3B77A

Crystal structure of a ph domain containing bacterial protein (exig_2160) from exiguobacterium sibiricum 255-15 at 2.42 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
188
Chain Sequence
DIGQVIHPDDFDKAAADDYVLHEDGEKIYFLIKSKTDEYCFTNLALVHLDGESASKRVLYRYPYAHYPIRHVMFETAGTVDLDVEIKFEIGGKHYSIDVDKKQLEHVKDLYKALLAIAEKQYEGQKMLEFANSSLNHSVTILGGLRQGDMNVPQTFKDLSQESFDWLQGHYYKWNQKDFGSFYEKYIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Bacterial pleckstrin homology domains: a prokaryotic origin for the PH domain.
pubmed doi rcsb
source organism Exiguobacterium sibiricum
molecule tags Unknown function
total genus 56
structure length 188
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11724 YvbH_ext YvbH-like oligomerisation region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3b77A02
2.30.29.50 Mainly Beta Roll PH-domain like Bacterial Pleckstrin homology domain 3b77A01
1Y66A 3CP1A 1EBOA 3WFVA 4JPRA 1JPXA 3B8NA 3HSAA 1I5YA 5CMUA 5KA5A 3P30A 1DF5A 5KA6A 2OT5A 5CN0A 4JF3A 1DLBA 3H01A 1QBZA 1QCEA 4N23A 1Y4MA 3DCXA 1K34A 1DF4A 1I5XA 3CYOA 5HFLA 2LP7A 5HFMA 1SZTA 3MHSC 2EBOA 3B8MA 4JGSA 4FJCC 1F23A 2X7RB 3M99B 2M7WA 4E2LA 2P6JA 3K9AA 4N21A 2EZPA 2EZOA 1QR9A 1K33A 4FIPC 4FK5C 1MOFA 4G2KA 5H9CA 1JQ0A 3MHHC 1MG1A 1ENVA 3GWOA 3B77A 1QR8A 2MK3A
chains in the Genus database with same CATH superfamily
1Q82W 1AQCA 1R3IC 2WAMA 3WU2Z 1V55C 1MIXA 5BZBA 3CCUV 4O2BB 2RGNB 1L0NH 1I0HA 1V5PA 4QPJA 4HAVB 4XDJA 2Z0QA 1KUQA 4JAUA 1V54C 3M99B 2F4VO 1O9GA 1OHHG 4QPKA 1P6SA 4P2ZA 1QLNA 2LOXA 3RGBA 1GM9A 3A2FA 2CTRA 4YJ3B 5LXTA 1BT8A 5IRSA 1YDXA 4X66B 4NXMO 2Z0AA 1VEWA 1HNZB 2DQ3A 4X8AA 2HFEC 5LONB 2QWRB 1WVHA 3DXEA 2XNDG 3G4SV 4X1YA 1NTMH 3U12A 1SS3A 1AI7A 5GONB 3K5LA 4B3SO 3I56V 4DR3B 2A9HA 4BW9A 4HDOA 3B77A 4QGPA 4P30A 3QVNA 4IIJB 2WLLB 4O4LA 2X6BA 3W7TA 1JA8A 4DUYB 3J7AU 2VWJA 1D5NA 3WB2A 2GTAA 1XNRB 1PLSA 3SDLA 3HB3B 3CCQV 2XAQA 1WG7A 4QE9A 2AHYA 4NKGB 3A8TA 3HKBB 5EIBD 3HW2B 1BTKA 1V88A 3L72H 4WFAV 3CSXA 1WNSA 4KHOA 1J19A 5KA5A 4K8XA 1RFYA 2GV9A 4HB2B 4JI0O 1KZGA 2FL4A 4CYEA 1J5EB 4B3TO 3E89A 3EXAA 1G1XB 1GM7A 4TV9A 5EBLC 3KRXA 3TXQA 2EJ7A 3ZRSA 1K8AW 1N3HA 2YXHA 4A6FA 2JDIG 1I94B 4DV0O 2P4KA 4DUZO 2GCLA 3CCRV 2KG7B 3PEGA 3B2EE 2FYUH 4LNUB 3L71H 1XNQB 1ZX3A 1I2HA 1W0KG 3RW0A 4GKJB 5EYPB 2P22C 4XDLA 3DXCA 4MVRA 1BCCH 4YHHB 3IVFA 1AR4A 1M93A 2AGAA 1BWNA 3MD0A 2CH7B 4NVPA 3N2GB 4HB0B 1X1GA 4I55B 3CMAV 1N34B 4OPAA 2ZKMX 4GXBA 4TSFG 2HR3A 5LGNA 2L6LA 2DKPA 2JP2A 1GG3A 5KA6A 1XMQB 3VQWA 1NH2D 4NTXA 4C0AA 3ZIAG 1S5LZ 4DR4O 2XAGA 5TISZ 1VQKV 3NW8A 5AG2A 4GCZA 1EM1A 3SO6A 3JD4A 4X1IA 4LFAO 2EZOA 3CJHB 1K33A 3ETEA 3OGCC 1F4MA 3DC6A 4JASA 4L87A 4QNHB 1NT2B 1YXBA 4J7JA 2CODA 2GCJA 1HR0O 2EJ8A 2R9RB 4PA9A 2OT5A 3D3IA 3FKSG 4CS2A 4OX9O 1V5MA 4Q6GA 1R6TA 3DCXA 2DW4A 2F93B 2IU3A 3UT5A 2UXCB 2GBOA 1T77A 3JCUZ 2BCJA 2PYLA 1KU9A 1R1BA 1XI1A 4DR5O 4H33A 1P7BA 2F43G 4O4HB 3JCZA 1DLBA 3U8ZA 2YIAA 1ZL8B 1RPOA 3OUSA 1TA8A 4J80A 3C90A 4C7UA 5IDJA 1BAKA 5D5PA 4GN1A 4FM0A 4RQEA 2ZDIA 3VQXA 4H8SA 1Z5VA 4K2PA 2R9IA 1N32O 1J0WA 2L2IA 5FI1A 1K92A 2LG1A 4NR1A 1EN4A 4K81A 2ZIMA 3LDDA 2Y8GA 5CBFA 3CB2A 4AQYO 3B8NA 3VIAA 1BZKA 4X89A 2ZM6O 5HE0A 1EFRG 1TJ6A 1VQ8V 1IDSA 3ULBA 1WAZA 4MT7A 1AR5A 1Q8IA 2EZPA 2Q8VA 1H2LA 4WFHA 5A9GA 4UVCA 1MAIA 3A0RA 1H10A 4JYAO 2QKSA 4MW8A 2KQXA 5M4YB 4LC1A 3MAQA 2NBVA 5CN0A 3ZMZA 2QEXV 1RSOB 5J2UA 3UM7A 5L3FA 3ZJZA 2YIBD 1M7RA 3H1KH 5IWAB 3RYFA 4LF9O 2ITDC 4TOIA 1WA8A 3HKDB 5GOWB 2XUMA 1R3KC 2QE7G 4NXNB 1ZTEA 5GTIZ 1SGHA 3K5OA 3OFNG 1YI2V 2ZNJA 2AZ2A 3FM8C 4YJ2B 5LMNO 4Z2WA 4O4JA 4LF7B 2NR5A 1IVSA 4ZHQB 4Z2MB 4J11A 3B8MA 3V5WA 4IGGA 1KD1W 1KC8W 3ASNC 3F5TA 4UB6Z 2UZSA 3SYAA 1LNQA 2Q7GA 4PDRA 1YCIA 2ILMA 2Q68A 2F4VB 1LR1A 3A0BZ 4HAMA 1QR8A 2CY4A 3KSYA 1GN3A 1YEWA 4R8CA 4JI7O 1ZAUA 3P30A 1K73W 4UCTA 1IBKO 2BTOA 5L3CA 1SF9A 1RM1C 4UV9A 2K1EA 2WLJA 3LSUA 4FFBB 4NXMB 2DHJA 4IFSA 2D3OW 4LH6A 2Q13A 1F23A 4JAAA 2B5UA 3K9SA 4WF9V 2ZD9A 4J41A 1HP8A 5EBMC 3JATB 1AR1B 1SESA 3RN4A 3ASOC 4X64O 2YIDA 4UVAA 4B3SB 2P5OA 1SA0B 1Y76A 5IJ0A 5EBWC 4U7OA 5FL7G 1PP9H 3HSAA 2EILC 1DF5A 2KIGA 4ZI7A 2AL6A 4J7ZA 4GUNA 1Z5WA 1DF4A 3J80N 1U96A 5KUMA 4DR7O 4KP4A 3CC4V 1U5DA 3OW2U 4B3MO 2Y4TA 4DXWA 4LFBO 4KXRA 1GK9A 3CCVV 1DDVA 4LCUC 2I1JA 2UZRA 5JVDB 1TUBB 3CRAA 5KCVA 1FGZA 3CXHF 3JAWA 1DDMA 2JJ2G 1RM1B 4HAYB 5EC1C 1X4TA 5KHKA 2EMSA 1XHXA 3BCCH 3ML0A 4GYCB 2PUSA 2XASA 4JI0B 1NI2A 1I7AA 3MHSC 3N2KA 4B3TB 5C93A 2VQEO 2KIEA 2JIZG 3LNMB 3ASOB 4TKNA 4WBNA 3SYCA 3APQA 3RYHA 1OCZC 5KX5B 3CXBB 4I9QA 1FAFA 1E5WA 2EILB 1R3LC 4TUYB 2KSDA 3K04A 1Q81W 2COCA 3NWAA 5B5EZ 3FAVB 2D2CB 3E8BA 2ZINA 3AK3A 3T1HO 3K08A 1IX9A 4CZZA 1W1DA 1R3JC 3SPJA 2HP8A 2YRYA 3M1IB 1FFXA 3EVKA 1U5FA 1IBMO 5DEDA 2LULA 4TV8B 3HR0A 4CH3A 2P90A 1GKFA 2KKWA 1XL4A 1IXMA 1VIBA 5E79Z 4CH4A 1MSWD 3G9WA 1M9NA 3CS5A 1H8EG 3GWKC 5C8YA 4DR4B 4UCUA 4EFEA 1BL8A 1YSCA 2NMBA 2GUZB 2LGQA 2J0MA 3E86A 2E5LO 3MPXA 1GO3F 1OCZB 3ETDA 2X6AA 3HKCB 1TQZA 4D0NB 3FB6C 3OMIB 3ODOA 2VWKA 5BMVB 2QKMA 1XUQA 1XREA 5CBGA 1E79G 4CHJA 4PDLA 1HR0B 4X62O 2W2WA 2QM4A 3ZBHA 2YS8A 4OX9B 4JI8O 5LG4B 2ROVA 1H38A 2QTSA 1KMIZ 4GNKB 3BEHA 1PNKA 2Y69B 1GH6A 2Z4DA 2XAFA 4L6EA 2JRIA 3Q4HA 5H9CA 3JD2A 3GYPA 4EB6B 3DXRB 1M57C 4OT1A 2JGUA 1XX0A 4Z2NA 1EBOA 3JD1A 4DR5B 5FNVA 3K03A 4PI2A 4QJFB 5KQ4A 3K06A 2YT1A 4TT3G 2Z5UA 3ZHVA 5LHGA 4PDMA 3CWBH 3DC5A 1SERA 5D3YA 1I5XA 2P06A 4FVMA 1NQTA 5IT9N 2QA4V 4I50A 3CRQA 2X7RB 4X1KB 2GS0A 2LFSA 1WGUA 4KFMA 3QG5A 3D8EA 3TCAA 2HHHO 4I4TB 2WWWA 3O9OA 4XBFA 4IHJB 4F7HA 4FLTA 1N32B 4MTOA 4GOUA 4CC5A 3VQVA 4AQYB 3D8CA 4MK0A 5J3YA 2ZM6B 3X23A 5ITZB 1UNRA 5LA6B 3H1IH 1V5UA 4KHAA 4H37A 5L3DA 3AG4C 3J81N 4WVFB 1OV9A 1M57B 4GMVA 3CMEV 2YSUB 1NR1A 1URFA 2KGXB 3FYIB 1FYJA 1JR9A 4NSWA 1DK1A 5CLLB 2UU9O 1Y4MA 3CYOA 5JQGA 1NU2A 3ZVRA 2VQFO 3JARA 1FGYA 2R72A 2RSGA 1MMMA 5LXTB 3QO5A 5DH9B 1JQ0A 4PNKA 3SYPA 4J42A 1MK7B 1ZM0A 4L1RA 2B9ZA 1NR7A 1Y19B 3DXDA 1K4DC 3RCPA 5KLVH 4U3FH 3OANA 4X1YB 1H2KA 2YUAA 1TAEA 2ZQMA 2GSMB 5CB4A 3AG1C 2H7EA 1MK9B 3AG4B 3EHBB 3CPWU 1LW3A 1G4YB 1Q90D 5HE2A 3OEHG 1F51A 4PQ0A 2ITCC 1AJPA 3DTUB 1VQOV 2BSKA 4MW3A 1UPQA 3RWRD 4L8JA 5LHIA 1F7YA 3JASA 1M5IA 2QKAA 2EINC 5LP6A 2WLIB 1WJ1A 4JI7B 3T4DA 4P7IA 2ZXWB 3ZCCA 3NSUA 2E74B 2FJUB 1WN7A 4DR1O 2E3CA 3B4SA 1KKCA 1QNMA 4RWUA 5KHHA 1CPYA 2DKQA 3ABKC 1GM8A 1YJ9V 5DN6G 4FK5C 3PVUA 4EMOA 2JK5C 1BHBA 1X86A 1Q3EA 2X18A 3FB5C 4MS2A 4CSQA 4X64B 5L3BA 2W2XD 3O96A 3UO2A 3A8QA 4A6KA 2ZT9B 2K2UA 5B3SC 1H4RA 2N0YA 3AG1B 1PNMA 4CS3A 5D27A 1N33O 3HPLC 2WPDG 4LF5B 2P0DA 4K35A 1DROA 3T2MA 2IH1C 4DR7B 1SC5B 5H2FZ 3FD9A 3P6AA 2IW5A 1OMWA 4B3MB 4R50A 5KMGA 2FKXA 1K7DA 4DX8A 5B1NA 2DYQA 4ZIBA 2RMKB 4DV5O 3FX7A 2MK3A 2QM7A 4B7EA 1SQVH 2EINB 3P3PA 2A0LA 2HEPA 1MZEA 2LQTA 1NJIW 2L35A 2Q5ZA 1WJMA 4J10A 4BW5A 1GC6A 4K8ZA 1W59A 3T4ZA 1AP6A 4DV7B 1FOEA 4Z1MG 2RCVA 3BRCA 3ABKB 1JMKC 1ZC4B 1H2GA 2ZE5A 3AU4A 4KHBB 2F1MA 3KCYA 4JI5O 4X20B 1NTVA 1ZWIC 1ORQC 1QU7A 1R6KA 4CH6A 1V89A 3H1JH 3JAKA 3SJAC 1W1GA 5J2TA 2IFSA 5B3SB 5KAFZ 4JI4B 4LF6B 1KQSU 4X1IB 4F7GA 1COWG 3JYCA 2QGNA 2ZDIC 2HTHB 4O2BA 1ZSPA 4GKKO 1VQMV 5JP4A 3WG7C 1HW7A 3CRMA 2HVJC 4BWAA 2WA4A 2V4DA 4QXAB 5H5NA 1VF7A 3K5NA 2EIJC 2JGDA 1K5QA 1XD4A 1YJNV 4JI3O 5HFLA 3BABA 3CCMV 2ZR3A 2IBZH 3I55V 2ADZA 2D9XA 2HLDG 3K9AA 1VF5B 1WJZA 4MVSA 3SPCA 4B3RO 1Q6IA 4JV5O 1N4CA 3AJ4A 4KUMA 1BQ0A 1VF6A 4G2KA 4HNAB 2E5LB 2P0FA 1XMOB 4B6HA 4FLXA 5CA0A 2K00A 4MVQA 5GONA 3DGEA 3KZIZ 4XDKA 3TK1A 1F4NA 3G6EV 5IYCO 3HK0A 4BBKA 4O2AA 5LGUA 2WLLA 2ZKOA 4X62B 2ADQB 2QR4A 5LL6Y 2DN6A 3ETQA 4JI8B 2UUCB 1XKEA 1S0VA 4E2LA 3PP2A 2F66C 3WG7B 5IE9A 4LF8B 3VQYA 1QVGU 3CCJV 1O9HA 1UFIA 1WP7A 5L3GA 2CAZC 2IM9A 1TUEB 1UPRA 2EIJB 1GN4A 1K9MW 1GN6A 1UJWB 2P67A 5IYBO 4DYLA 3PVLA 3E8GA 3TJTA 2M38A 3FFQA 4MTGA 1TGOA 1FB8A 1QC6A 5HE3A 1OY2A 2DN9A 2Z13A 3JAMN 1EAZA 3F0WA 5CLQB 3K57A 4GX1A 3VOUA 4ASUG 4ZBMA 2QWPB 1HDJA 1IBLO 1ZYIA 2AHZA 5J2UB 1NI8A 1JOYA 3L75H 2HHHB 3T1CA 2JJ1G 4IAPA 3RYFB 2PI4A 3OR6C 1WA8B 3K79A 2YS3A 2YT0A 3PG7A 1W1HA 2DYRC 1IZ3A 2FJLA 4G27B 3IGAC 4F6RB 2IJHA 3FEHA 4EJNA 3W7SA 5EYPA 4JZGA 5I2SA 3ABMC 2DMXA 2UUBB 3K5MA 3HIEA 3KG2A 3CE2A 1FPOA 4O4JB 3CC7V 1HNXB 2W0FC 4UUJC 4QE7A 3WB1A 1KBHA 4I55A 1VMGA 2Z14A 4E4EA 3BHPA 4F7UP 3RVZA 4QJ5B 1XHZA 1OJHA 1DTOA 4DR2O 2UU9B 3SNHA 5C5BA 3O65A 2VQFB 2CDYA 2YIBA 4DV4O 3H1LH 3M8AA 1W0JG 4KAXB 1GN2A 3CJHA 5IY5C 2FTKA 4U3JA 1EF1A 1H8HG 2XTAA 5BR8O 2G38A 4FLZA 1QBZA 2FMLA 2DYRB 3WYFB 1AJQA 3UCSC 3CD6V 3ABMB 1AROP 2RNRB 1Y76B 1XILA 5IJ0B 1RP3B 2WLMA 1SZXA 1K3EA 3PJSK 3ODXA 3LSSA 5D3XA 4ZI7B 2BCCH 5JHHA 1Q67A 5LOPB 1XCGA 1NVPB 2YEVA 1N0NA 2DWEC 1BHAA 1FXKA 2GJYA 2QDOA 4XWXA 1YVWA 2ZCEA 3RVYA 3K58A 3CRRA 2DTCA 3G80A 5B66Z 2OQBA 4ABMA 1UEFA 5IY5B 1YTFD 3OGIB 3G6BA 3RT3C 3ABTA 1G6UA 3KCXA 4HB3B 3HQCA 2RQ6A 4FM2A 1JCHA 3N2KB 1NU1H 1Q7YW 4ICGA 4WBNB 3GB7C 2D4QA 3JALB 3RYHB 2PTMA 1N33B 1UPGA 1YZBA 3OTFA 3CC2V 2EMTA 3TW1A 2IJJA 2WSSG 1MG1A 2ROZB 3BJIA 2DOSA 2WA3A 3LUTB 1OCCC 2DHIA 5C79A 2P0HA 3A58A 3ZHUA 4FLUA 4JPRA 1N36O 4WCEV 2CTPA 1X1FA 3F7YC 2R0DA 2Q7EA 1OCRB 2QWOB 5CA1A 1WLEA 2EX3A 5JJJB 3JSLA 3AK1A 1FFXB 2RJZA 2ZE6A 2OWOA 5D5QA 3ZMTA 2Q73A 4EKUA 2B1IA 4CC6A 1OZ0A 2I5CA 1PD3A 3OE7G 4DBBA 1Y5OA 3NWFA 1DBHA 3KY9A 1S76D 3D36A 2BOBC 4PA6A 4FLWA 3HKDA 5IYZA 2CK3G 1HWYA 4BIOA 1IURA 4X66O 4JI5B 3RFRA 3ZRWA 3STLC 2ATKC 2M6YA 3E2EA 4NB5A 2R2YA 1PKXA 2CE4A 2DQ0A 3SJQC 3DSQA 1SQQH 1A32A 1XBLA 3CHXA 4YL8A 4D6WA 4WFFA 4ZHQA 1OCCB 4JYCA 2AZ0A 3GWOA 4YIOA 1H2NA 2KUQA 4MT8A 2LO1A 3OR7C 1XEQA 4DV0B 1VQ6V 2YI8A 1BQZA 2VRWB 1FXHA 4DUZB 2Q6AA 3FYEB 1SHCA 2V76A 5LMUO 5A2QN 4HAXB 1K34A 1TVKA 2LP7A 3Q4HB 2Z3YA 1M7EA 1RJ2A 2MKRA 3GYOA 3T06A 2R70A 4JI3B 1Q5OA 5B1BC 2Z0OA 3CXCU 4DV1O 1JJOA 2K8EA 1YIJV 2ARHA 4ZKIA 1P4RA 3ZHSA 1Y74A 3RBZA 1I7FA 4G28B 2X0LA 2Y69C 5FNVB 5JWPA 4FM1A 4IYHA 1TXDA 1GRJA 1QQCA 2Z59A 4NY0A 1AJNA 4TWKA 4B3RB 4JI1O 2VKIA 3STZC 3ML4A 3JATA 1SQBH 4JYBA 5GW7A 2Q69A 5CMUA 3U0ZA 4J7KA 4CH5A 3UZTA 1H2SB 1U5EA 3RYIA 2YVCA 2UXBO 2EIKB 1KI1B 4PA7A 1R6NA 2R9AA 2HG5C 2Y0IA 4RAIA 4D7SA 1K5DB 4HYOA 2LJ2A 4PDVA 4I5SA 5D3WA 2J0KA 4LFAB 1FJGO 4MVUA 3FB8C 1XNQO 2ELBA 4JAVA 2KB1A 2XT9A 1NTKH 1N8RW 3OUFA 4YHHO 4QJ3B 1EGXA 5B1BB 2LKOA 3E22B 5JCOA 1BS3A 2D10A 3ABUA 4EEQA 1EVHA 1GTOA 3JD0A 2QSAA 4JTAB 3T1YO 2ZPYA 3E35A 3HKEA 4PHZA 1DGSA 4UXNA 1EZJA 1IBLB 3BA9A 4O4IB 2PI5A 1EN6A 2W6JG 3JARB 4BR6A 3CCEV 1N0JA 1KZ7A 3PVWA 3BPZA 1MPHA 1PV0A 1AP5A 5GTHZ 2H7DA 2IJKA 5DHAB 2XAHA 1FHXA 2HJDA 3KKYA 3A0HZ 2Q67A 4YXWG 1WGQA 2IJIA 3SYXA 2VS0A 5CB4B 3CRCA 1VQ4V 5CA3A 2JS3A 3SYQA 3P3NA 1S5HC 3G71V 4PJ0Z 1ZLZA 4IT5A 4IOYX 1BMFG 2D9ZA 3R65A 4X9QA 3U7DA 4B08A 4FJCC 2BSKB 3OMNB 3UO3A 3C3TA 4FMTA 4DR2B 1P7GA 2DYSB 3JASB 4X88A 4KHPO 1MKEA 1SETA 5EIBC 2AW9A 4OXSA 4HAWB 4LH7A 4HATB 2H3OA 4JI2O 1S3JA 2CAYA 1S5JA 3SUZA 1B3QA 3PN1A 4JYAB 3THOA 3QNEA 4JF3A 3L9DA 2CUGA 5IJ9A 5BR8B 3AU5A 3X2QB 2EIMC 2ZXWC 3ZEDA 3NWDA 4LF9B 4MVMA 2ZR2A 2KUPA 3QIJA 1MOFA 3F5RA 2MDXA 4K2OA 2YT2A 4UCRA 3QF7A 4CBCA 3JSNA 4DRXA 4EB6A 2YSZA 4CS4A 5LMNB 4ZRJA 5KMGB 3AG3C 5LOVA 3OM3B 1QHTA 4F4LA 4MVOA 1WI1A 5BXZA 1PMSA 4O4LB 3AG7A 3ICXA 4FLYA 2CRFA 4WJ7A 4D7TA 2DYNA 3TO1A 5DM6V 3H9VA 4DIXA 2P7TC 4OPHA 1XODA 4AI8A 2JEUA 2EIMB 3TETA 2DLWA 1IBKB 4QIWF 2XOKG 2RN9A 1HNWO 4LFCO 4HAUB 1VF6C 2RRFA 5L81A 1JX9A 3JAKB 5J2TB 4I0XA 1NS1A 5H6RA 3SGIA 2PZ1A 1JFFA 4UVBA 2NN4A 2ELAA 1FHWA 1AI4A 4BIZA 2EULA 4LF7O 1ZC3B 1SQXH 2ZNIA 5L3EA 2QM8A 4TV9B 1ISNA 5E1AC 1N36B 3G67A 4FLVA 4A6FB 3AG3B 2LOZA 3S3XA 2UXDO 3SJCC 3ZHRA 5EZYA 3LJUX 1JJ2U 4ZOLA 2A06H 2D9VA 4OSNA 1B6QA 5JH7A 4GMXB 2W0XA 2JGDB 4W4KA 1U5GA 4LFBB 1Y6XA 5KUKA 5FI0A 4KL1A 4WFEA 1NTZH 3RYCA 1NH2B 4YY3O 3ZMVA 3SPGA 4ZRIA 2HJFC 2CTWA 4RO2A 2BTQA 2HE7A 2MFQA 2D2QA 2RUKB 4JGSA 1YHQV 5BY1A 1AB3A 4WFGA 5CA0B 5LYJA 1PL0A 2Q4PA 1WPBA 4DR6O 3FB7C 2Q0OC 2VQEB 1LUVA 5H6QA 3CIKA 4A5UB 4LWSA 4K3AA 1V55B 4MTXA 2NZ8B 4GT1A 4O2AB 1D2DA 3UKMA 2E75B 1CEZA 4HB4B 2UVMA 4MY6A 5JJNB 1I5YA 3WB0A 4PA4A 1FFTB 4JYYA 4UCOA 2EC1A 3AEIA 1BSMA 4YONA 2QTOA 1V54B 5LMUB 5K1XA 4Q20A 2BE3A 4HAZB 4CHMA 2EBOA 2WLIA 1XL6A 4HSIA 3T1HB 2V7QG 3L74H 2Y8FA 1GMGA 4DV1B 4R6ZA 4WSFA 3WA0A 4JTDB 1VQLV 3OMAB 1IBMB 3BVOA 4JI1B 2DJVA 3JD3A 4A5KA 2P8VA 4W4LA 2PYJA 3UT5B 2A7WA 4DV2O 2AEHA 4UCVA 1XDCA 2Y7BA 1YITV 4YJ3A 4GPTB 3IC7A 4B7KA 1US6A 4DV6O 2UXBB 1L0LH 4DW0A 1ZVRA 2DA0A 4HHVA 2K2JA 3I5DA 2XHBA 1MZFA 5B1OA 1WPXA 5F2VO 4WFBV 3IFXA 2NNUA 2ZE7A 1FHOA 4DV3O 1FJGB 3SYOA 1B55A 1E1RG 3APOA 3KRWA 1YJWV 2PF4E 2PGGA 4MTFA 3E8FA 3IC9A 2EJRA 2DFKA 4U7NA 4IIJA 3E8HA 2OTLV 1P5TA 5FPRA 3OTOO 2P6JA 4RQFA 1XQ8A 1AVMA 1VP7A 3QWMA 2Y0PA 3CEIA 4UB8Z 2MWNB 2GHYA 3S3WA 1Q86W 3HKBA 3T1YB 1SQGA 1VQ5V 4KHBA 5J3TA 4TQFA 4X20A 1WB7A 3ODWA 1FXKC 2JEXA 1RRPB 5C5BB 2JVDA 5C16A 1THZA 3AK2A 4J9YB 1Z2GA 2O57A 5KHJA 5IYDO 1MA1A 3ZMUA 3A8PA 3SPHA 3ZS8C 3TFMA 5DECA 4U3JB 3BA8A 1BTNA 4GX2A 1L1FA 2B1GA 3K3WA 1U97A 4N23A 2QWNB 3TCUA 1ZUQA 1U29A 4UV8A 2C2AA 2OIEA 3R66A 1Y67A 1YF2A 2Z0PA 2KG7A 1AI5A 1FKAO 3LDCA 4FPPA 1Q43A 4LNUA 3MDSA 4JI6O 1UNQA 1MABG 3NXSA 2VRZA 2HVKC 3UQ8A 3MDBC 2COFA 1YTFB 4LF4O 2VSZA 4KHPB 2OCCC 2R09A 2YEVB 1MSDA 2CH7A 1FXKB 1E1QG 4TQDA 3H1HH 4HNAA 2OCHA 3N2GA 4Y94A 1S77D 4JI2B 1SKVA 3QTCA 5KQ1A 2K49A 4HBNA 1G8MA 5EC2C 4X65O 5FPOA 3D36C 5KAIZ 4J9ZB 4FZ0A 2CGNA 1QLEC 3OEEG 3ABLC 2DE0X 2UUAO 5B1AC 2CY5A 3WFVA 1OQNA 4P9OA 1EN5A 3CX5F 2KCJA 2X6CA 1NBMG 3C3SA 3TVVA 1I08A 1GAXA 2QKLA 2H8PC 1J95A 1V61A 2OCCB 5CA1B 1VARA 1CP9A 2YXLA 3OD4A 4K0KO 1Q6UA 2Q7HA 2M14A 4PI0A 1H2MA 1M90W 3AG2C 4D6TH 5JHGA 4H0LB 3LDEA 1K4CC 1OCRC 1MNGA 3ZN1A 2Y48A 2YS1A 4AHCA 5IYZB 3IJ4A 4O4HA 2D9WA 1QLEB 2OTXA 1KB9F 2NLJC 4HZ3A 1S72V 4LFCB 1HNWB 3ZRWB 4DR1B 4DW1A 1ZL8A 3ABLB 3BINA 3JAWB 1SQFA 5B1AB 4NYKA 4F6RA 1IXBA 1ZSQA 3ZDTA 1Z87A 4EFBA 2Q0AA 4BIUA 1DYNA 2RNBA 4DX90 1QQGA 2OTJV 3D8DA 1PFJA 2ZE8A 5EFXA 2LFRA 1VQPV 1U27A 3ZHQA 4N21A 2UXDB 2ADPA 4GX5A 3K0DA 1WP8A 3D3QA 4I9WA 4JZ2A 3CCLV 2RDCA 3M7MX 5KHGA 3ULCA 1TVKB 3U11A 3AG2B 4DXAB 3EFFK 1SQPH 4DV5B 3D8FA 4EKWA 3QBVB 5DHFB 1K97A 2Q9LA 1B04A 1Y74B 4YY3B 5JCOC 1RPRA 2IYBA 1RSOA 2PZSA 1VQ7V 2H94A 1T5EA 2CTQA 1K5SA 2YC0A 4Z1VA 4DK0A 1AILA 1KP3A 4DR6B 3RYIB 3SPIA 2COAA 4IL6Z 2D9YA 2N23A 5D3VA 2UXXA 2JS5A 5JLJB 1HNZO 3ZRXA 5C8YB 4LF5O 3SJBC 3QO7A 4OGQB 1B06A 1FS0G 1D5AA 2Y4UA 1M4UA 3ASNB 4YJ2A 2EIKC 1JVMA 2M7WA 1PL4A 3E83A 4FFKA 2UXNA 1NKDA 4DR3O 1P49A 1PPJH 4GKKB 2AXTZ 1UNPA 1Y66A 2ZIOA 2DX5A 4LBEC 5DI9B 3VOQA 4DUYO 3N27A 3ZN0A 3TXSA 3ZHTA 1NVPD 1X59A 4DV7O 1XNRO 3OHMB 1BE3H 2WLNA 1QCEA 2YS5A 5J9PC 1GC7A 3ZRVA 4DV2B 1AI6A 2CGOA 3HKEB 4R7CA 3P32A 4DV6B 4FFBA 4DO2A 3JALA 2XAJA 1EZVH 2ODMA 2IU0A 2J59M 2WLKA 4JI4O 4JV5B 2DHKA 4LF6O 1KECA 3KZ1A 3OAAG 1J5EO 2GDSA 4DV3B 3NR7A 4I50B 5FLXN 4TYZA 5LBQA 4MSWC 1SA0A 1FXVA 1ROPA 3B09A 1I94O 3BFRA 4IYIA 1QR9A 5JJEB 1W2BU 1P3RA 3OTOB 3ZX6A 4F6EA 5K1PA 3SV1A 1KKDA 3LNNA 3CCSV 4GKJO 2DX1A 5JVDA 3VBBA 2LYDA 1TUBA 5I2MA 3PSCA 4LP8A 3PZDA 1N34O 1CXZB 3F7VC 1AWEA 1XMOO 4BAYA 5J3QA 1X05A 2YF0A 4RUFA 3LSQA 3FSSA 3N7CA 2DYSC 1SRYA 3ETGA 1MIZB 4K17A 5IJ9B 5LP6C 1XMQO 2ETNA 1FAOA 1DDWA 3F5WC 2GUMA 2MW2B 2YI9A 5JQGB 3K0GA 2W2XC 4UFZA 5KX5A 2LW1A 2I1KA 2OYQA 1LB1A 2UUCO 2F95B 4TUYA 5HFMA 4UCSA 4LF8O 5C6RA 2PY5A 2P4VA 3GVMA 3L73H 2F23A 3FAVA 4JI6B 3X2QC 4DRXB 1MI1A 2DWDC 4P9PA 2HKOA 4DK1A 2D11A 2V1DA 4JTCB 2W6IG 4LF4B 2N04A 4NTWA 1KP2A 2G35A 1M56C 2QKCA 1QVFU 5LOVB 4TV8A 3BAAA 2LGWA 1VQNV 4ZRKA 1P84F 2UXCO 2YDEA 2E2XA 1R73A 1SZTA 3P7ZA 3W7UA 4X65B 1Q6HA 3QO8A 1M1KW 1KYOF 2BOCC 2YXYA 4A6HA 5DIFB 1V9PA 1XOUA 1PM9A 5LP6B 2GUZA 3A98B 4DV4B 2J0JA 2UUAB 3HKCA 3B40A 2LW7A 4AILC 4PD4F 1IRSA 3TGUH 4H44B 5BMVA 3H01A 2RLOA 4I0XB 3W7WA 1XR0B 2A3QA 2E76B 1JFFB 1BGYH 2UUBO 2I5FA 5KHIA 2K9PA 1LUWA 5HE1A 1HNXO 1OCOC 2IH3C 3E22A 2L1CA 2GTSA 2KR0A 1M56B 3BY6A 3OT7A 2QJ1A 4K0KB 4RUEA 5EZYB 3DXRA 2N05A 2XQNM 4ZOLB 1L8DA 4PV1B 4I7ZB 5JH7B 1U2BA 4O4IA 2OIGA 1PNLA 3ZMSA 4GX0A 5CBHA 4LR3A 2A79B 3SR2C 1NTYA 4HDQA 4KVGB 3RYCB 4GZUA 3U10A 3MHHC 1ENVA 5LGTA 4NTYA 1X11A 4X1KA 2BTQB 3CP1A 2QWQB 1JPXA 5EK0A 4FZ1A 4PELA 4H13B 4QJ4B 1NZ6A 1WB8A 4I4TA 5IWAO 4IHJA 1FD9A 5LHHA 5LYJB 2N74A 2RVBB 4GLXA 4GZRB 1VQ9V 4MVZA 4NXNO 4PA3A 4LWSB 1K5GB 3L70H 2FB5A 3K59A 1OCOB 4FIPC 2WLHA 3IAYA 2YICA 5ITZA 3W7XA 5LA6A 3FVCA 4YIPA
chains in the Genus database with same CATH topology
1VQ5V 1Q82W 3ABTA 1R3IC 1FXKC 1JCHA 2WAMA 5CBGA 1V55C 2JEXA 1E79G 1Q7YW 4PDLA 1THZA 5BZBA 3CCUV 4J9YB 5IYDO 3ZMUA 1H38A 3GB7C 3SPHA 4QPJA 4XDJA 3BEHA 4JAUA 1PNKA 1V54C 2Y69B 3M99B 3CC2V 2XAFA 1OHHG 4QPKA 4P2ZA 5H9CA 2IJJA 3JD2A 2WSSG 1MG1A 4GX2A 1L1FA 1M57C 3LUTB 1OCCC 2B1GA 3K3WA 4N23A 1QLNA 3TCUA 1EBOA 4JPRA 1GM9A 3JD1A 4WCEV 4UV8A 2C2AA 3F7YC 3K03A 1OCRB 4QJFB 3K06A 4TT3G 2Z5UA 1WLEA 5LHGA 4PDMA 1SERA 2DQ3A 4X8AA 1AI5A 1I5XA 3LDCA 3ZMTA 4FPPA 1NQTA 2HFEC 2B1IA 2QA4V 2XNDG 1OZ0A 1MABG 3NXSA 3G4SV 2X7RB 1PD3A 2HVKC 3OE7G 2LFSA 1S76D 1AI7A 3D36A 2BOBC 4KFMA 4PA6A 3I56V 1YTFB 2CK3G 2A9HA 2OCCC 1HWYA 2WWWA 3B77A 2YEVB 4P30A 4XBFA 1FXKB 1E1QG 4MTOA 2ATKC 3STLC 3ZRWA 3E2EA 2WLLB 2X6BA 3W7TA 1S77D 1PKXA 2DQ0A 3SJQC 1G8MA 5EC2C 3HB3B 3CCQV 2XAQA 4H37A 4J9ZB 4QE9A 2AHYA 5L3DA 3AG4C 4WFFA 1QLEC 3OEEG 1M57B 1OCCB 4JYCA 3ABLC 3GWOA 4WFAV 4MT8A 3CMEV 3OR7C 2YSUB 5B1AC 1NR1A 3WFVA 1VQ6V 4P9OA 3FYIB 5KA5A 1FXHA 2Q6AA 3FYEB 1Y4MA 3E89A 2X6CA 1K34A 3CYOA 1NBMG 2LP7A 1GM7A 2Z3YA 5EBLC 5B1BC 3CXCU 3ZRSA 1K8AW 1YIJV 4ZKIA 2H8PC 1P4RA 1J95A 2JDIG 3RBZA 4G28B 2X0LA 2Y69C 2OCCB 3QO5A 1CP9A 1JQ0A 1AJNA 4TWKA 3SYPA 3STZC 3CCRV 4JYBA 1NR7A 5GW7A 2Q69A 5CMUA 1K4DC 1M90W 3AG2C 3LDEA 1K4CC 1OCRC 1W0KG 3ZN1A 2ZQMA 2GSMB 2Y48A 3RW0A 2EIKB 4XDLA 3AG1C 4PA7A 1R6NA 4MVRA 2HG5C 4RAIA 3AG4B 1QLEB 3EHBB 2NLJC 4HZ3A 3CPWU 1G4YB 3MD0A 1S72V 3OEHG 1F51A 4HYOA 4PDVA 3ZRWB 3ABLB 4I5SA 2ITCC 1AJPA 3DTUB 5B1AB 3CMAV 1VQOV 4MW3A 4MVUA 4TSFG 3FB8C 5LHIA 2HR3A 5LGNA 4JAVA 4BIUA 2KB1A 2EINC 5KA6A 1NH2D 2WLIB 1N8RW 2OTJV 3T4DA 3OUFA 3ZIAG 2ZXWB 2XAGA 3ZCCA 1VQKV 5B1BB 4GCZA 2LFRA 1CPYA 3JD4A 1VQPV 3ABKC 4N21A 1GM8A 3ABUA 2EZOA 1YJ9V 1K33A 1GTOA 3JD0A 4FK5C 3ETEA 3K0DA 4GX5A 5DN6G 2JK5C 3OGCC 4JTAB 1BHBA 1F4MA 3FB5C 4I9WA 4JASA 3E35A 4L87A 4MS2A 4QNHB 5L3BA 3CCLV 4UXNA 1EZJA 3AG2B 3EFFK 2R9RB 4EKWA 4PA9A 2PI5A 2W6JG 2OT5A 3D3IA 3FKSG 1K97A 5B3SC 3CCEV 3AG1B 1PNMA 3DCXA 2DW4A 3HPLC 2WPDG 1RPRA 2IU3A 3T2MA 2IH1C 1VQ7V 2H94A 2IJKA 2IW5A 1K5SA 2XAHA 4R50A 1K7DA 1KP3A 5B1NA 2Q67A 4YXWG 2IJIA 2MK3A 3SPIA 2QM7A 2EINB 4H33A 1P7BA 2F43G 2UXXA 1VQ4V 5CA3A 2A0LA 1NJIW 3SYQA 3ZRXA 1S5HC 3QO7A 4BW5A 3JCZA 3G71V 1DLBA 1FS0G 1BMFG 1RPOA 3OUSA 3T4ZA 4Z1MG 3R65A 3ASNB 3ABKB 4FJCC 5IDJA 3OMNB 1H2GA 2EIKC 1JVMA 2M7WA 4FMTA 3E83A 2DYSB 2UXNA 1NKDA 4RQEA 2ZDIA 4X88A 1SETA 2R9IA 4OXSA 1ZWIC 1ORQC 1R6KA 1K92A 1Y66A 3LDDA 4LBEC 5CBFA 3ZN0A 3B8NA 1S3JA 5B3SB 1NVPD 4X89A 1KQSU 1EFRG 3QNEA 4JF3A 1COWG 2WLNA 1VQ8V 1QCEA 5J9PC 3ZRVA 3JYCA 3X2QB 2EIMC 2ZDIC 2ZXWC 1AI6A 4R7CA 3P32A 2EZPA 4WFHA 4MVMA 2ZR2A 4DO2A 1MOFA 1VQMV 2XAJA 4UVCA 3WG7C 3A0RA 2IU0A 2WLKA 2HVJC 4CBCA 1KECA 2QKSA 4MW8A 3OAAG 4LC1A 2EIJC 1K5QA 5CN0A 3ZMZA 2QEXV 5LBQA 4MSWC 3UM7A 5L3FA 1YJNV 3ZJZA 5HFLA 3CCMV 1FXVA 1ROPA 2ZR3A 2ITDC 3AG3C 3I55V 2HLDG 1R3KC 3K9AA 3OM3B 4MVSA 2QE7G 3SPCA 4F4LA 1QR9A 1W2BU 4MVOA 4KUMA 3OFNG 4G2KA 1YI2V 4MVQA 3DGEA 1KKDA 5DM6V 3CCSV 4XDKA 3TK1A 1F4NA 3G6EV 3VBBA 5IYCO 2P7TC 2JEUA 2EIMB 3TETA 5LGUA 2WLLA 4QIWF 2XOKG 4LP8A 3B8MA 1KD1W 4E2LA 1KC8W 1S0VA 1JX9A 3ASNC 3F7VC 4BAYA 3SYAA 5H6RA 1LNQA 4PDRA 3WG7B 4RUFA 3LSQA 4UVBA 2Q68A 1QVGU 2DYSC 3CCJV 5L3GA 1AI4A 4HAMA 1QR8A 1SRYA 3ETGA 4BIZA 1TUEB 2EIJB 1K9MW 3F5WC 4R8CA 1UJWB 3K0GA 2P67A 2QM8A 3P30A 5IYBO 5L3EA 1K73W 5E1AC 3E8GA 5L3CA 1RM1C 4MTGA 4UV9A 3AG3B 2K1EA 2WLJA 5HFMA 2D3OW 1F23A 2B5UA 4GX1A 4WF9V 1JJ2U 2ZD9A 3X2QC 5EBMC 1AR1B 3VOUA 1B6QA 2DWDC 4P9PA 1SESA 2HKOA 2V1DA 3ASOC 4ASUG 4JTCB 4UVAA 5KUKA 4ZBMA 2AHZA 2W6IG 1JOYA 4WFEA 5EBWC 1KP2A 4U7OA 3T1CA 2JJ1G 2PI4A 1M56C 5FL7G 3HSAA 2EILC 3OR6C 1DF5A 1NH2B 1QVFU 3ZMVA 3SPGA 2HJFC 4RO2A 3K79A 1VQNV 1DF4A 1R73A 1SZTA 2DYRC 5KUMA 4JGSA 4KP4A 1YHQV 4G27B 3W7UA 3CC4V 3IGAC 3OW2U 2IJHA 4WFGA 3W7SA 1PL0A 4DXWA 1GK9A 3QO8A 3ABMC 3FB7C 4LCUC 3CCVV 2BOCC 1M1KW 3KG2A 5H6QA 3CC7V 4MTXA 1V55B 2W0FC 4GT1A 4UUJC 3UKMA 1CEZA 4QE7A 2JJ2G 1I5YA 1RM1B 4PA4A 1FFTB 5EC1C 3AEIA 3H01A 3RVZA 3ML0A 3W7WA 2XASA 2QTOA 1V54B 4Q20A 1DTOA 3MHSC 2EBOA 2WLIA 1XL6A 5C93A 2JIZG 2V7QG 3LNMB 3ASOB 1GMGA 4R6ZA 1OCOC 2IH3C 3SYCA 1OCZC 4JTDB 1W0JG 1VQLV 3OMAB 1M56B 3BY6A 2EILB 5IY5C 2FTKA 1R3LC 3JD3A 1H8HG 3K04A 1Q81W 4RUEA 1QBZA 2DYRB 3E8BA 1YITV 1AJQA 3K08A 3CD6V 3IC7A 4CZZA 1PNLA 3ZMSA 1R3JC 4GX0A 3SPJA 5CBHA 3ABMB 1AROP 2A79B 5B1OA 2WLMA 1WPXA 1K3EA 3PJSK 3LSSA 3MHHC 1ENVA 5LGTA 4WFBV 2P90A 1GKFA 3IFXA 2NNUA 3CP1A 1JPXA 1XL4A 3SYOA 5EK0A 1IXMA 1NVPB 4PELA 1E1RG 1YJWV 1MSWD 2YEVA 2DWEC 1M9NA 4MTFA 1FXKA 3E8FA 5LHHA 2EJRA 1BHAA 4U7NA 1H8EG 3RVYA 3E8HA 1VQ9V 2OTLV 4MVZA 1BL8A 1YSCA 4PA3A 2P6JA 3E86A 4RQFA 1OCOB 4FIPC 2WLHA 1GO3F 1OCZB 3ETDA 2X6AA 3W7XA 3FB6C 3OMIB 5IY5B 2GHYA 1YTFD 1Q86W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y66 A;  3CP1 A;  1EBO A;  3WFV A;  4JPR A;  1JPX A;  3B8N A;  3HSA A;  1I5Y A;  5CMU A;  5KA5 A;  3P30 A;  1DF5 A;  5KA6 A;  2OT5 A;  5CN0 A;  4JF3 A;  1DLB A;  3H01 A;  1QBZ A;  1QCE A;  4N23 A;  1Y4M A;  3DCX A;  1K34 A;  1DF4 A;  1I5X A;  3CYO A;  5HFL A;  2LP7 A;  5HFM A;  1SZT A;  3MHS C;  2EBO A;  3B8M A;  4JGS A;  4FJC C;  1F23 A;  2X7R B;  3M99 B;  2M7W A;  4E2L A;  2P6J A;  3K9A A;  4N21 A;  2EZP A;  2EZO A;  1QR9 A;  1K33 A;  4FIP C;  4FK5 C;  1MOF A;  4G2K A;  5H9C A;  1JQ0 A;  3MHH C;  1MG1 A;  1ENV A;  3GWO A;  3B77 A;  1QR8 A;  2MK3 A; 
#chains in the Genus database with same CATH topology
 1Q82 W;  1AQC A;  1R3I C;  2WAM A;  3WU2 Z;  1V55 C;  1MIX A;  5BZB A;  3CCU V;  4O2B B;  2RGN B;  1L0N H;  1I0H A;  1V5P A;  4QPJ A;  4HAV B;  4XDJ A;  2Z0Q A;  1KUQ A;  4JAU A;  1V54 C;  3M99 B;  2F4V O;  1O9G A;  1OHH G;  4QPK A;  1P6S A;  4P2Z A;  1QLN A;  2LOX A;  3RGB A;  1GM9 A;  3A2F A;  2CTR A;  4YJ3 B;  5LXT A;  1BT8 A;  5IRS A;  1YDX A;  4X66 B;  4NXM O;  2Z0A A;  1VEW A;  1HNZ B;  2DQ3 A;  4X8A A;  2HFE C;  5LON B;  2QWR B;  1WVH A;  3DXE A;  2XND G;  3G4S V;  4X1Y A;  1NTM H;  3U12 A;  1SS3 A;  1AI7 A;  5GON B;  3K5L A;  4B3S O;  3I56 V;  4DR3 B;  2A9H A;  4BW9 A;  4HDO A;  3B77 A;  4QGP A;  4P30 A;  3QVN A;  4IIJ B;  2WLL B;  4O4L A;  2X6B A;  3W7T A;  1JA8 A;  4DUY B;  3J7A U;  2VWJ A;  1D5N A;  3WB2 A;  2GTA A;  1XNR B;  1PLS A;  3SDL A;  3HB3 B;  3CCQ V;  2XAQ A;  1WG7 A;  4QE9 A;  2AHY A;  4NKG B;  3A8T A;  3HKB B;  5EIB D;  3HW2 B;  1BTK A;  1V88 A;  3L72 H;  4WFA V;  3CSX A;  1WNS A;  4KHO A;  1J19 A;  5KA5 A;  4K8X A;  1RFY A;  2GV9 A;  4HB2 B;  4JI0 O;  1KZG A;  2FL4 A;  4CYE A;  1J5E B;  4B3T O;  3E89 A;  3EXA A;  1G1X B;  1GM7 A;  4TV9 A;  5EBL C;  3KRX A;  3TXQ A;  2EJ7 A;  3ZRS A;  1K8A W;  1N3H A;  2YXH A;  4A6F A;  2JDI G;  1I94 B;  4DV0 O;  2P4K A;  4DUZ O;  2GCL A;  3CCR V;  2KG7 B;  3PEG A;  3B2E E;  2FYU H;  4LNU B;  3L71 H;  1XNQ B;  1ZX3 A;  1I2H A;  1W0K G;  3RW0 A;  4GKJ B;  5EYP B;  2P22 C;  4XDL A;  3DXC A;  4MVR A;  1BCC H;  4YHH B;  3IVF A;  1AR4 A;  1M93 A;  2AGA A;  1BWN A;  3MD0 A;  2CH7 B;  4NVP A;  3N2G B;  4HB0 B;  1X1G A;  4I55 B;  3CMA V;  1N34 B;  4OPA A;  2ZKM X;  4GXB A;  4TSF G;  2HR3 A;  5LGN A;  2L6L A;  2DKP A;  2JP2 A;  1GG3 A;  5KA6 A;  1XMQ B;  3VQW A;  1NH2 D;  4NTX A;  4C0A A;  3ZIA G;  1S5L Z;  4DR4 O;  2XAG A;  5TIS Z;  1VQK V;  3NW8 A;  5AG2 A;  4GCZ A;  1EM1 A;  3SO6 A;  3JD4 A;  4X1I A;  4LFA O;  2EZO A;  3CJH B;  1K33 A;  3ETE A;  3OGC C;  1F4M A;  3DC6 A;  4JAS A;  4L87 A;  4QNH B;  1NT2 B;  1YXB A;  4J7J A;  2COD A;  2GCJ A;  1HR0 O;  2EJ8 A;  2R9R B;  4PA9 A;  2OT5 A;  3D3I A;  3FKS G;  4CS2 A;  4OX9 O;  1V5M A;  4Q6G A;  1R6T A;  3DCX A;  2DW4 A;  2F93 B;  2IU3 A;  3UT5 A;  2UXC B;  2GBO A;  1T77 A;  3JCU Z;  2BCJ A;  2PYL A;  1KU9 A;  1R1B A;  1XI1 A;  4DR5 O;  4H33 A;  1P7B A;  2F43 G;  4O4H B;  3JCZ A;  1DLB A;  3U8Z A;  2YIA A;  1ZL8 B;  1RPO A;  3OUS A;  1TA8 A;  4J80 A;  3C90 A;  4C7U A;  5IDJ A;  1BAK A;  5D5P A;  4GN1 A;  4FM0 A;  4RQE A;  2ZDI A;  3VQX A;  4H8S A;  1Z5V A;  4K2P A;  2R9I A;  1N32 O;  1J0W A;  2L2I A;  5FI1 A;  1K92 A;  2LG1 A;  4NR1 A;  1EN4 A;  4K81 A;  2ZIM A;  3LDD A;  2Y8G A;  5CBF A;  3CB2 A;  4AQY O;  3B8N A;  3VIA A;  1BZK A;  4X89 A;  2ZM6 O;  5HE0 A;  1EFR G;  1TJ6 A;  1VQ8 V;  1IDS A;  3ULB A;  1WAZ A;  4MT7 A;  1AR5 A;  1Q8I A;  2EZP A;  2Q8V A;  1H2L A;  4WFH A;  5A9G A;  4UVC A;  1MAI A;  3A0R A;  1H10 A;  4JYA O;  2QKS A;  4MW8 A;  2KQX A;  5M4Y B;  4LC1 A;  3MAQ A;  2NBV A;  5CN0 A;  3ZMZ A;  2QEX V;  1RSO B;  5J2U A;  3UM7 A;  5L3F A;  3ZJZ A;  2YIB D;  1M7R A;  3H1K H;  5IWA B;  3RYF A;  4LF9 O;  2ITD C;  4TOI A;  1WA8 A;  3HKD B;  5GOW B;  2XUM A;  1R3K C;  2QE7 G;  4NXN B;  1ZTE A;  5GTI Z;  1SGH A;  3K5O A;  3OFN G;  1YI2 V;  2ZNJ A;  2AZ2 A;  3FM8 C;  4YJ2 B;  5LMN O;  4Z2W A;  4O4J A;  4LF7 B;  2NR5 A;  1IVS A;  4ZHQ B;  4Z2M B;  4J11 A;  3B8M A;  3V5W A;  4IGG A;  1KD1 W;  1KC8 W;  3ASN C;  3F5T A;  4UB6 Z;  2UZS A;  3SYA A;  1LNQ A;  2Q7G A;  4PDR A;  1YCI A;  2ILM A;  2Q68 A;  2F4V B;  1LR1 A;  3A0B Z;  4HAM A;  1QR8 A;  2CY4 A;  3KSY A;  1GN3 A;  1YEW A;  4R8C A;  4JI7 O;  1ZAU A;  3P30 A;  1K73 W;  4UCT A;  1IBK O;  2BTO A;  5L3C A;  1SF9 A;  1RM1 C;  4UV9 A;  2K1E A;  2WLJ A;  3LSU A;  4FFB B;  4NXM B;  2DHJ A;  4IFS A;  2D3O W;  4LH6 A;  2Q13 A;  1F23 A;  4JAA A;  2B5U A;  3K9S A;  4WF9 V;  2ZD9 A;  4J41 A;  1HP8 A;  5EBM C;  3JAT B;  1AR1 B;  1SES A;  3RN4 A;  3ASO C;  4X64 O;  2YID A;  4UVA A;  4B3S B;  2P5O A;  1SA0 B;  1Y76 A;  5IJ0 A;  5EBW C;  4U7O A;  5FL7 G;  1PP9 H;  3HSA A;  2EIL C;  1DF5 A;  2KIG A;  4ZI7 A;  2AL6 A;  4J7Z A;  4GUN A;  1Z5W A;  1DF4 A;  3J80 N;  1U96 A;  5KUM A;  4DR7 O;  4KP4 A;  3CC4 V;  1U5D A;  3OW2 U;  4B3M O;  2Y4T A;  4DXW A;  4LFB O;  4KXR A;  1GK9 A;  3CCV V;  1DDV A;  4LCU C;  2I1J A;  2UZR A;  5JVD B;  1TUB B;  3CRA A;  5KCV A;  1FGZ A;  3CXH F;  3JAW A;  1DDM A;  2JJ2 G;  1RM1 B;  4HAY B;  5EC1 C;  1X4T A;  5KHK A;  2EMS A;  1XHX A;  3BCC H;  3ML0 A;  4GYC B;  2PUS A;  2XAS A;  4JI0 B;  1NI2 A;  1I7A A;  3MHS C;  3N2K A;  4B3T B;  5C93 A;  2VQE O;  2KIE A;  2JIZ G;  3LNM B;  3ASO B;  4TKN A;  4WBN A;  3SYC A;  3APQ A;  3RYH A;  1OCZ C;  5KX5 B;  3CXB B;  4I9Q A;  1FAF A;  1E5W A;  2EIL B;  1R3L C;  4TUY B;  2KSD A;  3K04 A;  1Q81 W;  2COC A;  3NWA A;  5B5E Z;  3FAV B;  2D2C B;  3E8B A;  2ZIN A;  3AK3 A;  3T1H O;  3K08 A;  1IX9 A;  4CZZ A;  1W1D A;  1R3J C;  3SPJ A;  2HP8 A;  2YRY A;  3M1I B;  1FFX A;  3EVK A;  1U5F A;  1IBM O;  5DED A;  2LUL A;  4TV8 B;  3HR0 A;  4CH3 A;  2P90 A;  1GKF A;  2KKW A;  1XL4 A;  1IXM A;  1VIB A;  5E79 Z;  4CH4 A;  1MSW D;  3G9W A;  1M9N A;  3CS5 A;  1H8E G;  3GWK C;  5C8Y A;  4DR4 B;  4UCU A;  4EFE A;  1BL8 A;  1YSC A;  2NMB A;  2GUZ B;  2LGQ A;  2J0M A;  3E86 A;  2E5L O;  3MPX A;  1GO3 F;  1OCZ B;  3ETD A;  2X6A A;  3HKC B;  1TQZ A;  4D0N B;  3FB6 C;  3OMI B;  3ODO A;  2VWK A;  5BMV B;  2QKM A;  1XUQ A;  1XRE A;  5CBG A;  1E79 G;  4CHJ A;  4PDL A;  1HR0 B;  4X62 O;  2W2W A;  2QM4 A;  3ZBH A;  2YS8 A;  4OX9 B;  4JI8 O;  5LG4 B;  2ROV A;  1H38 A;  2QTS A;  1KMI Z;  4GNK B;  3BEH A;  1PNK A;  2Y69 B;  1GH6 A;  2Z4D A;  2XAF A;  4L6E A;  2JRI A;  3Q4H A;  5H9C A;  3JD2 A;  3GYP A;  4EB6 B;  3DXR B;  1M57 C;  4OT1 A;  2JGU A;  1XX0 A;  4Z2N A;  1EBO A;  3JD1 A;  4DR5 B;  5FNV A;  3K03 A;  4PI2 A;  4QJF B;  5KQ4 A;  3K06 A;  2YT1 A;  4TT3 G;  2Z5U A;  3ZHV A;  5LHG A;  4PDM A;  3CWB H;  3DC5 A;  1SER A;  5D3Y A;  1I5X A;  2P06 A;  4FVM A;  1NQT A;  5IT9 N;  2QA4 V;  4I50 A;  3CRQ A;  2X7R B;  4X1K B;  2GS0 A;  2LFS A;  1WGU A;  4KFM A;  3QG5 A;  3D8E A;  3TCA A;  2HHH O;  4I4T B;  2WWW A;  3O9O A;  4XBF A;  4IHJ B;  4F7H A;  4FLT A;  1N32 B;  4MTO A;  4GOU A;  4CC5 A;  3VQV A;  4AQY B;  3D8C A;  4MK0 A;  5J3Y A;  2ZM6 B;  3X23 A;  5ITZ B;  1UNR A;  5LA6 B;  3H1I H;  1V5U A;  4KHA A;  4H37 A;  5L3D A;  3AG4 C;  3J81 N;  4WVF B;  1OV9 A;  1M57 B;  4GMV A;  3CME V;  2YSU B;  1NR1 A;  1URF A;  2KGX B;  3FYI B;  1FYJ A;  1JR9 A;  4NSW A;  1DK1 A;  5CLL B;  2UU9 O;  1Y4M A;  3CYO A;  5JQG A;  1NU2 A;  3ZVR A;  2VQF O;  3JAR A;  1FGY A;  2R72 A;  2RSG A;  1MMM A;  5LXT B;  3QO5 A;  5DH9 B;  1JQ0 A;  4PNK A;  3SYP A;  4J42 A;  1MK7 B;  1ZM0 A;  4L1R A;  2B9Z A;  1NR7 A;  1Y19 B;  3DXD A;  1K4D C;  3RCP A;  5KLV H;  4U3F H;  3OAN A;  4X1Y B;  1H2K A;  2YUA A;  1TAE A;  2ZQM A;  2GSM B;  5CB4 A;  3AG1 C;  2H7E A;  1MK9 B;  3AG4 B;  3EHB B;  3CPW U;  1LW3 A;  1G4Y B;  1Q90 D;  5HE2 A;  3OEH G;  1F51 A;  4PQ0 A;  2ITC C;  1AJP A;  3DTU B;  1VQO V;  2BSK A;  4MW3 A;  1UPQ A;  3RWR D;  4L8J A;  5LHI A;  1F7Y A;  3JAS A;  1M5I A;  2QKA A;  2EIN C;  5LP6 A;  2WLI B;  1WJ1 A;  4JI7 B;  3T4D A;  4P7I A;  2ZXW B;  3ZCC A;  3NSU A;  2E74 B;  2FJU B;  1WN7 A;  4DR1 O;  2E3C A;  3B4S A;  1KKC A;  1QNM A;  4RWU A;  5KHH A;  1CPY A;  2DKQ A;  3ABK C;  1GM8 A;  1YJ9 V;  5DN6 G;  4FK5 C;  3PVU A;  4EMO A;  2JK5 C;  1BHB A;  1X86 A;  1Q3E A;  2X18 A;  3FB5 C;  4MS2 A;  4CSQ A;  4X64 B;  5L3B A;  2W2X D;  3O96 A;  3UO2 A;  3A8Q A;  4A6K A;  2ZT9 B;  2K2U A;  5B3S C;  1H4R A;  2N0Y A;  3AG1 B;  1PNM A;  4CS3 A;  5D27 A;  1N33 O;  3HPL C;  2WPD G;  4LF5 B;  2P0D A;  4K35 A;  1DRO A;  3T2M A;  2IH1 C;  4DR7 B;  1SC5 B;  5H2F Z;  3FD9 A;  3P6A A;  2IW5 A;  1OMW A;  4B3M B;  4R50 A;  5KMG A;  2FKX A;  1K7D A;  4DX8 A;  5B1N A;  2DYQ A;  4ZIB A;  2RMK B;  4DV5 O;  3FX7 A;  2MK3 A;  2QM7 A;  4B7E A;  1SQV H;  2EIN B;  3P3P A;  2A0L A;  2HEP A;  1MZE A;  2LQT A;  1NJI W;  2L35 A;  2Q5Z A;  1WJM A;  4J10 A;  4BW5 A;  1GC6 A;  4K8Z A;  1W59 A;  3T4Z A;  1AP6 A;  4DV7 B;  1FOE A;  4Z1M G;  2RCV A;  3BRC A;  3ABK B;  1JMK C;  1ZC4 B;  1H2G A;  2ZE5 A;  3AU4 A;  4KHB B;  2F1M A;  3KCY A;  4JI5 O;  4X20 B;  1NTV A;  1ZWI C;  1ORQ C;  1QU7 A;  1R6K A;  4CH6 A;  1V89 A;  3H1J H;  3JAK A;  3SJA C;  1W1G A;  5J2T A;  2IFS A;  5B3S B;  5KAF Z;  4JI4 B;  4LF6 B;  1KQS U;  4X1I B;  4F7G A;  1COW G;  3JYC A;  2QGN A;  2ZDI C;  2HTH B;  4O2B A;  1ZSP A;  4GKK O;  1VQM V;  5JP4 A;  3WG7 C;  1HW7 A;  3CRM A;  2HVJ C;  4BWA A;  2WA4 A;  2V4D A;  4QXA B;  5H5N A;  1VF7 A;  3K5N A;  2EIJ C;  2JGD A;  1K5Q A;  1XD4 A;  1YJN V;  4JI3 O;  5HFL A;  3BAB A;  3CCM V;  2ZR3 A;  2IBZ H;  3I55 V;  2ADZ A;  2D9X A;  2HLD G;  3K9A A;  1VF5 B;  1WJZ A;  4MVS A;  3SPC A;  4B3R O;  1Q6I A;  4JV5 O;  1N4C A;  3AJ4 A;  4KUM A;  1BQ0 A;  1VF6 A;  4G2K A;  4HNA B;  2E5L B;  2P0F A;  1XMO B;  4B6H A;  4FLX A;  5CA0 A;  2K00 A;  4MVQ A;  5GON A;  3DGE A;  3KZI Z;  4XDK A;  3TK1 A;  1F4N A;  3G6E V;  5IYC O;  3HK0 A;  4BBK A;  4O2A A;  5LGU A;  2WLL A;  2ZKO A;  4X62 B;  2ADQ B;  2QR4 A;  5LL6 Y;  2DN6 A;  3ETQ A;  4JI8 B;  2UUC B;  1XKE A;  1S0V A;  4E2L A;  3PP2 A;  2F66 C;  3WG7 B;  5IE9 A;  4LF8 B;  3VQY A;  1QVG U;  3CCJ V;  1O9H A;  1UFI A;  1WP7 A;  5L3G A;  2CAZ C;  2IM9 A;  1TUE B;  1UPR A;  2EIJ B;  1GN4 A;  1K9M W;  1GN6 A;  1UJW B;  2P67 A;  5IYB O;  4DYL A;  3PVL A;  3E8G A;  3TJT A;  2M38 A;  3FFQ A;  4MTG A;  1TGO A;  1FB8 A;  1QC6 A;  5HE3 A;  1OY2 A;  2DN9 A;  2Z13 A;  3JAM N;  1EAZ A;  3F0W A;  5CLQ B;  3K57 A;  4GX1 A;  3VOU A;  4ASU G;  4ZBM A;  2QWP B;  1HDJ A;  1IBL O;  1ZYI A;  2AHZ A;  5J2U B;  1NI8 A;  1JOY A;  3L75 H;  2HHH B;  3T1C A;  2JJ1 G;  4IAP A;  3RYF B;  2PI4 A;  3OR6 C;  1WA8 B;  3K79 A;  2YS3 A;  2YT0 A;  3PG7 A;  1W1H A;  2DYR C;  1IZ3 A;  2FJL A;  4G27 B;  3IGA C;  4F6R B;  2IJH A;  3FEH A;  4EJN A;  3W7S A;  5EYP A;  4JZG A;  5I2S A;  3ABM C;  2DMX A;  2UUB B;  3K5M A;  3HIE A;  3KG2 A;  3CE2 A;  1FPO A;  4O4J B;  3CC7 V;  1HNX B;  2W0F C;  4UUJ C;  4QE7 A;  3WB1 A;  1KBH A;  4I55 A;  1VMG A;  2Z14 A;  4E4E A;  3BHP A;  4F7U P;  3RVZ A;  4QJ5 B;  1XHZ A;  1OJH A;  1DTO A;  4DR2 O;  2UU9 B;  3SNH A;  5C5B A;  3O65 A;  2VQF B;  2CDY A;  2YIB A;  4DV4 O;  3H1L H;  3M8A A;  1W0J G;  4KAX B;  1GN2 A;  3CJH A;  5IY5 C;  2FTK A;  4U3J A;  1EF1 A;  1H8H G;  2XTA A;  5BR8 O;  2G38 A;  4FLZ A;  1QBZ A;  2FML A;  2DYR B;  3WYF B;  1AJQ A;  3UCS C;  3CD6 V;  3ABM B;  1ARO P;  2RNR B;  1Y76 B;  1XIL A;  5IJ0 B;  1RP3 B;  2WLM A;  1SZX A;  1K3E A;  3PJS K;  3ODX A;  3LSS A;  5D3X A;  4ZI7 B;  2BCC H;  5JHH A;  1Q67 A;  5LOP B;  1XCG A;  1NVP B;  2YEV A;  1N0N A;  2DWE C;  1BHA A;  1FXK A;  2GJY A;  2QDO A;  4XWX A;  1YVW A;  2ZCE A;  3RVY A;  3K58 A;  3CRR A;  2DTC A;  3G80 A;  5B66 Z;  2OQB A;  4ABM A;  1UEF A;  5IY5 B;  1YTF D;  3OGI B;  3G6B A;  3RT3 C;  3ABT A;  1G6U A;  3KCX A;  4HB3 B;  3HQC A;  2RQ6 A;  4FM2 A;  1JCH A;  3N2K B;  1NU1 H;  1Q7Y W;  4ICG A;  4WBN B;  3GB7 C;  2D4Q A;  3JAL B;  3RYH B;  2PTM A;  1N33 B;  1UPG A;  1YZB A;  3OTF A;  3CC2 V;  2EMT A;  3TW1 A;  2IJJ A;  2WSS G;  1MG1 A;  2ROZ B;  3BJI A;  2DOS A;  2WA3 A;  3LUT B;  1OCC C;  2DHI A;  5C79 A;  2P0H A;  3A58 A;  3ZHU A;  4FLU A;  4JPR A;  1N36 O;  4WCE V;  2CTP A;  1X1F A;  3F7Y C;  2R0D A;  2Q7E A;  1OCR B;  2QWO B;  5CA1 A;  1WLE A;  2EX3 A;  5JJJ B;  3JSL A;  3AK1 A;  1FFX B;  2RJZ A;  2ZE6 A;  2OWO A;  5D5Q A;  3ZMT A;  2Q73 A;  4EKU A;  2B1I A;  4CC6 A;  1OZ0 A;  2I5C A;  1PD3 A;  3OE7 G;  4DBB A;  1Y5O A;  3NWF A;  1DBH A;  3KY9 A;  1S76 D;  3D36 A;  2BOB C;  4PA6 A;  4FLW A;  3HKD A;  5IYZ A;  2CK3 G;  1HWY A;  4BIO A;  1IUR A;  4X66 O;  4JI5 B;  3RFR A;  3ZRW A;  3STL C;  2ATK C;  2M6Y A;  3E2E A;  4NB5 A;  2R2Y A;  1PKX A;  2CE4 A;  2DQ0 A;  3SJQ C;  3DSQ A;  1SQQ H;  1A32 A;  1XBL A;  3CHX A;  4YL8 A;  4D6W A;  4WFF A;  4ZHQ A;  1OCC B;  4JYC A;  2AZ0 A;  3GWO A;  4YIO A;  1H2N A;  2KUQ A;  4MT8 A;  2LO1 A;  3OR7 C;  1XEQ A;  4DV0 B;  1VQ6 V;  2YI8 A;  1BQZ A;  2VRW B;  1FXH A;  4DUZ B;  2Q6A A;  3FYE B;  1SHC A;  2V76 A;  5LMU O;  5A2Q N;  4HAX B;  1K34 A;  1TVK A;  2LP7 A;  3Q4H B;  2Z3Y A;  1M7E A;  1RJ2 A;  2MKR A;  3GYO A;  3T06 A;  2R70 A;  4JI3 B;  1Q5O A;  5B1B C;  2Z0O A;  3CXC U;  4DV1 O;  1JJO A;  2K8E A;  1YIJ V;  2ARH A;  4ZKI A;  1P4R A;  3ZHS A;  1Y74 A;  3RBZ A;  1I7F A;  4G28 B;  2X0L A;  2Y69 C;  5FNV B;  5JWP A;  4FM1 A;  4IYH A;  1TXD A;  1GRJ A;  1QQC A;  2Z59 A;  4NY0 A;  1AJN A;  4TWK A;  4B3R B;  4JI1 O;  2VKI A;  3STZ C;  3ML4 A;  3JAT A;  1SQB H;  4JYB A;  5GW7 A;  2Q69 A;  5CMU A;  3U0Z A;  4J7K A;  4CH5 A;  3UZT A;  1H2S B;  1U5E A;  3RYI A;  2YVC A;  2UXB O;  2EIK B;  1KI1 B;  4PA7 A;  1R6N A;  2R9A A;  2HG5 C;  2Y0I A;  4RAI A;  4D7S A;  1K5D B;  4HYO A;  2LJ2 A;  4PDV A;  4I5S A;  5D3W A;  2J0K A;  4LFA B;  1FJG O;  4MVU A;  3FB8 C;  1XNQ O;  2ELB A;  4JAV A;  2KB1 A;  2XT9 A;  1NTK H;  1N8R W;  3OUF A;  4YHH O;  4QJ3 B;  1EGX A;  5B1B B;  2LKO A;  3E22 B;  5JCO A;  1BS3 A;  2D10 A;  3ABU A;  4EEQ A;  1EVH A;  1GTO A;  3JD0 A;  2QSA A;  4JTA B;  3T1Y O;  2ZPY A;  3E35 A;  3HKE A;  4PHZ A;  1DGS A;  4UXN A;  1EZJ A;  1IBL B;  3BA9 A;  4O4I B;  2PI5 A;  1EN6 A;  2W6J G;  3JAR B;  4BR6 A;  3CCE V;  1N0J A;  1KZ7 A;  3PVW A;  3BPZ A;  1MPH A;  1PV0 A;  1AP5 A;  5GTH Z;  2H7D A;  2IJK A;  5DHA B;  2XAH A;  1FHX A;  2HJD A;  3KKY A;  3A0H Z;  2Q67 A;  4YXW G;  1WGQ A;  2IJI A;  3SYX A;  2VS0 A;  5CB4 B;  3CRC A;  1VQ4 V;  5CA3 A;  2JS3 A;  3SYQ A;  3P3N A;  1S5H C;  3G71 V;  4PJ0 Z;  1ZLZ A;  4IT5 A;  4IOY X;  1BMF G;  2D9Z A;  3R65 A;  4X9Q A;  3U7D A;  4B08 A;  4FJC C;  2BSK B;  3OMN B;  3UO3 A;  3C3T A;  4FMT A;  4DR2 B;  1P7G A;  2DYS B;  3JAS B;  4X88 A;  4KHP O;  1MKE A;  1SET A;  5EIB C;  2AW9 A;  4OXS A;  4HAW B;  4LH7 A;  4HAT B;  2H3O A;  4JI2 O;  1S3J A;  2CAY A;  1S5J A;  3SUZ A;  1B3Q A;  3PN1 A;  4JYA B;  3THO A;  3QNE A;  4JF3 A;  3L9D A;  2CUG A;  5IJ9 A;  5BR8 B;  3AU5 A;  3X2Q B;  2EIM C;  2ZXW C;  3ZED A;  3NWD A;  4LF9 B;  4MVM A;  2ZR2 A;  2KUP A;  3QIJ A;  1MOF A;  3F5R A;  2MDX A;  4K2O A;  2YT2 A;  4UCR A;  3QF7 A;  4CBC A;  3JSN A;  4DRX A;  4EB6 A;  2YSZ A;  4CS4 A;  5LMN B;  4ZRJ A;  5KMG B;  3AG3 C;  5LOV A;  3OM3 B;  1QHT A;  4F4L A;  4MVO A;  1WI1 A;  5BXZ A;  1PMS A;  4O4L B;  3AG7 A;  3ICX A;  4FLY A;  2CRF A;  4WJ7 A;  4D7T A;  2DYN A;  3TO1 A;  5DM6 V;  3H9V A;  4DIX A;  2P7T C;  4OPH A;  1XOD A;  4AI8 A;  2JEU A;  2EIM B;  3TET A;  2DLW A;  1IBK B;  4QIW F;  2XOK G;  2RN9 A;  1HNW O;  4LFC O;  4HAU B;  1VF6 C;  2RRF A;  5L81 A;  1JX9 A;  3JAK B;  5J2T B;  4I0X A;  1NS1 A;  5H6R A;  3SGI A;  2PZ1 A;  1JFF A;  4UVB A;  2NN4 A;  2ELA A;  1FHW A;  1AI4 A;  4BIZ A;  2EUL A;  4LF7 O;  1ZC3 B;  1SQX H;  2ZNI A;  5L3E A;  2QM8 A;  4TV9 B;  1ISN A;  5E1A C;  1N36 B;  3G67 A;  4FLV A;  4A6F B;  3AG3 B;  2LOZ A;  3S3X A;  2UXD O;  3SJC C;  3ZHR A;  5EZY A;  3LJU X;  1JJ2 U;  4ZOL A;  2A06 H;  2D9V A;  4OSN A;  1B6Q A;  5JH7 A;  4GMX B;  2W0X A;  2JGD B;  4W4K A;  1U5G A;  4LFB B;  1Y6X A;  5KUK A;  5FI0 A;  4KL1 A;  4WFE A;  1NTZ H;  3RYC A;  1NH2 B;  4YY3 O;  3ZMV A;  3SPG A;  4ZRI A;  2HJF C;  2CTW A;  4RO2 A;  2BTQ A;  2HE7 A;  2MFQ A;  2D2Q A;  2RUK B;  4JGS A;  1YHQ V;  5BY1 A;  1AB3 A;  4WFG A;  5CA0 B;  5LYJ A;  1PL0 A;  2Q4P A;  1WPB A;  4DR6 O;  3FB7 C;  2Q0O C;  2VQE B;  1LUV A;  5H6Q A;  3CIK A;  4A5U B;  4LWS A;  4K3A A;  1V55 B;  4MTX A;  2NZ8 B;  4GT1 A;  4O2A B;  1D2D A;  3UKM A;  2E75 B;  1CEZ A;  4HB4 B;  2UVM A;  4MY6 A;  5JJN B;  1I5Y A;  3WB0 A;  4PA4 A;  1FFT B;  4JYY A;  4UCO A;  2EC1 A;  3AEI A;  1BSM A;  4YON A;  2QTO A;  1V54 B;  5LMU B;  5K1X A;  4Q20 A;  2BE3 A;  4HAZ B;  4CHM A;  2EBO A;  2WLI A;  1XL6 A;  4HSI A;  3T1H B;  2V7Q G;  3L74 H;  2Y8F A;  1GMG A;  4DV1 B;  4R6Z A;  4WSF A;  3WA0 A;  4JTD B;  1VQL V;  3OMA B;  1IBM B;  3BVO A;  4JI1 B;  2DJV A;  3JD3 A;  4A5K A;  2P8V A;  4W4L A;  2PYJ A;  3UT5 B;  2A7W A;  4DV2 O;  2AEH A;  4UCV A;  1XDC A;  2Y7B A;  1YIT V;  4YJ3 A;  4GPT B;  3IC7 A;  4B7K A;  1US6 A;  4DV6 O;  2UXB B;  1L0L H;  4DW0 A;  1ZVR A;  2DA0 A;  4HHV A;  2K2J A;  3I5D A;  2XHB A;  1MZF A;  5B1O A;  1WPX A;  5F2V O;  4WFB V;  3IFX A;  2NNU A;  2ZE7 A;  1FHO A;  4DV3 O;  1FJG B;  3SYO A;  1B55 A;  1E1R G;  3APO A;  3KRW A;  1YJW V;  2PF4 E;  2PGG A;  4MTF A;  3E8F A;  3IC9 A;  2EJR A;  2DFK A;  4U7N A;  4IIJ A;  3E8H A;  2OTL V;  1P5T A;  5FPR A;  3OTO O;  2P6J A;  4RQF A;  1XQ8 A;  1AVM A;  1VP7 A;  3QWM A;  2Y0P A;  3CEI A;  4UB8 Z;  2MWN B;  2GHY A;  3S3W A;  1Q86 W;  3HKB A;  3T1Y B;  1SQG A;  1VQ5 V;  4KHB A;  5J3T A;  4TQF A;  4X20 A;  1WB7 A;  3ODW A;  1FXK C;  2JEX A;  1RRP B;  5C5B B;  2JVD A;  5C16 A;  1THZ A;  3AK2 A;  4J9Y B;  1Z2G A;  2O57 A;  5KHJ A;  5IYD O;  1MA1 A;  3ZMU A;  3A8P A;  3SPH A;  3ZS8 C;  3TFM A;  5DEC A;  4U3J B;  3BA8 A;  1BTN A;  4GX2 A;  1L1F A;  2B1G A;  3K3W A;  1U97 A;  4N23 A;  2QWN B;  3TCU A;  1ZUQ A;  1U29 A;  4UV8 A;  2C2A A;  2OIE A;  3R66 A;  1Y67 A;  1YF2 A;  2Z0P A;  2KG7 A;  1AI5 A;  1FKA O;  3LDC A;  4FPP A;  1Q43 A;  4LNU A;  3MDS A;  4JI6 O;  1UNQ A;  1MAB G;  3NXS A;  2VRZ A;  2HVK C;  3UQ8 A;  3MDB C;  2COF A;  1YTF B;  4LF4 O;  2VSZ A;  4KHP B;  2OCC C;  2R09 A;  2YEV B;  1MSD A;  2CH7 A;  1FXK B;  1E1Q G;  4TQD A;  3H1H H;  4HNA A;  2OCH A;  3N2G A;  4Y94 A;  1S77 D;  4JI2 B;  1SKV A;  3QTC A;  5KQ1 A;  2K49 A;  4HBN A;  1G8M A;  5EC2 C;  4X65 O;  5FPO A;  3D36 C;  5KAI Z;  4J9Z B;  4FZ0 A;  2CGN A;  1QLE C;  3OEE G;  3ABL C;  2DE0 X;  2UUA O;  5B1A C;  2CY5 A;  3WFV A;  1OQN A;  4P9O A;  1EN5 A;  3CX5 F;  2KCJ A;  2X6C A;  1NBM G;  3C3S A;  3TVV A;  1I08 A;  1GAX A;  2QKL A;  2H8P C;  1J95 A;  1V61 A;  2OCC B;  5CA1 B;  1VAR A;  1CP9 A;  2YXL A;  3OD4 A;  4K0K O;  1Q6U A;  2Q7H A;  2M14 A;  4PI0 A;  1H2M A;  1M90 W;  3AG2 C;  4D6T H;  5JHG A;  4H0L B;  3LDE A;  1K4C C;  1OCR C;  1MNG A;  3ZN1 A;  2Y48 A;  2YS1 A;  4AHC A;  5IYZ B;  3IJ4 A;  4O4H A;  2D9W A;  1QLE B;  2OTX A;  1KB9 F;  2NLJ C;  4HZ3 A;  1S72 V;  4LFC B;  1HNW B;  3ZRW B;  4DR1 B;  4DW1 A;  1ZL8 A;  3ABL B;  3BIN A;  3JAW B;  1SQF A;  5B1A B;  4NYK A;  4F6R A;  1IXB A;  1ZSQ A;  3ZDT A;  1Z87 A;  4EFB A;  2Q0A A;  4BIU A;  1DYN A;  2RNB A;  4DX9 0;  1QQG A;  2OTJ V;  3D8D A;  1PFJ A;  2ZE8 A;  5EFX A;  2LFR A;  1VQP V;  1U27 A;  3ZHQ A;  4N21 A;  2UXD B;  2ADP A;  4GX5 A;  3K0D A;  1WP8 A;  3D3Q A;  4I9W A;  4JZ2 A;  3CCL V;  2RDC A;  3M7M X;  5KHG A;  3ULC A;  1TVK B;  3U11 A;  3AG2 B;  4DXA B;  3EFF K;  1SQP H;  4DV5 B;  3D8F A;  4EKW A;  3QBV B;  5DHF B;  1K97 A;  2Q9L A;  1B04 A;  1Y74 B;  4YY3 B;  5JCO C;  1RPR A;  2IYB A;  1RSO A;  2PZS A;  1VQ7 V;  2H94 A;  1T5E A;  2CTQ A;  1K5S A;  2YC0 A;  4Z1V A;  4DK0 A;  1AIL A;  1KP3 A;  4DR6 B;  3RYI B;  3SPI A;  2COA A;  4IL6 Z;  2D9Y A;  2N23 A;  5D3V A;  2UXX A;  2JS5 A;  5JLJ B;  1HNZ O;  3ZRX A;  5C8Y B;  4LF5 O;  3SJB C;  3QO7 A;  4OGQ B;  1B06 A;  1FS0 G;  1D5A A;  2Y4U A;  1M4U A;  3ASN B;  4YJ2 A;  2EIK C;  1JVM A;  2M7W A;  1PL4 A;  3E83 A;  4FFK A;  2UXN A;  1NKD A;  4DR3 O;  1P49 A;  1PPJ H;  4GKK B;  2AXT Z;  1UNP A;  1Y66 A;  2ZIO A;  2DX5 A;  4LBE C;  5DI9 B;  3VOQ A;  4DUY O;  3N27 A;  3ZN0 A;  3TXS A;  3ZHT A;  1NVP D;  1X59 A;  4DV7 O;  1XNR O;  3OHM B;  1BE3 H;  2WLN A;  1QCE A;  2YS5 A;  5J9P C;  1GC7 A;  3ZRV A;  4DV2 B;  1AI6 A;  2CGO A;  3HKE B;  4R7C A;  3P32 A;  4DV6 B;  4FFB A;  4DO2 A;  3JAL A;  2XAJ A;  1EZV H;  2ODM A;  2IU0 A;  2J59 M;  2WLK A;  4JI4 O;  4JV5 B;  2DHK A;  4LF6 O;  1KEC A;  3KZ1 A;  3OAA G;  1J5E O;  2GDS A;  4DV3 B;  3NR7 A;  4I50 B;  5FLX N;  4TYZ A;  5LBQ A;  4MSW C;  1SA0 A;  1FXV A;  1ROP A;  3B09 A;  1I94 O;  3BFR A;  4IYI A;  1QR9 A;  5JJE B;  1W2B U;  1P3R A;  3OTO B;  3ZX6 A;  4F6E A;  5K1P A;  3SV1 A;  1KKD A;  3LNN A;  3CCS V;  4GKJ O;  2DX1 A;  5JVD A;  3VBB A;  2LYD A;  1TUB A;  5I2M A;  3PSC A;  4LP8 A;  3PZD A;  1N34 O;  1CXZ B;  3F7V C;  1AWE A;  1XMO O;  4BAY A;  5J3Q A;  1X05 A;  2YF0 A;  4RUF A;  3LSQ A;  3FSS A;  3N7C A;  2DYS C;  1SRY A;  3ETG A;  1MIZ B;  4K17 A;  5IJ9 B;  5LP6 C;  1XMQ O;  2ETN A;  1FAO A;  1DDW A;  3F5W C;  2GUM A;  2MW2 B;  2YI9 A;  5JQG B;  3K0G A;  2W2X C;  4UFZ A;  5KX5 A;  2LW1 A;  2I1K A;  2OYQ A;  1LB1 A;  2UUC O;  2F95 B;  4TUY A;  5HFM A;  4UCS A;  4LF8 O;  5C6R A;  2PY5 A;  2P4V A;  3GVM A;  3L73 H;  2F23 A;  3FAV A;  4JI6 B;  3X2Q C;  4DRX B;  1MI1 A;  2DWD C;  4P9P A;  2HKO A;  4DK1 A;  2D11 A;  2V1D A;  4JTC B;  2W6I G;  4LF4 B;  2N04 A;  4NTW A;  1KP2 A;  2G35 A;  1M56 C;  2QKC A;  1QVF U;  5LOV B;  4TV8 A;  3BAA A;  2LGW A;  1VQN V;  4ZRK A;  1P84 F;  2UXC O;  2YDE A;  2E2X A;  1R73 A;  1SZT A;  3P7Z A;  3W7U A;  4X65 B;  1Q6H A;  3QO8 A;  1M1K W;  1KYO F;  2BOC C;  2YXY A;  4A6H A;  5DIF B;  1V9P A;  1XOU A;  1PM9 A;  5LP6 B;  2GUZ A;  3A98 B;  4DV4 B;  2J0J A;  2UUA B;  3HKC A;  3B40 A;  2LW7 A;  4AIL C;  4PD4 F;  1IRS A;  3TGU H;  4H44 B;  5BMV A;  3H01 A;  2RLO A;  4I0X B;  3W7W A;  1XR0 B;  2A3Q A;  2E76 B;  1JFF B;  1BGY H;  2UUB O;  2I5F A;  5KHI A;  2K9P A;  1LUW A;  5HE1 A;  1HNX O;  1OCO C;  2IH3 C;  3E22 A;  2L1C A;  2GTS A;  2KR0 A;  1M56 B;  3BY6 A;  3OT7 A;  2QJ1 A;  4K0K B;  4RUE A;  5EZY B;  3DXR A;  2N05 A;  2XQN M;  4ZOL B;  1L8D A;  4PV1 B;  4I7Z B;  5JH7 B;  1U2B A;  4O4I A;  2OIG A;  1PNL A;  3ZMS A;  4GX0 A;  5CBH A;  4LR3 A;  2A79 B;  3SR2 C;  1NTY A;  4HDQ A;  4KVG B;  3RYC B;  4GZU A;  3U10 A;  3MHH C;  1ENV A;  5LGT A;  4NTY A;  1X11 A;  4X1K A;  2BTQ B;  3CP1 A;  2QWQ B;  1JPX A;  5EK0 A;  4FZ1 A;  4PEL A;  4H13 B;  4QJ4 B;  1NZ6 A;  1WB8 A;  4I4T A;  5IWA O;  4IHJ A;  1FD9 A;  5LHH A;  5LYJ B;  2N74 A;  2RVB B;  4GLX A;  4GZR B;  1VQ9 V;  4MVZ A;  4NXN O;  4PA3 A;  4LWS B;  1K5G B;  3L70 H;  2FB5 A;  3K59 A;  1OCO B;  4FIP C;  2WLH A;  3IAY A;  2YIC A;  5ITZ A;  3W7X A;  5LA6 A;  3FVC A;  4YIP A; 
#chains in the Genus database with same CATH homology
 1VQ5 V;  1Q82 W;  3ABT A;  1R3I C;  1FXK C;  1JCH A;  2WAM A;  5CBG A;  1V55 C;  2JEX A;  1E79 G;  1Q7Y W;  4PDL A;  1THZ A;  5BZB A;  3CCU V;  4J9Y B;  5IYD O;  3ZMU A;  1H38 A;  3GB7 C;  3SPH A;  4QPJ A;  4XDJ A;  3BEH A;  4JAU A;  1PNK A;  1V54 C;  2Y69 B;  3M99 B;  3CC2 V;  2XAF A;  1OHH G;  4QPK A;  4P2Z A;  5H9C A;  2IJJ A;  3JD2 A;  2WSS G;  1MG1 A;  4GX2 A;  1L1F A;  1M57 C;  3LUT B;  1OCC C;  2B1G A;  3K3W A;  4N23 A;  1QLN A;  3TCU A;  1EBO A;  4JPR A;  1GM9 A;  3JD1 A;  4WCE V;  4UV8 A;  2C2A A;  3F7Y C;  3K03 A;  1OCR B;  4QJF B;  3K06 A;  4TT3 G;  2Z5U A;  1WLE A;  5LHG A;  4PDM A;  1SER A;  2DQ3 A;  4X8A A;  1AI5 A;  1I5X A;  3LDC A;  3ZMT A;  4FPP A;  1NQT A;  2HFE C;  2B1I A;  2QA4 V;  2XND G;  1OZ0 A;  1MAB G;  3NXS A;  3G4S V;  2X7R B;  1PD3 A;  2HVK C;  3OE7 G;  2LFS A;  1S76 D;  1AI7 A;  3D36 A;  2BOB C;  4KFM A;  4PA6 A;  3I56 V;  1YTF B;  2CK3 G;  2A9H A;  2OCC C;  1HWY A;  2WWW A;  3B77 A;  2YEV B;  4P30 A;  4XBF A;  1FXK B;  1E1Q G;  4MTO A;  2ATK C;  3STL C;  3ZRW A;  3E2E A;  2WLL B;  2X6B A;  3W7T A;  1S77 D;  1PKX A;  2DQ0 A;  3SJQ C;  1G8M A;  5EC2 C;  3HB3 B;  3CCQ V;  2XAQ A;  4H37 A;  4J9Z B;  4QE9 A;  2AHY A;  5L3D A;  3AG4 C;  4WFF A;  1QLE C;  3OEE G;  1M57 B;  1OCC B;  4JYC A;  3ABL C;  3GWO A;  4WFA V;  4MT8 A;  3CME V;  3OR7 C;  2YSU B;  5B1A C;  1NR1 A;  3WFV A;  1VQ6 V;  4P9O A;  3FYI B;  5KA5 A;  1FXH A;  2Q6A A;  3FYE B;  1Y4M A;  3E89 A;  2X6C A;  1K34 A;  3CYO A;  1NBM G;  2LP7 A;  1GM7 A;  2Z3Y A;  5EBL C;  5B1B C;  3CXC U;  3ZRS A;  1K8A W;  1YIJ V;  4ZKI A;  2H8P C;  1P4R A;  1J95 A;  2JDI G;  3RBZ A;  4G28 B;  2X0L A;  2Y69 C;  2OCC B;  3QO5 A;  1CP9 A;  1JQ0 A;  1AJN A;  4TWK A;  3SYP A;  3STZ C;  3CCR V;  4JYB A;  1NR7 A;  5GW7 A;  2Q69 A;  5CMU A;  1K4D C;  1M90 W;  3AG2 C;  3LDE A;  1K4C C;  1OCR C;  1W0K G;  3ZN1 A;  2ZQM A;  2GSM B;  2Y48 A;  3RW0 A;  2EIK B;  4XDL A;  3AG1 C;  4PA7 A;  1R6N A;  4MVR A;  2HG5 C;  4RAI A;  3AG4 B;  1QLE B;  3EHB B;  2NLJ C;  4HZ3 A;  3CPW U;  1G4Y B;  3MD0 A;  1S72 V;  3OEH G;  1F51 A;  4HYO A;  4PDV A;  3ZRW B;  3ABL B;  4I5S A;  2ITC C;  1AJP A;  3DTU B;  5B1A B;  3CMA V;  1VQO V;  4MW3 A;  4MVU A;  4TSF G;  3FB8 C;  5LHI A;  2HR3 A;  5LGN A;  4JAV A;  4BIU A;  2KB1 A;  2EIN C;  5KA6 A;  1NH2 D;  2WLI B;  1N8R W;  2OTJ V;  3T4D A;  3OUF A;  3ZIA G;  2ZXW B;  2XAG A;  3ZCC A;  1VQK V;  5B1B B;  4GCZ A;  2LFR A;  1CPY A;  3JD4 A;  1VQP V;  3ABK C;  4N21 A;  1GM8 A;  3ABU A;  2EZO A;  1YJ9 V;  1K33 A;  1GTO A;  3JD0 A;  4FK5 C;  3ETE A;  3K0D A;  4GX5 A;  5DN6 G;  2JK5 C;  3OGC C;  4JTA B;  1BHB A;  1F4M A;  3FB5 C;  4I9W A;  4JAS A;  3E35 A;  4L87 A;  4MS2 A;  4QNH B;  5L3B A;  3CCL V;  4UXN A;  1EZJ A;  3AG2 B;  3EFF K;  2R9R B;  4EKW A;  4PA9 A;  2PI5 A;  2W6J G;  2OT5 A;  3D3I A;  3FKS G;  1K97 A;  5B3S C;  3CCE V;  3AG1 B;  1PNM A;  3DCX A;  2DW4 A;  3HPL C;  2WPD G;  1RPR A;  2IU3 A;  3T2M A;  2IH1 C;  1VQ7 V;  2H94 A;  2IJK A;  2IW5 A;  1K5S A;  2XAH A;  4R50 A;  1K7D A;  1KP3 A;  5B1N A;  2Q67 A;  4YXW G;  2IJI A;  2MK3 A;  3SPI A;  2QM7 A;  2EIN B;  4H33 A;  1P7B A;  2F43 G;  2UXX A;  1VQ4 V;  5CA3 A;  2A0L A;  1NJI W;  3SYQ A;  3ZRX A;  1S5H C;  3QO7 A;  4BW5 A;  3JCZ A;  3G71 V;  1DLB A;  1FS0 G;  1BMF G;  1RPO A;  3OUS A;  3T4Z A;  4Z1M G;  3R65 A;  3ASN B;  3ABK B;  4FJC C;  5IDJ A;  3OMN B;  1H2G A;  2EIK C;  1JVM A;  2M7W A;  4FMT A;  3E83 A;  2DYS B;  2UXN A;  1NKD A;  4RQE A;  2ZDI A;  4X88 A;  1SET A;  2R9I A;  4OXS A;  1ZWI C;  1ORQ C;  1R6K A;  1K92 A;  1Y66 A;  3LDD A;  4LBE C;  5CBF A;  3ZN0 A;  3B8N A;  1S3J A;  5B3S B;  1NVP D;  4X89 A;  1KQS U;  1EFR G;  3QNE A;  4JF3 A;  1COW G;  2WLN A;  1VQ8 V;  1QCE A;  5J9P C;  3ZRV A;  3JYC A;  3X2Q B;  2EIM C;  2ZDI C;  2ZXW C;  1AI6 A;  4R7C A;  3P32 A;  2EZP A;  4WFH A;  4MVM A;  2ZR2 A;  4DO2 A;  1MOF A;  1VQM V;  2XAJ A;  4UVC A;  3WG7 C;  3A0R A;  2IU0 A;  2WLK A;  2HVJ C;  4CBC A;  1KEC A;  2QKS A;  4MW8 A;  3OAA G;  4LC1 A;  2EIJ C;  1K5Q A;  5CN0 A;  3ZMZ A;  2QEX V;  5LBQ A;  4MSW C;  3UM7 A;  5L3F A;  1YJN V;  3ZJZ A;  5HFL A;  3CCM V;  1FXV A;  1ROP A;  2ZR3 A;  2ITD C;  3AG3 C;  3I55 V;  2HLD G;  1R3K C;  3K9A A;  3OM3 B;  4MVS A;  2QE7 G;  3SPC A;  4F4L A;  1QR9 A;  1W2B U;  4MVO A;  4KUM A;  3OFN G;  4G2K A;  1YI2 V;  4MVQ A;  3DGE A;  1KKD A;  5DM6 V;  3CCS V;  4XDK A;  3TK1 A;  1F4N A;  3G6E V;  3VBB A;  5IYC O;  2P7T C;  2JEU A;  2EIM B;  3TET A;  5LGU A;  2WLL A;  4QIW F;  2XOK G;  4LP8 A;  3B8M A;  1KD1 W;  4E2L A;  1KC8 W;  1S0V A;  1JX9 A;  3ASN C;  3F7V C;  4BAY A;  3SYA A;  5H6R A;  1LNQ A;  4PDR A;  3WG7 B;  4RUF A;  3LSQ A;  4UVB A;  2Q68 A;  1QVG U;  2DYS C;  3CCJ V;  5L3G A;  1AI4 A;  4HAM A;  1QR8 A;  1SRY A;  3ETG A;  4BIZ A;  1TUE B;  2EIJ B;  1K9M W;  3F5W C;  4R8C A;  1UJW B;  3K0G A;  2P67 A;  2QM8 A;  3P30 A;  5IYB O;  5L3E A;  1K73 W;  5E1A C;  3E8G A;  5L3C A;  1RM1 C;  4MTG A;  4UV9 A;  3AG3 B;  2K1E A;  2WLJ A;  5HFM A;  2D3O W;  1F23 A;  2B5U A;  4GX1 A;  4WF9 V;  1JJ2 U;  2ZD9 A;  3X2Q C;  5EBM C;  1AR1 B;  3VOU A;  1B6Q A;  2DWD C;  4P9P A;  1SES A;  2HKO A;  2V1D A;  3ASO C;  4ASU G;  4JTC B;  4UVA A;  5KUK A;  4ZBM A;  2AHZ A;  2W6I G;  1JOY A;  4WFE A;  5EBW C;  1KP2 A;  4U7O A;  3T1C A;  2JJ1 G;  2PI4 A;  1M56 C;  5FL7 G;  3HSA A;  2EIL C;  3OR6 C;  1DF5 A;  1NH2 B;  1QVF U;  3ZMV A;  3SPG A;  2HJF C;  4RO2 A;  3K79 A;  1VQN V;  1DF4 A;  1R73 A;  1SZT A;  2DYR C;  5KUM A;  4JGS A;  4KP4 A;  1YHQ V;  4G27 B;  3W7U A;  3CC4 V;  3IGA C;  3OW2 U;  2IJH A;  4WFG A;  3W7S A;  1PL0 A;  4DXW A;  1GK9 A;  3QO8 A;  3ABM C;  3FB7 C;  4LCU C;  3CCV V;  2BOC C;  1M1K W;  3KG2 A;  5H6Q A;  3CC7 V;  4MTX A;  1V55 B;  2W0F C;  4GT1 A;  4UUJ C;  3UKM A;  1CEZ A;  4QE7 A;  2JJ2 G;  1I5Y A;  1RM1 B;  4PA4 A;  1FFT B;  5EC1 C;  3AEI A;  3H01 A;  3RVZ A;  3ML0 A;  3W7W A;  2XAS A;  2QTO A;  1V54 B;  4Q20 A;  1DTO A;  3MHS C;  2EBO A;  2WLI A;  1XL6 A;  5C93 A;  2JIZ G;  2V7Q G;  3LNM B;  3ASO B;  1GMG A;  4R6Z A;  1OCO C;  2IH3 C;  3SYC A;  1OCZ C;  4JTD B;  1W0J G;  1VQL V;  3OMA B;  1M56 B;  3BY6 A;  2EIL B;  5IY5 C;  2FTK A;  1R3L C;  3JD3 A;  1H8H G;  3K04 A;  1Q81 W;  4RUE A;  1QBZ A;  2DYR B;  3E8B A;  1YIT V;  1AJQ A;  3K08 A;  3CD6 V;  3IC7 A;  4CZZ A;  1PNL A;  3ZMS A;  1R3J C;  4GX0 A;  3SPJ A;  5CBH A;  3ABM B;  1ARO P;  2A79 B;  5B1O A;  2WLM A;  1WPX A;  1K3E A;  3PJS K;  3LSS A;  3MHH C;  1ENV A;  5LGT A;  4WFB V;  2P90 A;  1GKF A;  3IFX A;  2NNU A;  3CP1 A;  1JPX A;  1XL4 A;  3SYO A;  5EK0 A;  1IXM A;  1NVP B;  4PEL A;  1E1R G;  1YJW V;  1MSW D;  2YEV A;  2DWE C;  1M9N A;  4MTF A;  1FXK A;  3E8F A;  5LHH A;  2EJR A;  1BHA A;  4U7N A;  1H8E G;  3RVY A;  3E8H A;  1VQ9 V;  2OTL V;  4MVZ A;  1BL8 A;  1YSC A;  4PA3 A;  2P6J A;  3E86 A;  4RQF A;  1OCO B;  4FIP C;  2WLH A;  1GO3 F;  1OCZ B;  3ETD A;  2X6A A;  3W7X A;  3FB6 C;  3OMI B;  5IY5 B;  2GHY A;  1YTF D;  1Q86 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...