA 4WBNB 4DV4O 1KC8W 3CD6V 2ILMA 2CTWA 3CWBH 2WLNA 3KCXA 2EMSA 4PD4F 1R3JC 3H1HH 5IYZB 2DQ3A 4I0XA 5DH9B 4DR2O 1VQKV 1KBHA 5LBQA 4ZBMA 1RP3B 4H13B 4X66O 1ZVRA 3K0DA 2VWKA 4X20B 1UFIA 4P9PA 2V7QG 1XNQB 5FNVB 1TA8A 3G80A 2DYNA 4EKUA 4JI3B 1M90W 3CB2A 1CEZA 3HW2B 3NSUA 4UV8A 1Y74B 1PL0A 2ZD9A 5EBLC 1SF9A 1DTOA 2LW1A 2K8EA 2RVBB 1ZLZA 1KMIZ 2EZPA 2ZDIA 4A6HA 2HE7A 1WAZA 3F5TA 3P3PA 1KD1W 4X66B 3ABMC 5KAIZ 2I5CA 2AL6A 1MA1A 3I5DA 3ZBHA 4TQDA 1QR8A 2IW5A 2ZNIA 2OTJV 2J59M 3JD3A 5LP6B 1VP7A 2GUMA 1K8AW 1AI4A 4L1RA 4PA4A 4B3TO 5BMVB 2DYSB 3JSNA 2EIJB 3OFNG 3PVWA 3V5WA 3D3QA 4KHBA 3W7WA 3A0BZ 4GX0A 3ABLB 4DV1B 1F7YA 3ETEA 2NLJC 2P5OA 1VIBA 3QVNA 4L6EA 4DR1O 1RM1C 1BGYH 3OE7G 4Z2NA 1YCIA 5I2SA 1EZJA 2HVJC 4X89A 2B1GA 2M6YA 2WLIA 4RUFA 4CS2A 2R9IA 2Q0OC 4I55A 2H7DA 5JHHA 3ML4A 1XQ8A 2UUCO 1YI2V 3X23A 2NNUA 4A6KA 4LWSA 4JI2O 5JP4A 1HNWB 2JVDA 3KKYA 1YTFD 2KGXB 1VF6A 1ZTEA 2J0JA 3KG2A 3PVUA 3RGBA 1GC6A 2NZ8B 1GK9A 3O9OA 5B1AB 1J0WA 1FPOA 2QKCA 2BCCH 1GKFA 1R6TA 3O96A 3FSSA 1SS3A 3CJHA 4GKJB 3HK0A 1N32O 1ZM0A 3E89A 3MDBC 2Q67A 1FXHA 3FB6C 4GNKB 2YSZA 4ZI7A 1X86A 1M7EA 3ZMZA 3BA8A 1TVKA 1OHHG 2QE7G 5DM6V 3T1CA 2Y48A 1D5AA 4IOYX 2DOSA 4WCEV 1NVPD 2OWOA 2P0FA 3WU2Z 4JI1B 2DX5A 4BIZA 1K3EA 4MVSA 3CCEV 3AG4B 3CCSV 5HE1A 1VQMV 4ZRJA 3PEGA 4JI0O 4F7HA 2QM8A 2K00A 5D3YA 3SPCA 5C8YB 4I9QA 4GMVA 2X7RB 2H94A 1YSCA 2UXXA 2KUQA 1XILA 1NBMG 4X9QA 2F66C 4JZ2A 1S77D 1RFYA 1IBMB 2P22C 1W0KG 3WB0A 1TGOA 1IVSA 4LFAO 3W7XA 3U0ZA 1SQGA 4MVUA 2AW9A 4UFZA 2DFKA 4AQYB 3CXBB 4HAVB 2LO1A 2N74A 1ZX3A 3CMAV 3K04A 4JV5O 4DRXB 3CPWU 2QR4A 4GYCB 2GTSA 2KQXA 4J7JA 1WJ1A 2XAGA 1W1DA 5CBGA 1H2GA 3DCXA 1H2MA 3C3TA 1SQBH 1FD9A 3JALB 3VQVA 4OX9O 1Y67A 3ODOA 4CHMA 2K1EA 2IJHA 4I50B 2N05A 5J2TA 4PJ0Z 2GV9A 4FLYA 4JI4O 3CCUV 2D9XA 4XDJA 4DX8A 5B3SB 2D9WA 2MWNB 1U5DA 4DR7B 3GB7C 4PDLA 4GKKO 1Z5WA 3B2EE 3HPLC 1M1KW 3MHHC 2CK3G 4GT1A 1WP8A 3BRCA 1MOFA 4QGPA 2Q7GA 4X64B 3WFVA 3OMNB 1G4YB 1F51A 3DSQA 2FTKA 1GRJA 4Z1MG 1XL6A 1HWYA 2D10A 3FB8C 2PUSA 5JJJB 1EN6A 4R7CA 2UZRA 1KYOF 3CMEV 1H4RA 3RYFB 2FYUH 4DV0B 1PNKA 2YEVA 2EMTA 1FHWA 1S3JA 1FKAO 4B3MB 1NH2B 2QWQB 3TGUH 5CA1A 3LSUA 2L1CA 1AVMA 4UCTA 2NR5A 5JCOC 4CBCA 1B55A 5LMUB 2PYLA 5J3QA 5F2VO 1HW7A 1Q5OA 4Z2MB 3A8TA 1OCCB 5LMNB 2WLKA 1H2NA 1SA0B 2DN9A 2PY5A 4IFSA 2Q9LA 4BIOA 2F43G 4LF9O 4JF3A 2CDYA 3VIAA 4IL6Z 4I4TA 4JYYA 1QQCA 4QJ4B 4K2PA 2IU0A 1KP2A 4H8SA 2YT1A 1WNSA 5EZYA 1RJ2A 2UXBB 4JTDB 4HB0B 4K2OA 3JATA 1MK7B 1FB8A 3JAWA 2EIKC 1YJWV 3ZS8C 3UM7A 3ABKB 1URFA 2QGNA 3K0GA 4FVMA 4MTOA 1EZVH 4CS3A 4HSIA 4AHCA 4CC5A 3BA9A 2VRZA 3JAWB 3CCQV 3TFMA 5LHHA 4MVRA 4XDLA 4TT3G 1B3QA 2YDEA 5E79Z 5KMGB 1MABG 2YT2A 1MI1A 2I1JA 5JCOA 3HKEA 5C5BA 4J11A 2EX3A 1Y6XA 4E2LA 3FAVB 2NMBA 1Z2GA 2OTXA 5KQ1A 1H10A 1VQ8V 1N4CA 4LFCB 5J3YA 1KB9F 1TJ6A 3ABUA 1CPYA 2CAYA 4O4LB 3OHMB 3A2FA 1Q67A 3SYCA 1KQSU 5H6RA 4DR5B 5LMUO 1OMWA 1J95A 3NWFA 5H6QA 1YZBA 1AI7A 1ENVA 1MKEA 4WFHA 4LF8B 3BVOA 1IZ3A 5KHIA 2DMXA 2R70A 1NU2A 1YF2A 2Q5ZA 4QJ5B 3K59A 1FXKA 5E1AC 1K5DB 2DHIA 1N0NA 3RW0A 3DXRB 2ZNJA 1GG3A 2IH1C 1U27A
chains in the Genus database with same CATH topology
3LUTB 2WLIB 1VQ9V 4N21A 3ZRXA 2XASA 4Q20A 5L3EA 1K34A 3T4DA 1SZTA 2XNDG 1AI6A 2HLDG 5B1BC 1BMFG 2EBOA 3WG7C 5L3GA 3K03A 3IFXA 3E2EA 2DW4A 1DF4A 2HJFC 3OR7C 4WFEA 1NR1A 2X6CA 1P7BA 3IC7A 1OCRB 2QKSA 4R6ZA 3G4SV 1AROP 1G8MA 1M57C 5CBFA 3D3IA 3ZN1A 1VQNV 3ZIAG 5IY5B 1CP9A 4UXNA 3CC2V 1MSWD 2WWWA 3PJSK 2WLHA 3OAAG 3E8FA 3OMAB 3FB7C 2JJ1G 5B1OA 4EKWA 3OR6C 1S0VA 3I56V 2GSMB 5KA5A 1R73A 1VQ6V 1K97A 3STLC 1VQLV 3K08A 4X8AA 1NJIW 5CMUA 3WG7B 1RPRA 3QO5A 4LC1A 3UKMA 1VQ5V 4MW3A 4P30A 4UVCA 3B8NA 1K5SA 3TCUA 2ATKC 1R6KA 1SETA 4UVAA 1JQ0A 3SYAA 2EZOA 1COWG 3QO7A 1QCEA 2Q69A 3SPIA 4WFGA 5EK0A 5EC2C 1QBZA 1S5HC 2ITDC 5CN0A 1K92A 3LSQA 5LGNA 1AJNA 2A9HA 3F5WC 2WLLA 1GTOA 1OCRC 4MT8A 5B1AC 4KP4A 2JEXA 5HFLA 4KUMA 5KUMA 4RQEA 4QPJA 5IYBO 4QJFB 2ZR2A 3OEHG 3T2MA 1KC8W 4JTCB 3CD6V 1JCHA 2JEUA 3K9AA 2WLNA 3CC4V 3OUSA 2C2AA 1R3JC 3QNEA 1GMGA 2DQ3A 2P7TC 1K4DC 1DF5A 1VQKV 3BY6A 5LBQA 1QR9A 4ZBMA 5L3FA 2AHZA 4G27B 3K0DA 1OCOC 1MG1A 2DYRB 4P9PA 1H8EG 1GM8A 2V7QG 2DQ0A 2W6JG 1SRYA 1FXKB 2LP7A 4UV9A 3DTUB 4RAIA 1GM7A 2V1DA 1M90W 1K9MW 1PNMA 1CEZA 3G71V 1AI5A 3SJQC 4RUEA 5L3DA 2WAMA 4UV8A 1L1FA 1PL0A 4UVBA 2ZD9A 5EBLC 1QLEC 1DTOA 2WPDG 2LFRA 1ZWIC 4GX5A 2EZPA 2ZDIA 4J9ZB 4P9OA 3ZRWA 3W7SA 2EINB 1YJ9V 3K06A 2B5UA 1KD1W 3ABMC 2EIMB 4GX2A 3K3WA 1WPXA 4JASA 1QVFU 2ZXWB 2Y69C 4MVOA 3SPGA 5LHGA 1M56C 3MHSC 2EIKB 2DWEC 3CCVV 3OM3B 1QR8A 2IW5A 2OTJV 2JJ2G 3JD3A 2ZXWC 3OUFA 3T4ZA 3W7UA 1I5YA 1JJ2U 2QTOA 1K8AW 1AI4A 4PA4A 3G6EV 4QNHB 1ROPA 2DYSB 3D36A 2EIJB 3ASNC 3OFNG 1R6NA 3JD4A 3ZRWB 1VQ7V 3F7YC 1V55B 3ZMTA 2AHYA 4RO2A 4GX0A 4J9YB 4MS2A 3ZRVA 3W7WA 3ABLB 4LP8A 1QLEB 4JAVA 1PNLA 3ETEA 2NLJC 1DLBA 1W2BU 1R3LC 1E79G 2H8PC 3AG3C 1OCCC 1RM1C 5LGUA 3OE7G 4QE7A 3ASOB 4XBFA 1EZJA 4PDMA 3ML0A 2HVJC 4X89A 1Q7YW 2B1GA 2WLIA 1AR1B 3ASOC 1JPXA 4RUFA 2R9IA 3VOUA 4MW8A 2XAQA 3AG3B 3CCRV 1YI2V 5HFMA 3CXCU 2NNUA 4JYCA 4QE9A 1IXMA 2Z3YA 3AG1C 1YTFD 3CYOA 3JCZA 3KG2A 4PELA 4UUJC 2HFEC 4GX1A 1M9NA 1GK9A 1V55C 1JOYA 5B1AB 2EIJC 3ASNB 4OXSA 4JYBA 1OZ0A 4PDRA 3TK1A 4I9WA 1SESA 3X2QC 2X6AA 4BW5A 1GKFA 3ZRSA 1F23A 1S76D 5DN6G 3SPHA 3CC7V 3OMIB 3E89A 5B1NA 1VQ4V 3FB5C 2Q67A 1FXHA 2Y69B 3FB6C 3ABTA 3ZMZA 1R3IC 1NVPB 2QE7G 1OHHG 5DM6V 5KUKA 4FIPC 3T1CA 2Y48A 1FFTB 2EINC 1Y4MA 4WFBV 3JD2A 3B8MA 2M7WA 1K5QA 4WCEV 1NVPD 3FYIB 2OTLV 2PI5A 1BHAA 2ZR3A 4BIZA 1K3EA 4MVSA 3OW2U 3CCEV 3AG4B 3CCSV 1VQMV 1S72V 4P2ZA 5LGTA 1YIJV 3P30A 2QM8A 3CP1A 3SPCA 1KP3A 5L3CA 3E8BA 2X7RB 2H94A 1PD3A 1YSCA 2UXXA 4TWKA 3HB3B 2DYRC 1M57B 3E83A 3SYOA 1OCOB 1NBMG 1ORQC 2DWDC 2IJKA 1S77D 1K4CC 4DO2A 1W0KG 1LNQA 1QLNA 2XAFA 5B1BB 5IYCO 2WLJA 3ETDA 4WFAV 4QIWF 3W7XA 4MVUA 1NH2D 3NXSA 3ZMVA 5EBWC 1P4RA 5B3SC 3HSAA 4XDKA 2B1IA 3CMAV 3K04A 4BIUA 3CPWU 5IDJA 2IU3A 1K7DA 1YTFB 2X6BA 5CA3A 4PA6A 2WLLB 2XAGA 2XOKG 1H2GA 4MTFA 5CBGA 3DCXA 2QEXV 3ETGA 5J9PC 2K1EA 2IJHA 4PA9A 3STZC 1FXVA 3CCLV 2HG5C 3CCUV 4XDJA 5B3SB 4ASUG 3E8GA 4JAUA 2MK3A 3ZMUA 4RQFA 1EBOA 1JX9A 2WLMA 2UXNA 1YITV 2BOBC 3ZN0A 5GW7A 3GB7C 2HVKC 2P6JA 4PDLA 3EHBB 1QVGU 4FK5C 3RBZA 3HPLC 3TETA 4LCUC 3M99B 1M1KW 2EILB 3MHHC 2CK3G 4GT1A 1MOFA 3P32A 5FL7G 3LNMB 1AJPA 1W0JG 3GWOA 2GHYA 3W7TA 3WFVA 3OMNB 3B77A 2HR3A 2A0LA 1G4YB 4R50A 2R9RB 1F51A 5IY5C 2A79B 1YHQV 2HKOA 4U7NA 3RVZA 1H38A 2FTKA 4Z1MG 1HWYA 1XL6A 3FB8C 2KB1A 3SYQA 4LBEC 3AG4C 1H8HG 1KECA 4R7CA 4GCZA 4N23A 3CMEV 1R3KC 1N8RW 3CCMV 2Z5UA 1K73W 2OT5A 2OCCB 1PNKA 2Q68A 2YEVA 5BZBA 3RVYA 3AEIA 1S3JA 4PA3A 3MD0A 1FS0G 2YEVB 3VBBA 2QA4V 1GM9A 1F4NA 5EBMC 4MVQA 1NH2B 4H37A 1VQPV 2ZQMA 4KFMA 4X88A 1XL4A 2W6IG 5H9CA 2EJRA 5CBHA 4F4LA 3A0RA 1V54B 1GO3F 4L87A 5L3BA 1F4MA 1K33A 1E1QG 3X2QB 3AG2C 4CBCA 4R8CA 2ITCC 2Q6AA 1OCZC 2ZDIC 3H01A 1NQTA 1OCCB 4YXWG 1UJWB 2WLKA 3JYCA 2LFSA 4MTGA 4PA7A 1KKDA 3JD1A 3AG1B 2F43G 2IJIA 4FJCC 1PKXA 4HYOA 4JF3A 2XAJA 4HAMA 5IYDO 4JGSA 2IU0A 1OCZB 3JD0A 5EC1C 1KP2A 3BEHA 3AG2B 4I5SA 2IJJA 2PI4A 1V54C 3LDEA 4JTDB 4DXWA 1VQOV 2EIKC 1RM1B 1YJWV 1M56B 2YSUB 3ZMSA 3CCJV 2P67A 3OEEG 3OGCC 3UM7A 3ABKB 2EIMC 3ABMB 4MTOA 3K0GA 1YJNV 3FKSG 2JK5C 3CCQV 2OCCC 3DGEA 5LHHA 4MVRA 4U7OA 4XDLA 4TT3G 1AJQA 1BHBA 3ABLC 4BAYA 4G28B 1MABG 3ZCCA 2JIZG 3E8HA 4MTXA 1THZA 3EFFK 2DYSC 4E2LA 4ZKIA 3QO8A 3LDDA 3ABKC 3E86A 3K79A 1VQ8V 4WFFA 5LHIA 4G2KA 4JTAB 1NR7A 3ABUA 1CPYA 3IGAC 3LSSA 2X0LA 1I5XA 2W0FC 3LDCA 2WSSG 4MVMA 3SPJA 4QPKA 3ZJZA 2EILC 3SYCA 1KQSU 4H33A 5H6RA 1Q81W 1B6QA 4JPRA 4FMTA 3I55V 1BL8A 1J95A 1Q86W 5H6QA 1Q82W 1AI7A 1WLEA 2QM7A 4HZ3A 1ENVA 4TSFG 2JDIG 3FYEB 1EFRG 4WFHA 3E35A 4CZZA 3F7VC 1NKDA 2IH3C 2P90A 2BOCC 4FPPA 4MSWC 3SYPA 1RPOA 1E1RG 1FXKC 5KA6A 4MVZA 1SERA 1FXKA 4PDVA 5E1AC 4WF9V 1Y66A 3RW0A 2IH1C 2D3OW 3R65A 2XAHA 1TUEB 1JVMA 5C93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H9C A;  2MK3 A;  4JGS A;  1DF5 A;  1EBO A;  1JQ0 A;  2EZO A;  4JPR A;  4N21 A;  1F23 A;  1JPX A;  1QCE A;  1QR9 A;  1QBZ A;  4E2L A;  1K34 A;  3HSA A;  1K33 A;  2EZP A;  3P30 A;  5CN0 A;  1SZT A;  2P6J A;  3CP1 A;  4FK5 C;  5HFM A;  1MG1 A;  1ENV A;  3H01 A;  4N23 A;  4G2K A;  2EBO A;  2X7R B;  5KA5 A;  1DLB A;  3M99 B;  2OT5 A;  1DF4 A;  3MHH C;  2LP7 A;  3CYO A;  5HFL A;  4FIP C;  3DCX A;  1MOF A;  5CMU A;  3MHS C;  1Y4M A;  5KA6 A;  3GWO A;  3B8M A;  2M7W A;  4FJC C;  1QR8 A;  3WFV A;  1I5X A;  3B77 A;  4JF3 A;  3K9A A;  3B8N A;  1Y66 A;  1I5Y A; 
#chains in the Genus database with same CATH topology
 1YVW A;  3LUT B;  3ZHR A;  2FJU B;  4O4I A;  4Q20 A;  2R09 A;  4A6F A;  4QXA B;  2WA4 A;  2OCH A;  3KSY A;  4B7E A;  3G67 A;  1M7R A;  2XND G;  4LF7 B;  2FB5 A;  2EBO A;  1PLS A;  3K03 A;  3IFX A;  5LXT A;  2Y8G A;  1DF4 A;  2YUA A;  3OR7 C;  3UCS C;  4X64 O;  1UNP A;  4JV5 B;  2K2J A;  1OCR B;  5M4Y B;  3N2G A;  4B3S B;  2P8V A;  1G8M A;  1KZG A;  5CBF A;  3A8P A;  1MZE A;  3P7Z A;  2YS3 A;  4DR3 B;  4UB8 Z;  3FD9 A;  1NTY A;  1PP9 H;  4X1K B;  2Y4U A;  3OAA G;  3E8F A;  2JJ1 G;  2GBO A;  4EKW A;  1K5G B;  3OR6 C;  1YDX A;  1HDJ A;  2QKL A;  1R73 A;  3AG7 A;  1K97 A;  1VQL V;  5JVD A;  4X8A A;  5J3T A;  1N0J A;  3B40 A;  3RWR D;  5BY1 A;  4J10 A;  1RPR A;  4LC1 A;  1L8D A;  4UVC A;  5K1X A;  2UXD O;  2HJD A;  1BWN A;  2RGN B;  2ATK C;  1N3H A;  1OV9 A;  1MZF A;  3Q4H A;  4UVA A;  4NYK A;  3SYA A;  1COW G;  2LJ2 A;  4IHJ B;  4WFG A;  3SPI A;  5EK0 A;  5EC2 C;  1QBZ A;  1K92 A;  3LNN A;  2WLL A;  4ZRK A;  1HR0 O;  1OCR C;  4MT8 A;  5B1A C;  5HFL A;  4RQE A;  1SHC A;  4K3A A;  1PMS A;  4QPJ A;  3APQ A;  1JCH A;  2JEU A;  1I2H A;  3CC4 V;  4O4J B;  2C2A A;  1SQP H;  4FFK A;  2DLW A;  4JI8 O;  3RT3 C;  1R1B A;  1L0N H;  1DF5 A;  1V9P A;  3BY6 A;  4YY3 O;  1T5E A;  4JI0 B;  1I08 A;  4FLX A;  1Y19 B;  3HKE B;  2MFQ A;  1NU1 H;  1QU7 A;  1MG1 A;  2DYR B;  5LOV B;  1BCC H;  2H3O A;  2UU9 O;  1KI1 B;  4UV9 A;  3DTU B;  4ZIB A;  5IT9 N;  1B06 A;  1PNM A;  3G71 V;  1AI5 A;  4RUE A;  1A32 A;  1LW3 A;  3JAT B;  5C5B B;  4F7U P;  2E74 B;  1FAF A;  1NT2 B;  4NXM O;  4MK0 A;  4WVF B;  5JQG B;  1GN3 A;  2XT9 A;  4P9O A;  2FML A;  1B04 A;  2B5U A;  3R66 A;  3S3X A;  4GX2 A;  2YIB D;  3HKB A;  4MVO A;  2DWE C;  1Q6U A;  3CCV V;  3FX7 A;  4Z2W A;  4TOI A;  1I5Y A;  4JI2 B;  2QTO A;  1W1H A;  1QC6 A;  1IBL B;  1WN7 A;  3B09 A;  1VQ7 V;  1R6N A;  4DV6 O;  1V55 B;  1SQV H;  4MS2 A;  1XHZ A;  3Q4H B;  4YJ2 B;  4C7U A;  2IYB A;  2Q73 A;  3QG5 A;  1DLB A;  5LON B;  3RFR A;  2DX1 A;  1R3L C;  5FPR A;  1N33 B;  1E79 G;  2H8P C;  3AG3 C;  3M8A A;  2Z59 A;  4XBF A;  4LF4 O;  3WYF B;  1DRO A;  1U97 A;  2X18 A;  4PDM A;  1UPG A;  1Q7Y W;  2RSG A;  2HEP A;  5KAF Z;  1AR1 B;  3ASO C;  3VOU A;  4MW8 A;  1MIZ B;  2CTP A;  3PZD A;  4PI0 A;  2MKR A;  2CE4 A;  4B3R B;  4A5K A;  1ZAU A;  4XWX A;  2Z3Y A;  3CYO A;  1PM9 A;  5D3V A;  1VF6 C;  1FHO A;  3ASN B;  4PQ0 A;  4JYB A;  4PDR A;  3TK1 A;  4B3S O;  2X6A A;  4BW5 A;  1ZUQ A;  1XHX A;  3CRA A;  4EFB A;  1BS3 A;  3S3W A;  3CIK A;  2N0Y A;  5DEC A;  3ZHU A;  1EN4 A;  1FFX A;  4JI7 O;  2Y69 B;  3ABT A;  4DV4 B;  1SQX H;  3N7C A;  3J7A U;  5KUK A;  4HHV A;  1TXD A;  4CH5 A;  2EIN C;  4EB6 B;  4MT7 A;  2QWO B;  3B8M A;  3JAS A;  1XNQ O;  3FYI B;  2OTL V;  4DRX A;  2JGD B;  2Z0P A;  4EJN A;  2YXH A;  4DK0 A;  1BT8 A;  5D3W A;  4P2Z A;  4LF8 O;  4A5U B;  3SYX A;  2W2W A;  1TUB A;  5L3C A;  3E8B A;  1VMG A;  2L6L A;  4TWK A;  2Y7B A;  3SYO A;  1WGU A;  1OCO B;  4DR5 O;  4WBN A;  1IBK O;  1ZYI A;  1M4U A;  2RN9 A;  4HBN A;  1IBL O;  4DO2 A;  2LOX A;  3WA0 A;  1Z5V A;  1LNQ A;  3UT5 B;  2I1K A;  5B1B B;  4HDQ A;  2WLJ A;  3ETD A;  4WFA V;  4QIW F;  1KU9 A;  3OD4 A;  1NH2 D;  3NXS A;  5B3S C;  4XDK A;  4LFB B;  3SDL A;  5CB4 B;  2OQB A;  1GH6 A;  1H2K A;  4BIU A;  4K8X A;  2PTM A;  1YTF B;  5CA3 A;  2DYQ A;  2XOK G;  5AG2 A;  2QEX V;  2UXC B;  3OTF A;  2NN4 A;  3CCL V;  4NB5 A;  2KR0 A;  2FL4 A;  4E4E A;  4ASU G;  3FM8 C;  2F4V B;  3ZMU A;  5EZY B;  3P6A A;  3U8Z A;  2LYD A;  1JX9 A;  1O9H A;  2VS0 A;  2UXN A;  1BTK A;  1YIT V;  2BOB C;  4UCV A;  2D2Q A;  2HVK C;  2P6J A;  1QVG U;  4KHP B;  4FK5 C;  2UXB O;  2E2X A;  4AI8 A;  3CXH F;  4FM1 A;  1XMQ B;  2EIL B;  1Q8I A;  5JJN B;  4TUY A;  3K57 A;  2KG7 A;  2D9Y A;  3UO2 A;  3RYH B;  5EIB D;  5LOV A;  3T1H O;  2HR3 A;  4LF9 B;  4D6W A;  2HKO A;  2R9A A;  3ICX A;  4OSN A;  2KB1 A;  4I4T B;  4JI5 O;  1NI2 A;  3AG4 C;  1H8H G;  1FGY A;  1KEC A;  1XD4 A;  4DW1 A;  4GMX B;  4D7S A;  3ZED A;  1N8R W;  2LKO A;  3CCM V;  1K73 W;  1U5E A;  2OCC B;  2IM9 A;  5BZB A;  5B5E Z;  4TV9 A;  4UCU A;  1GC7 A;  3MD0 A;  3VBB A;  2YEV B;  1CXZ B;  4B3M O;  2OIE A;  1NTM H;  1VQP V;  3VOQ A;  2ZQM A;  2RQ6 A;  4KFM A;  5H9C A;  2EJR A;  2Y0I A;  5J2U B;  5C79 A;  2YXY A;  5L3B A;  1SGH A;  3TO1 A;  2MDX A;  4DYL A;  1E1Q G;  4YIP A;  2ZE7 A;  5KX5 A;  3TJT A;  2UUA O;  4KHA A;  3D8F A;  3EVK A;  3J81 N;  1UJW B;  3JYC A;  4WSF A;  2ZKM X;  3DC6 A;  3U7D A;  3FEH A;  2LGW A;  3P3N A;  3T1Y B;  1UPQ A;  2XAJ A;  3JAK A;  2QSA A;  3B4S A;  2AZ2 A;  4DV2 B;  5KHK A;  1ZL8 B;  3F5R A;  3H1K H;  4DV3 B;  3AG2 B;  5BR8 B;  2L2I A;  3VQY A;  4DXW A;  1Y76 B;  1RM1 B;  3ZMS A;  5JH7 B;  3NWA A;  1MMM A;  2UZS A;  1YJN V;  2BE3 A;  2OYQ A;  1AB3 A;  4J7K A;  2RCV A;  1UPR A;  4PI2 A;  2LOZ A;  5D27 A;  2YID A;  4OX9 B;  1AJQ A;  3ABL C;  4X1Y A;  1X59 A;  2YC0 A;  3ZCC A;  2JIZ G;  3E8H A;  5LYJ B;  5K1P A;  1WA8 A;  4DV3 O;  2DYS C;  2ZCE A;  3LDD A;  4I0X B;  4GLX A;  2R72 A;  4UCO A;  3UO3 A;  4WFF A;  1SQF A;  1G1X B;  1XNR B;  1I5X A;  2W0F C;  3D8D A;  2YI8 A;  4Z1V A;  3BAB A;  4JAA A;  2AEH A;  4JPR A;  3I55 V;  4TKN A;  2P06 A;  4K0K B;  2DJV A;  1WLE A;  4BWA A;  3E22 B;  4OPH A;  2UVM A;  2YIB A;  3E35 A;  4CZZ A;  3HR0 A;  3F7V C;  1FYJ A;  2BOC C;  1JFF B;  4WF9 V;  2F93 B;  2D3O W;  4GZU A;  2XAH A;  2R0D A;  2H7E A;  1JVM A;  4JI5 B;  4N21 A;  5L3E A;  2KKW A;  4UB6 Z;  2DHJ A;  1SZT A;  1N34 O;  4W4L A;  3L72 H;  1BMF G;  5L3G A;  1JR9 A;  3QF7 A;  2HJF C;  4WFE A;  1NR1 A;  2BCJ A;  4O4H B;  3IC7 A;  2QKS A;  2BTO A;  3G4S V;  3TCA A;  2VRW B;  3CX5 F;  2E3C A;  2XUM A;  3ZN1 A;  1I94 O;  1WGQ A;  4EMO A;  5LG4 B;  2Q7H A;  4UXN A;  3CC2 V;  4I55 B;  4IIJ A;  2WLH A;  4GZR B;  2QKM A;  1HNW O;  3QWM A;  4DV7 B;  4NTY A;  3I56 V;  4DBB A;  1IBK B;  3STL C;  4K81 A;  5CMU A;  3LJU X;  3UKM A;  4HB4 B;  4KL1 A;  4DR1 B;  1R6K A;  2COF A;  5FI0 A;  3K9S A;  4X1Y B;  1Z87 A;  2YI9 A;  1QCE A;  1ZC3 B;  2LW7 A;  4K35 A;  2RLO A;  4DXA B;  2COA A;  4BBK A;  5LGN A;  4K8Z A;  4WJ7 A;  1AJN A;  3L71 H;  4FLZ A;  4EB6 A;  5FLX N;  5KUM A;  4KUM A;  5D5Q A;  1SQQ H;  1KKC A;  4B3T B;  1X11 A;  3OEH G;  2K49 A;  3OUS A;  3QNE A;  1GMG A;  1D2D A;  3BFR A;  3ETQ A;  2P7T C;  1NTZ H;  1ZL8 A;  1FJG B;  2ZE8 A;  4F6E A;  4QJ3 B;  2DKP A;  1QR9 A;  1BQZ A;  3JAK B;  2YF0 A;  2ZM6 B;  4JI6 O;  1OCO C;  3NWD A;  1WP7 A;  1HP8 A;  1O9G A;  3DXR A;  4HDO A;  2XQN M;  2G35 A;  2LP7 A;  1FXK B;  4ZHQ B;  1GM7 A;  2V1D A;  4DIX A;  5L81 A;  3SJQ C;  5L3D A;  5FI1 A;  4HAT B;  4JI7 B;  1ZSQ A;  1L1F A;  1IXB A;  2DE0 X;  4HNA A;  4UVB A;  1NTV A;  3TXS A;  2LFR A;  3CE2 A;  3JAR B;  5JLJ B;  4GX5 A;  4LF4 B;  3ZRW A;  2EIN B;  1YJ9 V;  3K06 A;  3JAL A;  1FGZ A;  3K3W A;  4AQY O;  1WPX A;  1N33 O;  1QVF U;  1FJG O;  4LH7 A;  4HB3 B;  2ZXW B;  2Y69 C;  3SPG A;  4JYA B;  5LHG A;  3MHS C;  4HAZ B;  2EIK B;  2MW2 B;  2RDC A;  2XTA A;  4FM0 A;  3SJB C;  2JJ2 G;  1WI1 A;  3OUF A;  1X1G A;  1JJ2 U;  2ADZ A;  4QNH B;  1NTK H;  3D36 A;  3ZRW B;  3ASN C;  5IYZ A;  5LL6 Y;  4LF6 O;  2VQE O;  3ZHT A;  4RO2 A;  4J9Y B;  3FVC A;  3L73 H;  1U5F A;  2Q0A A;  1IUR A;  1X4T A;  1QLE B;  3N2K A;  1BAK A;  3U10 A;  4UCS A;  2JRI A;  4NXN O;  2D11 A;  1D5N A;  3TXQ A;  3HKC A;  1OCC C;  5C8Y A;  3C90 A;  5JHG A;  1OY2 A;  2LGQ A;  3BIN A;  4QE7 A;  3ASO B;  1UEF A;  4MY6 A;  2GCL A;  3A8Q A;  4FM2 A;  1P84 F;  3ML0 A;  4GUN A;  1FHX A;  3KZ1 A;  5IJ0 B;  1JPX A;  3ZHV A;  4DV6 B;  1QQG A;  5IE9 A;  5GTH Z;  4L8J A;  2ADP A;  1AR5 A;  2XAQ A;  5LA6 A;  3AG3 B;  5HFM A;  2LUL A;  4DV7 O;  4JYC A;  3ZHS A;  3CRM A;  4FLT A;  2OIG A;  5JJE B;  5HE2 A;  3JCZ A;  4UUJ C;  4PEL A;  1QHT A;  1DGS A;  4GX1 A;  1M9N A;  3N2K B;  1DYN A;  5CB4 A;  4DW0 A;  1V55 C;  4DV5 O;  1EAZ A;  4H44 B;  1XUQ A;  1OZ0 A;  3X2Q C;  5GTI Z;  3RN4 A;  3ZRS A;  1TAE A;  2UUB B;  2F23 A;  3SPH A;  3APO A;  1VQ4 V;  1SA0 A;  1R3I C;  1NVP B;  2AXT Z;  1DDW A;  1V88 A;  4FIP C;  3IC9 A;  4WFB V;  4LWS B;  3JD2 A;  2M7W A;  1K5Q A;  5BXZ A;  2A06 H;  3ZHQ A;  3RYF A;  2GJY A;  4ZOL A;  1YEW A;  3O65 A;  4HNA B;  3TVV A;  3U11 A;  4X65 O;  1G6U A;  5LGT A;  4FLU A;  4CHJ A;  2VQF B;  2R2Y A;  4FZ0 A;  5C6R A;  3RYI A;  1DK1 A;  5IJ9 B;  4C0A A;  5HE3 A;  2DYR C;  1M57 B;  3E83 A;  4B08 A;  1HNZ B;  4LF5 O;  3GVM A;  1K4C C;  3UZT A;  3MPX A;  2DA0 A;  4O2A A;  5D3X A;  2XAF A;  2CH7 A;  4DR3 O;  5IYC O;  1XEQ A;  5BMV A;  3WB1 A;  4IAP A;  3ZMV A;  1MK9 B;  1P4R A;  2ZKO A;  3HSA A;  4CS4 A;  2K9P A;  3QTC A;  2QTS A;  3N2G B;  4TV8 B;  3AU4 A;  2B1I A;  2UXD B;  1Q90 D;  3L75 H;  4Q6G A;  3A0H Z;  2IU3 A;  2AZ0 A;  2X6B A;  4MTF A;  2YS5 A;  4LF7 O;  5J9P C;  5FNV A;  3STZ C;  1FXV A;  1IDS A;  5KHG A;  1SZX A;  2E5L B;  1NI8 A;  4U3J A;  5DI9 B;  3E8G A;  2DKQ A;  2MK3 A;  1EBO A;  2WLM A;  4OGQ B;  3ZN0 A;  5J2T B;  4J80 A;  1PL4 A;  5BR8 O;  4DR4 O;  5GOW B;  2JGU A;  3TET A;  4LCU C;  2Z4D A;  3CRC A;  1LUV A;  1GN6 A;  5JWP A;  3LNM B;  1W0J G;  3GWO A;  2GHY A;  4KVG B;  5KQ4 A;  4NKG B;  2E76 B;  3B77 A;  3SV1 A;  2A0L A;  4R50 A;  1V5P A;  4IIJ B;  5IRS A;  2EC1 A;  5H2F Z;  4U7N A;  1XKE A;  1H38 A;  3JAR A;  2AGA A;  3SYQ A;  2UUA B;  4GOU A;  2ZIN A;  4O4L A;  4GCZ A;  4N23 A;  5H5N A;  3RYH A;  1VAR A;  3K5O A;  1EM1 A;  2ZIM A;  3RVY A;  2HHH O;  4PA3 A;  4LFC O;  1J19 A;  1FS0 G;  4ZHQ A;  2QA4 V;  3PN1 A;  2J0M A;  5EBM C;  2A3Q A;  1PV0 A;  4MVQ A;  5C16 A;  2V76 A;  1VEW A;  5JQG A;  4J41 A;  1XL4 A;  2W6I G;  2Q4P A;  3H9V A;  2J0K A;  1V54 B;  4L87 A;  2ETN A;  3VQW A;  3MAQ A;  3JCU Z;  4NVP A;  1F4M A;  1K33 A;  1US6 A;  2Q6A A;  1OCZ C;  3H01 A;  1BQ0 A;  1AR4 A;  4TQF A;  2N23 A;  4DX9 0;  1IRS A;  2LFS A;  1TVK B;  4MTG A;  2P0H A;  2PYJ A;  5HE0 A;  2P4V A;  3JD1 A;  3AG1 B;  4FJC C;  3E22 A;  1MSD A;  1PPJ H;  1J5E O;  1XX0 A;  1LUW A;  3CJH B;  3RYI B;  2JS3 A;  2F1M A;  4HAM A;  5IYD O;  1OCZ B;  4OPA A;  4FFB B;  5J2U A;  1E5W A;  1OQN A;  3HIE A;  3CHX A;  2IJJ A;  1V54 C;  3LDE A;  1QNM A;  3M7M X;  2YSU B;  3CCJ V;  2P67 A;  4IYH A;  2QWP B;  4P7I A;  4O2B A;  3GYO A;  1V61 A;  4TV9 B;  3ABM B;  5EFX A;  3MDS A;  3FKS G;  2JK5 C;  3AK2 A;  4NSW A;  3DGE A;  3GYP A;  5LYJ A;  1BHB A;  4J42 A;  3BPZ A;  4BAY A;  4G28 B;  3EFF K;  4HB2 B;  2D2C B;  5A2Q N;  3ABK C;  3JAS B;  4G2K A;  3IJ4 A;  3SUZ A;  4K0K O;  4DV0 O;  2YVC A;  4BR6 A;  2D4Q A;  3IGA C;  2KG7 B;  2X0L A;  2M38 A;  3LDC A;  2WSS G;  3K5M A;  3ZJZ A;  2DN6 A;  4X1K A;  1DDV A;  1Q81 W;  1B6Q A;  4FLW A;  1BL8 A;  1Q86 W;  2QWN B;  3G6B A;  2CGO A;  2V4D A;  1EVH A;  4YJ3 A;  2QM7 A;  5D5P A;  4HZ3 A;  2YXL A;  1EFR G;  4X62 B;  1NKD A;  2P90 A;  4FPP A;  5LOP B;  4TYZ A;  3SYP A;  2HHH B;  1E1R G;  3HKC B;  2ADQ B;  4X1I B;  2RUK B;  1SER A;  3TW1 A;  4PDV A;  3L70 H;  4GKK B;  3QBV B;  4KHO A;  1FAO A;  1T77 A;  1Y66 A;  5ITZ B;  4AIL C;  4O4I B;  1TUE B;  1S5J A;  4X20 A;  2Y4T A;  3CEI A;  1XR0 B;  2XAS A;  1Y74 A;  3T4D A;  1AI6 A;  1VF5 B;  4FZ1 A;  3SJC C;  1Y5O A;  2DTC A;  4DUY B;  3WG7 C;  3E2E A;  2CUG A;  2COC A;  2X6C A;  1P7B A;  1NZ6 A;  4R6Z A;  4OT1 A;  3ZDT A;  2W2X C;  1M57 C;  4LR3 A;  1JMK C;  3D3I A;  3AU5 A;  3PG7 A;  2E75 B;  3T1Y O;  4B6H A;  1V89 A;  4W4K A;  1KUQ A;  3OMA B;  4B3R O;  3FB7 C;  4U3J B;  1TQZ A;  4JI4 B;  2GSM B;  5KA5 A;  1VQ6 V;  4B7K A;  3NW8 A;  2CTR A;  4JZG A;  1X1F A;  4CYE A;  3K5L A;  1I0H A;  2JP2 A;  1WJZ A;  1VQ5 V;  3SGI A;  4MW3 A;  4I7Z B;  2VQF O;  1WB8 A;  5CA0 A;  2COD A;  3TCU A;  1ZSP A;  2D9V A;  1Y76 A;  2FJL A;  1U96 A;  4J7Z A;  4YJ3 B;  1WB7 A;  1SET A;  3WB2 A;  1JQ0 A;  2CGN A;  3QO7 A;  5KMG A;  4LFA B;  3LSQ A;  3DXE A;  4F6R A;  1ISN A;  4O2A B;  3F5W C;  1IBM O;  3SR2 C;  1SKV A;  3BCC H;  1GN2 A;  1BE3 H;  3OTO O;  1HNZ O;  4LF5 B;  4ZI7 B;  3UQ8 A;  5IYB O;  4QJF B;  1AQC A;  2ZR2 A;  3T2M A;  4JTC B;  3ULC A;  3K9A A;  5IJ9 A;  4ZRI A;  5EYP A;  2YS1 A;  5KX5 B;  1K4D C;  4H0L B;  4NY0 A;  4X65 B;  4PHZ A;  5L3F A;  2Q13 A;  2AHZ A;  1XMQ O;  4G27 B;  2GUZ A;  4DV5 B;  2IFS A;  2BSK B;  3EXA A;  5GON B;  1LR1 A;  4JI1 O;  1H8E G;  1GM8 A;  5TIS Z;  1UNQ A;  2DQ0 A;  1SRY A;  2W6J G;  1FOE A;  4RAI A;  1RSO A;  1K9M W;  3CSX A;  4NR1 A;  2D9Z A;  1GN4 A;  2WAM A;  4EEQ A;  3JAM N;  4IGG A;  5A9G A;  2UXC O;  4PV1 B;  3HKD A;  4LNU A;  2GUZ B;  1QLE C;  1N32 B;  2WPD G;  5KHH A;  1ZWI C;  4FFB A;  2UUB O;  1DBH A;  4J9Z B;  3W7S A;  1MPH A;  1RSO B;  2EIM B;  2CTQ A;  3BJI A;  1WVH A;  4YY3 B;  2M14 A;  4JAS A;  1M56 C;  3CS5 A;  3OM3 B;  3HKB B;  4JI8 B;  3PVL A;  2ZXW C;  3T4Z A;  3W7U A;  2W0X A;  2JS5 A;  4BW9 A;  3G6E V;  4LF6 B;  3VQX A;  1ROP A;  2UUC B;  3KRW A;  3JD4 A;  3KCY A;  3F7Y C;  1HR0 B;  4HAX B;  3D36 C;  1Q6I A;  3ZMT A;  2AHY A;  3ZRV A;  3KRX A;  2EJ8 A;  2YIA A;  4Y94 A;  4ABM A;  4LP8 A;  4JAV A;  4HAW B;  1PNL A;  1AP5 A;  1W2B U;  3PSC A;  2ZPY A;  2I5F A;  3K58 A;  2GCJ A;  3RCP A;  3DC5 A;  3H1J H;  5LGU A;  4NXN B;  4YIO A;  1ZC4 B;  1N36 O;  2G38 A;  1XI1 A;  5KHJ A;  3C3S A;  3AJ4 A;  2VQE B;  5DIF B;  2RRF A;  2VWJ A;  2Z13 A;  3CCR V;  3CXC U;  3KZI Z;  2IBZ H;  4QE9 A;  1IXM A;  3AG1 C;  1JJO A;  3L9D A;  4JYA O;  2HFE C;  1WJM A;  2FKX A;  3U12 A;  4JI6 B;  1JOY A;  2EIJ C;  3CRQ A;  2A7W A;  4OXS A;  4I9W A;  1SES A;  1TUB B;  2YRY A;  1W59 A;  2EJ7 A;  1F23 A;  2BTQ A;  5LP6 C;  3ULB A;  1S76 D;  5DN6 G;  1WA8 B;  4F7G A;  4DUY O;  3CC7 V;  3OAN A;  3OMI B;  5B1N A;  3FB5 C;  4HAU B;  2GS0 A;  4GN1 A;  2RMK B;  2JGD A;  2HP8 A;  1I7F A;  5I2M A;  1AWE A;  4JI3 O;  1FFT B;  1M93 A;  1Y4M A;  1RRP B;  1N36 B;  1S5L Z;  5JVD B;  4ICG A;  2PI5 A;  1BHA A;  1XMO B;  2ZR3 A;  3IVF A;  3OW2 U;  2ZM6 O;  2PZS A;  4FLV A;  1MNG A;  1X05 A;  1FFX B;  3SNH A;  1S72 V;  3AK1 A;  2ZT9 B;  4X62 O;  1YIJ V;  4DR2 B;  3P30 A;  1P5T A;  2CH7 B;  3CP1 A;  1H2L A;  4UCR A;  1KP3 A;  1L0L H;  1PD3 A;  2YS8 A;  1MIX A;  1WG7 A;  2K2U A;  4CH3 A;  3HB3 B;  3OT7 A;  2Z0O A;  1Q43 A;  2B9Z A;  2DWD C;  1ORQ C;  2IJK A;  2Z0A A;  2F95 B;  3K5N A;  1QLN A;  2ROV A;  1KZ7 A;  5FPO A;  2CRF A;  2KCJ A;  1I94 B;  4A6F B;  1XOD A;  2RNR B;  5EBW C;  4RWU A;  5CLQ B;  3HKD B;  4LNU B;  4ZOL B;  2XHB A;  5IDJ A;  2VSZ A;  1K7D A;  2KIE A;  4PA6 A;  2WLL B;  4NXM B;  3J80 N;  3ETG A;  1W1G A;  2QJ1 A;  4PA9 A;  1Q3E A;  1SC5 B;  4IHJ A;  2HG5 C;  4DUZ B;  5GON A;  4CH4 A;  4DR6 B;  1EGX A;  4JAU A;  3ZX6 A;  4RQF A;  4D7T A;  1I7A A;  1XCG A;  2UU9 B;  5GW7 A;  3EHB B;  3RBZ A;  4CC6 A;  2P0D A;  5IWA O;  3M99 B;  4YHH B;  1UNR A;  2QDO A;  4D6T H;  1XOU A;  5B66 Z;  3P32 A;  5FL7 G;  1AJP A;  3W7T A;  4TUY B;  2PF4 E;  2QKA A;  4KHB B;  3D8E A;  2R9R B;  3QIJ A;  5IY5 C;  2W2X D;  2A79 B;  1YHQ V;  1N34 B;  4HAY B;  5LA6 B;  3H1L H;  3RVZ A;  3OTO B;  5LMN O;  1Q6H A;  5LP6 A;  3THO A;  2HTH B;  1WPB A;  4LBE C;  1JA8 A;  2Q8V A;  2ELB A;  2ROZ B;  1XNR O;  2P4K A;  3ZVR A;  1R3K C;  3D8C A;  2LQT A;  2Z5U A;  3SJA C;  2OT5 A;  2Z0Q A;  2Q68 A;  3RYC B;  3AEI A;  4CSQ A;  4F6R B;  1GM9 A;  1F4N A;  4D0N B;  4H37 A;  3AK3 A;  3HQC A;  4X88 A;  2PGG A;  3A58 A;  5CBH A;  4F4L A;  3A0R A;  1GO3 F;  1U29 A;  2EUL A;  1HNX O;  2BTQ B;  1EF1 A;  2RJZ A;  3X2Q B;  3AG2 C;  4R8C A;  2ITC C;  1XDC A;  1VF7 A;  3UT5 A;  2ZDI C;  1NQT A;  4YXW G;  2Q7E A;  3H1I H;  4KXR A;  2DHK A;  4PA7 A;  2Y0P A;  1KKD A;  2IJI A;  1PKX A;  3A98 B;  4HYO A;  4KAX B;  3M1I B;  2YT0 A;  4JGS A;  5DHF B;  5DHA B;  3JD0 A;  5EC1 C;  3BEH A;  4DV2 O;  1BTN A;  1P3R A;  4I5S A;  4DR4 B;  2PI4 A;  1VQO V;  4CH6 A;  4DR7 O;  1M56 B;  2O57 A;  3T06 A;  3OEE G;  3OGC C;  2EIM C;  2E5L O;  5JH7 A;  1LB1 A;  4IT5 A;  2ZE6 A;  3FAV A;  3IAY A;  2OCC C;  2YIC A;  1HNX B;  4U7O A;  4MTX A;  1THZ A;  1M5I A;  3BHP A;  2GDS A;  5ITZ A;  4ZKI A;  3QO8 A;  2LG1 A;  1GAX A;  3E86 A;  1PFJ A;  3K79 A;  4X1I A;  4GXB A;  5LHI A;  3RYC A;  4NTX A;  2NBV A;  4JTA B;  1NR7 A;  4U3F H;  3KY9 A;  4TV8 A;  3LSS A;  2Z14 A;  3SPJ A;  4MVM A;  5LXT B;  4QPK A;  2PZ1 A;  2EIL C;  1P6S A;  4YL8 A;  3FFQ A;  4H33 A;  5CLL B;  1BZK A;  4FMT A;  1BSM A;  3GWK C;  1Q82 W;  3T1H B;  4TSF G;  2JDI G;  3FYE B;  2CY4 A;  4IYI A;  2IH3 C;  1IX9 A;  3L74 H;  4MSW C;  1RPO A;  1FXK C;  1P49 A;  4O2B B;  5KA6 A;  4MVZ A;  2QWR B;  3PP2 A;  3JSL A;  2GTA A;  4KHP O;  3NR7 A;  1XRE A;  3DXC A;  3R65 A;  1V5U A;  5C93 A;  4YJ2 A;  2WLI B;  1VQ9 V;  3ZRX A;  2ODM A;  5CA1 B;  2Y8F A;  2ZE5 A;  4DUZ O;  1K34 A;  1DDM A;  2KIG A;  2HLD G;  5B1B C;  2ARH A;  4GKJ O;  2DW4 A;  3SO6 A;  3F0W A;  1V5M A;  4NTW A;  2ZIO A;  4EFE A;  1ARO P;  2BSK A;  2WA3 A;  4YHH O;  4LFB O;  5IWA B;  1AIL A;  3OGI B;  1EN5 A;  1MAI A;  1J5E B;  2KUP A;  1VQN V;  3ZIA G;  5IY5 B;  1CP9 A;  1MSW D;  1AP6 A;  1YXB A;  1NS1 A;  2WWW A;  3PJS K;  5EYP B;  3BAA A;  2F4V O;  5IJ0 A;  4DR6 O;  2N04 A;  5B1O A;  1U2B A;  1S0V A;  2ELA A;  3N27 A;  4O4H A;  2CY5 A;  5CA0 B;  2VKI A;  3CRR A;  3K08 A;  2L35 A;  3ODX A;  1NJI W;  5KLV H;  3WG7 B;  1JFF A;  2RNB A;  3QO5 A;  3ODW A;  4GPT B;  4DK1 A;  4K17 A;  5EIB C;  4P30 A;  4PNK A;  3B8N A;  1U5G A;  1K5S A;  2CAZ C;  5DED A;  2QM4 A;  2EZO A;  3G9W A;  2Q69 A;  3DXD A;  4YON A;  5KCV A;  1S5H C;  2ITD C;  5CN0 A;  1XMO O;  4I50 A;  2KSD A;  4LH6 A;  2A9H A;  4DV1 O;  4O4J A;  1GTO A;  1XBL A;  1OJH A;  1P7G A;  1H2S B;  4KP4 A;  2JEX A;  4WBN B;  4DV4 O;  1KC8 W;  3CD6 V;  2ILM A;  2CTW A;  3CWB H;  2WLN A;  3KCX A;  2EMS A;  4PD4 F;  1R3J C;  3H1H H;  5IYZ B;  2DQ3 A;  4I0X A;  5DH9 B;  4DR2 O;  1VQK V;  1KBH A;  5LBQ A;  4ZBM A;  1RP3 B;  4H13 B;  4X66 O;  1ZVR A;  3K0D A;  2VWK A;  4X20 B;  1UFI A;  4P9P A;  2V7Q G;  1XNQ B;  5FNV B;  1TA8 A;  3G80 A;  2DYN A;  4EKU A;  4JI3 B;  1M90 W;  3CB2 A;  1CEZ A;  3HW2 B;  3NSU A;  4UV8 A;  1Y74 B;  1PL0 A;  2ZD9 A;  5EBL C;  1SF9 A;  1DTO A;  2LW1 A;  2K8E A;  2RVB B;  1ZLZ A;  1KMI Z;  2EZP A;  2ZDI A;  4A6H A;  2HE7 A;  1WAZ A;  3F5T A;  3P3P A;  1KD1 W;  4X66 B;  3ABM C;  5KAI Z;  2I5C A;  2AL6 A;  1MA1 A;  3I5D A;  3ZBH A;  4TQD A;  1QR8 A;  2IW5 A;  2ZNI A;  2OTJ V;  2J59 M;  3JD3 A;  5LP6 B;  1VP7 A;  2GUM A;  1K8A W;  1AI4 A;  4L1R A;  4PA4 A;  4B3T O;  5BMV B;  2DYS B;  3JSN A;  2EIJ B;  3OFN G;  3PVW A;  3V5W A;  3D3Q A;  4KHB A;  3W7W A;  3A0B Z;  4GX0 A;  3ABL B;  4DV1 B;  1F7Y A;  3ETE A;  2NLJ C;  2P5O A;  1VIB A;  3QVN A;  4L6E A;  4DR1 O;  1RM1 C;  1BGY H;  3OE7 G;  4Z2N A;  1YCI A;  5I2S A;  1EZJ A;  2HVJ C;  4X89 A;  2B1G A;  2M6Y A;  2WLI A;  4RUF A;  4CS2 A;  2R9I A;  2Q0O C;  4I55 A;  2H7D A;  5JHH A;  3ML4 A;  1XQ8 A;  2UUC O;  1YI2 V;  3X23 A;  2NNU A;  4A6K A;  4LWS A;  4JI2 O;  5JP4 A;  1HNW B;  2JVD A;  3KKY A;  1YTF D;  2KGX B;  1VF6 A;  1ZTE A;  2J0J A;  3KG2 A;  3PVU A;  3RGB A;  1GC6 A;  2NZ8 B;  1GK9 A;  3O9O A;  5B1A B;  1J0W A;  1FPO A;  2QKC A;  2BCC H;  1GKF A;  1R6T A;  3O96 A;  3FSS A;  1SS3 A;  3CJH A;  4GKJ B;  3HK0 A;  1N32 O;  1ZM0 A;  3E89 A;  3MDB C;  2Q67 A;  1FXH A;  3FB6 C;  4GNK B;  2YSZ A;  4ZI7 A;  1X86 A;  1M7E A;  3ZMZ A;  3BA8 A;  1TVK A;  1OHH G;  2QE7 G;  5DM6 V;  3T1C A;  2Y48 A;  1D5A A;  4IOY X;  2DOS A;  4WCE V;  1NVP D;  2OWO A;  2P0F A;  3WU2 Z;  4JI1 B;  2DX5 A;  4BIZ A;  1K3E A;  4MVS A;  3CCE V;  3AG4 B;  3CCS V;  5HE1 A;  1VQM V;  4ZRJ A;  3PEG A;  4JI0 O;  4F7H A;  2QM8 A;  2K00 A;  5D3Y A;  3SPC A;  5C8Y B;  4I9Q A;  4GMV A;  2X7R B;  2H94 A;  1YSC A;  2UXX A;  2KUQ A;  1XIL A;  1NBM G;  4X9Q A;  2F66 C;  4JZ2 A;  1S77 D;  1RFY A;  1IBM B;  2P22 C;  1W0K G;  3WB0 A;  1TGO A;  1IVS A;  4LFA O;  3W7X A;  3U0Z A;  1SQG A;  4MVU A;  2AW9 A;  4UFZ A;  2DFK A;  4AQY B;  3CXB B;  4HAV B;  2LO1 A;  2N74 A;  1ZX3 A;  3CMA V;  3K04 A;  4JV5 O;  4DRX B;  3CPW U;  2QR4 A;  4GYC B;  2GTS A;  2KQX A;  4J7J A;  1WJ1 A;  2XAG A;  1W1D A;  5CBG A;  1H2G A;  3DCX A;  1H2M A;  3C3T A;  1SQB H;  1FD9 A;  3JAL B;  3VQV A;  4OX9 O;  1Y67 A;  3ODO A;  4CHM A;  2K1E A;  2IJH A;  4I50 B;  2N05 A;  5J2T A;  4PJ0 Z;  2GV9 A;  4FLY A;  4JI4 O;  3CCU V;  2D9X A;  4XDJ A;  4DX8 A;  5B3S B;  2D9W A;  2MWN B;  1U5D A;  4DR7 B;  3GB7 C;  4PDL A;  4GKK O;  1Z5W A;  3B2E E;  3HPL C;  1M1K W;  3MHH C;  2CK3 G;  4GT1 A;  1WP8 A;  3BRC A;  1MOF A;  4QGP A;  2Q7G A;  4X64 B;  3WFV A;  3OMN B;  1G4Y B;  1F51 A;  3DSQ A;  2FTK A;  1GRJ A;  4Z1M G;  1XL6 A;  1HWY A;  2D10 A;  3FB8 C;  2PUS A;  5JJJ B;  1EN6 A;  4R7C A;  2UZR A;  1KYO F;  3CME V;  1H4R A;  3RYF B;  2FYU H;  4DV0 B;  1PNK A;  2YEV A;  2EMT A;  1FHW A;  1S3J A;  1FKA O;  4B3M B;  1NH2 B;  2QWQ B;  3TGU H;  5CA1 A;  3LSU A;  2L1C A;  1AVM A;  4UCT A;  2NR5 A;  5JCO C;  4CBC A;  1B55 A;  5LMU B;  2PYL A;  5J3Q A;  5F2V O;  1HW7 A;  1Q5O A;  4Z2M B;  3A8T A;  1OCC B;  5LMN B;  2WLK A;  1H2N A;  1SA0 B;  2DN9 A;  2PY5 A;  4IFS A;  2Q9L A;  4BIO A;  2F43 G;  4LF9 O;  4JF3 A;  2CDY A;  3VIA A;  4IL6 Z;  4I4T A;  4JYY A;  1QQC A;  4QJ4 B;  4K2P A;  2IU0 A;  1KP2 A;  4H8S A;  2YT1 A;  1WNS A;  5EZY A;  1RJ2 A;  2UXB B;  4JTD B;  4HB0 B;  4K2O A;  3JAT A;  1MK7 B;  1FB8 A;  3JAW A;  2EIK C;  1YJW V;  3ZS8 C;  3UM7 A;  3ABK B;  1URF A;  2QGN A;  3K0G A;  4FVM A;  4MTO A;  1EZV H;  4CS3 A;  4HSI A;  4AHC A;  4CC5 A;  3BA9 A;  2VRZ A;  3JAW B;  3CCQ V;  3TFM A;  5LHH A;  4MVR A;  4XDL A;  4TT3 G;  1B3Q A;  2YDE A;  5E79 Z;  5KMG B;  1MAB G;  2YT2 A;  1MI1 A;  2I1J A;  5JCO A;  3HKE A;  5C5B A;  4J11 A;  2EX3 A;  1Y6X A;  4E2L A;  3FAV B;  2NMB A;  1Z2G A;  2OTX A;  5KQ1 A;  1H10 A;  1VQ8 V;  1N4C A;  4LFC B;  5J3Y A;  1KB9 F;  1TJ6 A;  3ABU A;  1CPY A;  2CAY A;  4O4L B;  3OHM B;  3A2F A;  1Q67 A;  3SYC A;  1KQS U;  5H6R A;  4DR5 B;  5LMU O;  1OMW A;  1J95 A;  3NWF A;  5H6Q A;  1YZB A;  1AI7 A;  1ENV A;  1MKE A;  4WFH A;  4LF8 B;  3BVO A;  1IZ3 A;  5KHI A;  2DMX A;  2R70 A;  1NU2 A;  1YF2 A;  2Q5Z A;  4QJ5 B;  3K59 A;  1FXK A;  5E1A C;  1K5D B;  2DHI A;  1N0N A;  3RW0 A;  3DXR B;  2ZNJ A;  1GG3 A;  2IH1 C;  1U27 A; 
#chains in the Genus database with same CATH homology
 3LUT B;  2WLI B;  1VQ9 V;  4N21 A;  3ZRX A;  2XAS A;  4Q20 A;  5L3E A;  1K34 A;  3T4D A;  1SZT A;  2XND G;  1AI6 A;  2HLD G;  5B1B C;  1BMF G;  2EBO A;  3WG7 C;  5L3G A;  3K03 A;  3IFX A;  3E2E A;  2DW4 A;  1DF4 A;  2HJF C;  3OR7 C;  4WFE A;  1NR1 A;  2X6C A;  1P7B A;  3IC7 A;  1OCR B;  2QKS A;  4R6Z A;  3G4S V;  1ARO P;  1G8M A;  1M57 C;  5CBF A;  3D3I A;  3ZN1 A;  1VQN V;  3ZIA G;  5IY5 B;  1CP9 A;  4UXN A;  3CC2 V;  1MSW D;  2WWW A;  3PJS K;  2WLH A;  3OAA G;  3E8F A;  3OMA B;  3FB7 C;  2JJ1 G;  5B1O A;  4EKW A;  3OR6 C;  1S0V A;  3I56 V;  2GSM B;  5KA5 A;  1R73 A;  1VQ6 V;  1K97 A;  3STL C;  1VQL V;  3K08 A;  4X8A A;  1NJI W;  5CMU A;  3WG7 B;  1RPR A;  3QO5 A;  4LC1 A;  3UKM A;  1VQ5 V;  4MW3 A;  4P30 A;  4UVC A;  3B8N A;  1K5S A;  3TCU A;  2ATK C;  1R6K A;  1SET A;  4UVA A;  1JQ0 A;  3SYA A;  2EZO A;  1COW G;  3QO7 A;  1QCE A;  2Q69 A;  3SPI A;  4WFG A;  5EK0 A;  5EC2 C;  1QBZ A;  1S5H C;  2ITD C;  5CN0 A;  1K92 A;  3LSQ A;  5LGN A;  1AJN A;  2A9H A;  3F5W C;  2WLL A;  1GTO A;  1OCR C;  4MT8 A;  5B1A C;  4KP4 A;  2JEX A;  5HFL A;  4KUM A;  5KUM A;  4RQE A;  4QPJ A;  5IYB O;  4QJF B;  2ZR2 A;  3OEH G;  3T2M A;  1KC8 W;  4JTC B;  3CD6 V;  1JCH A;  2JEU A;  3K9A A;  2WLN A;  3CC4 V;  3OUS A;  2C2A A;  1R3J C;  3QNE A;  1GMG A;  2DQ3 A;  2P7T C;  1K4D C;  1DF5 A;  1VQK V;  3BY6 A;  5LBQ A;  1QR9 A;  4ZBM A;  5L3F A;  2AHZ A;  4G27 B;  3K0D A;  1OCO C;  1MG1 A;  2DYR B;  4P9P A;  1H8E G;  1GM8 A;  2V7Q G;  2DQ0 A;  2W6J G;  1SRY A;  1FXK B;  2LP7 A;  4UV9 A;  3DTU B;  4RAI A;  1GM7 A;  2V1D A;  1M90 W;  1K9M W;  1PNM A;  1CEZ A;  3G71 V;  1AI5 A;  3SJQ C;  4RUE A;  5L3D A;  2WAM A;  4UV8 A;  1L1F A;  1PL0 A;  4UVB A;  2ZD9 A;  5EBL C;  1QLE C;  1DTO A;  2WPD G;  2LFR A;  1ZWI C;  4GX5 A;  2EZP A;  2ZDI A;  4J9Z B;  4P9O A;  3ZRW A;  3W7S A;  2EIN B;  1YJ9 V;  3K06 A;  2B5U A;  1KD1 W;  3ABM C;  2EIM B;  4GX2 A;  3K3W A;  1WPX A;  4JAS A;  1QVF U;  2ZXW B;  2Y69 C;  4MVO A;  3SPG A;  5LHG A;  1M56 C;  3MHS C;  2EIK B;  2DWE C;  3CCV V;  3OM3 B;  1QR8 A;  2IW5 A;  2OTJ V;  2JJ2 G;  3JD3 A;  2ZXW C;  3OUF A;  3T4Z A;  3W7U A;  1I5Y A;  1JJ2 U;  2QTO A;  1K8A W;  1AI4 A;  4PA4 A;  3G6E V;  4QNH B;  1ROP A;  2DYS B;  3D36 A;  2EIJ B;  3ASN C;  3OFN G;  1R6N A;  3JD4 A;  3ZRW B;  1VQ7 V;  3F7Y C;  1V55 B;  3ZMT A;  2AHY A;  4RO2 A;  4GX0 A;  4J9Y B;  4MS2 A;  3ZRV A;  3W7W A;  3ABL B;  4LP8 A;  1QLE B;  4JAV A;  1PNL A;  3ETE A;  2NLJ C;  1DLB A;  1W2B U;  1R3L C;  1E79 G;  2H8P C;  3AG3 C;  1OCC C;  1RM1 C;  5LGU A;  3OE7 G;  4QE7 A;  3ASO B;  4XBF A;  1EZJ A;  4PDM A;  3ML0 A;  2HVJ C;  4X89 A;  1Q7Y W;  2B1G A;  2WLI A;  1AR1 B;  3ASO C;  1JPX A;  4RUF A;  2R9I A;  3VOU A;  4MW8 A;  2XAQ A;  3AG3 B;  3CCR V;  1YI2 V;  5HFM A;  3CXC U;  2NNU A;  4JYC A;  4QE9 A;  1IXM A;  2Z3Y A;  3AG1 C;  1YTF D;  3CYO A;  3JCZ A;  3KG2 A;  4PEL A;  4UUJ C;  2HFE C;  4GX1 A;  1M9N A;  1GK9 A;  1V55 C;  1JOY A;  5B1A B;  2EIJ C;  3ASN B;  4OXS A;  4JYB A;  1OZ0 A;  4PDR A;  3TK1 A;  4I9W A;  1SES A;  3X2Q C;  2X6A A;  4BW5 A;  1GKF A;  3ZRS A;  1F23 A;  1S76 D;  5DN6 G;  3SPH A;  3CC7 V;  3OMI B;  3E89 A;  5B1N A;  1VQ4 V;  3FB5 C;  2Q67 A;  1FXH A;  2Y69 B;  3FB6 C;  3ABT A;  3ZMZ A;  1R3I C;  1NVP B;  2QE7 G;  1OHH G;  5DM6 V;  5KUK A;  4FIP C;  3T1C A;  2Y48 A;  1FFT B;  2EIN C;  1Y4M A;  4WFB V;  3JD2 A;  3B8M A;  2M7W A;  1K5Q A;  4WCE V;  1NVP D;  3FYI B;  2OTL V;  2PI5 A;  1BHA A;  2ZR3 A;  4BIZ A;  1K3E A;  4MVS A;  3OW2 U;  3CCE V;  3AG4 B;  3CCS V;  1VQM V;  1S72 V;  4P2Z A;  5LGT A;  1YIJ V;  3P30 A;  2QM8 A;  3CP1 A;  3SPC A;  1KP3 A;  5L3C A;  3E8B A;  2X7R B;  2H94 A;  1PD3 A;  1YSC A;  2UXX A;  4TWK A;  3HB3 B;  2DYR C;  1M57 B;  3E83 A;  3SYO A;  1OCO B;  1NBM G;  1ORQ C;  2DWD C;  2IJK A;  1S77 D;  1K4C C;  4DO2 A;  1W0K G;  1LNQ A;  1QLN A;  2XAF A;  5B1B B;  5IYC O;  2WLJ A;  3ETD A;  4WFA V;  4QIW F;  3W7X A;  4MVU A;  1NH2 D;  3NXS A;  3ZMV A;  5EBW C;  1P4R A;  5B3S C;  3HSA A;  4XDK A;  2B1I A;  3CMA V;  3K04 A;  4BIU A;  3CPW U;  5IDJ A;  2IU3 A;  1K7D A;  1YTF B;  2X6B A;  5CA3 A;  4PA6 A;  2WLL B;  2XAG A;  2XOK G;  1H2G A;  4MTF A;  5CBG A;  3DCX A;  2QEX V;  3ETG A;  5J9P C;  2K1E A;  2IJH A;  4PA9 A;  3STZ C;  1FXV A;  3CCL V;  2HG5 C;  3CCU V;  4XDJ A;  5B3S B;  4ASU G;  3E8G A;  4JAU A;  2MK3 A;  3ZMU A;  4RQF A;  1EBO A;  1JX9 A;  2WLM A;  2UXN A;  1YIT V;  2BOB C;  3ZN0 A;  5GW7 A;  3GB7 C;  2HVK C;  2P6J A;  4PDL A;  3EHB B;  1QVG U;  4FK5 C;  3RBZ A;  3HPL C;  3TET A;  4LCU C;  3M99 B;  1M1K W;  2EIL B;  3MHH C;  2CK3 G;  4GT1 A;  1MOF A;  3P32 A;  5FL7 G;  3LNM B;  1AJP A;  1W0J G;  3GWO A;  2GHY A;  3W7T A;  3WFV A;  3OMN B;  3B77 A;  2HR3 A;  2A0L A;  1G4Y B;  4R50 A;  2R9R B;  1F51 A;  5IY5 C;  2A79 B;  1YHQ V;  2HKO A;  4U7N A;  3RVZ A;  1H38 A;  2FTK A;  4Z1M G;  1HWY A;  1XL6 A;  3FB8 C;  2KB1 A;  3SYQ A;  4LBE C;  3AG4 C;  1H8H G;  1KEC A;  4R7C A;  4GCZ A;  4N23 A;  3CME V;  1R3K C;  1N8R W;  3CCM V;  2Z5U A;  1K73 W;  2OT5 A;  2OCC B;  1PNK A;  2Q68 A;  2YEV A;  5BZB A;  3RVY A;  3AEI A;  1S3J A;  4PA3 A;  3MD0 A;  1FS0 G;  2YEV B;  3VBB A;  2QA4 V;  1GM9 A;  1F4N A;  5EBM C;  4MVQ A;  1NH2 B;  4H37 A;  1VQP V;  2ZQM A;  4KFM A;  4X88 A;  1XL4 A;  2W6I G;  5H9C A;  2EJR A;  5CBH A;  4F4L A;  3A0R A;  1V54 B;  1GO3 F;  4L87 A;  5L3B A;  1F4M A;  1K33 A;  1E1Q G;  3X2Q B;  3AG2 C;  4CBC A;  4R8C A;  2ITC C;  2Q6A A;  1OCZ C;  2ZDI C;  3H01 A;  1NQT A;  1OCC B;  4YXW G;  1UJW B;  2WLK A;  3JYC A;  2LFS A;  4MTG A;  4PA7 A;  1KKD A;  3JD1 A;  3AG1 B;  2F43 G;  2IJI A;  4FJC C;  1PKX A;  4HYO A;  4JF3 A;  2XAJ A;  4HAM A;  5IYD O;  4JGS A;  2IU0 A;  1OCZ B;  3JD0 A;  5EC1 C;  1KP2 A;  3BEH A;  3AG2 B;  4I5S A;  2IJJ A;  2PI4 A;  1V54 C;  3LDE A;  4JTD B;  4DXW A;  1VQO V;  2EIK C;  1RM1 B;  1YJW V;  1M56 B;  2YSU B;  3ZMS A;  3CCJ V;  2P67 A;  3OEE G;  3OGC C;  3UM7 A;  3ABK B;  2EIM C;  3ABM B;  4MTO A;  3K0G A;  1YJN V;  3FKS G;  2JK5 C;  3CCQ V;  2OCC C;  3DGE A;  5LHH A;  4MVR A;  4U7O A;  4XDL A;  4TT3 G;  1AJQ A;  1BHB A;  3ABL C;  4BAY A;  4G28 B;  1MAB G;  3ZCC A;  2JIZ G;  3E8H A;  4MTX A;  1THZ A;  3EFF K;  2DYS C;  4E2L A;  4ZKI A;  3QO8 A;  3LDD A;  3ABK C;  3E86 A;  3K79 A;  1VQ8 V;  4WFF A;  5LHI A;  4G2K A;  4JTA B;  1NR7 A;  3ABU A;  1CPY A;  3IGA C;  3LSS A;  2X0L A;  1I5X A;  2W0F C;  3LDC A;  2WSS G;  4MVM A;  3SPJ A;  4QPK A;  3ZJZ A;  2EIL C;  3SYC A;  1KQS U;  4H33 A;  5H6R A;  1Q81 W;  1B6Q A;  4JPR A;  4FMT A;  3I55 V;  1BL8 A;  1J95 A;  1Q86 W;  5H6Q A;  1Q82 W;  1AI7 A;  1WLE A;  2QM7 A;  4HZ3 A;  1ENV A;  4TSF G;  2JDI G;  3FYE B;  1EFR G;  4WFH A;  3E35 A;  4CZZ A;  3F7V C;  1NKD A;  2IH3 C;  2P90 A;  2BOC C;  4FPP A;  4MSW C;  3SYP A;  1RPO A;  1E1R G;  1FXK C;  5KA6 A;  4MVZ A;  1SER A;  1FXK A;  4PDV A;  5E1A C;  4WF9 V;  1Y66 A;  3RW0 A;  2IH1 C;  2D3O W;  3R65 A;  2XAH A;  1TUE B;  1JVM A;  5C93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...