3B7HA

Crystal structure of the prophage lp1 protein 11
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
76
structure length
76
Chain Sequence
MKTDGEFVSEHLMELITQQNLTINRVATLAGLNQSTVNAMFEGRSKRPTITTIRKVCGTLGISVHDFFDFPPYNEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the prophage Lp1 protein 11.
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Structural protein
molecule keywords Prophage Lp1 protein 11
total genus 26
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3b7hA00
1RIOA 2AXZA 4I8TA 3JXBC 3U3WA 1POUA 3IVPA 2AXVA 2KZ8A 2A6CA 1Y7YA 2GRLA 4YARA 4MCXA 3OMTA 2WIUB 4GQMA 3ZHIA 2LYJA 2CROA 1YSEA 4F8DA 1R69A 4PU7A 3G5GA 3OQNA 2XIUA 4YG7B 3OQOA 1WIZA 4YBAA 2L8NA 3LISA 2PUCA 3DNVB 1GT0C 3OP9A 3PXPA 1ZPQA 3ZKCA 4X4EA 1UXDA 2BNOA 4PU3C 3F6WA 3GN5A 1JH9A 1LLIA 1WH6A 4Z5CA 2KEKA 1X57A 3QF3A 2B5AA 4FN3A 2O38A 1NEQA 1Y9QA 4GHJA 3KJXA 3CROL 3CLCA 2R1JL 1S7EA 4FBIA 4X4CA 3KXAA 1BDHA 2AXUA 2L49A 1ZZ6A 1QQBA 1ZZ8A 1E3OC 1R63A 2LYQA 2PIJA 1ZZCA 3QYXA 3KZ3A 1ADRA 1ZZBA 1ZUGA 2KEJA 4IWRA 1SQ8A 2ICTA 2KPJA 1CQTA 2PUFA 2IV1A 1QP0A 1HF0A 4Z58A 3UFDA 3L1PA 2WUSR 2GZUA 1X2LA 2AW6A 1QP4A 1CJGA 3QWGA 1PRVA 2JVLA 2LYSA 3CECA 2EWTA 3MLFA 2O49A 1RZSA 2IUOA 1AU7A 4JCXA 2XJ3A 5A7LA 3VK0A 3OQMA 3BD1A 1RPEL 1ZZ9A 4X4HA 2KEIA 1NERA 2PUGA 2R63A 4J1XA 4MCTA 1VPWA 3O9XA 3ZHMA 4X4GA 2LYKA 1LCCA 1UTXA 2BNMA 2BJCA 1O4XA 3GBFA 3RZZA 2MQKA 2PE5A 2PUAA 3F51A 2PPXA 4PU8A 4X4FA 3TRBA 2OR1L 2MEZA 2XI8A 1QPZA 2LCVA 3FYAA 3SCFA 4X4BA 4JCYA 2IVQA 4IVZA 1LMB3 2LYPA 1JWLA 2PUEA 3D1NI 5K98B 4YG4A 4Z5HA 2XSDC 1ZAYA 1PRAA 2LYLA 4I6TA 3SCHA 2ICPA 2BNNA 3B7HA 3G7DA 3SCGA 1LCDA 1PNRA 1L1MA 1ZZ7A 1ZS4A 3FMYA 1BDIA 2H8RA 4OB4A 2AUWA 3FYMA 2AWIA 3GN5B 2IU7A 2HSGA 1JFSA 4NDWA 3QQ6A 2HINA 3R1FA 3JXCL 3S8QA 4JQDA 1QP7A 1WH8A 2D5VA 2GRMA 1ZVVA 4X4IA 1XWRA 2O4AA 4IA8A 3BDNA 1UXCA 2PUBA 3EUSA 4J1WA 1EFAA 2EF8A 1QQAA 3F52A 4Z59A 1LQCA 1PRUA 3BS3A 4I6UA 1RZRD 1JFTA 1PERL 1RZRA 1OSLA 2XCJA 4X4DA 1WETA 4O8BA 1DW9A 2LYRA 2JCGA 4Y42A 3HZIB 3H5TA 3LFPA 4I6RA 4Z5DA 2EBYA 2FJRA 2CSFA 4YG1A 1IC8A 2PUDA 1OCTC 4PU4C 2OFYA 3JXDL 2IVGA 1DWKA 1B0NA 2IVBA
chains in the Genus database with same CATH superfamily
1RIOA 3U3WA 4ER3A 1Y7YA 2WIUB 3ZHIA 2PXVA 3OQNA 5DRYA 3OQOA 4YBAA 1DULA 5GAGi 3GZDC 4X4EA 3GN5A 1X57A 3KL4A 3CLCA 4EKIA 1QQBA 1ZZ8A 1R63A 1ZZCA 2LLVA 3GZDA 4IWRA 2KPJA 2IV1A 1HF0A 1NW3A 2WUSR 2XXQA 3QOXA 1AU7A 5A7LA 3OQMA 3BD1A 4J1XA 3O9XA 3ZHMA 4X4GA 3QFIA 3GZCA 3UWPA 3GBFA 2MQKA 3TRBA 3FYAA 2HFZA 4JCYA 4IVZA 3D1NI 5K98B 3SCHA 3SCGA 1L1MA 1ZZ7A 1ZS4A 2XXPA 2HCSA 3R1FA 3S8QA 3TEPA 1XWRA 2O4AA 1U2ZA 2YBDA 1EFAA 1QQAA 4Z59A 2PXUA 1LQCA 4I6UA 2XCJA 3ZPXA 1WETA 2LYRA 4ER5A 3LFPA 2EBYA 2CSFA 4DE9A 2PUDA 4EK9A 1OCTC 4PU4C 2OFYA 3DM5A 2IVGA 1RPEL 1LCDA 2IVBA 2AXZA 4I8TA 4MCXA 3OMTA 2PXTA 2CROA 4Q2JA 1R69A 1WIZA 2L8NA 4PU3C 1UXDA 2PXDA 3F6WA 2KEKA 2B5AA 4FN3A 2LNMA 3KJXA 1S7EA 3KXAA 5DTQA 1E3OC 2PIJA 3KZ3A 1ZUGA 1CQTA 1X2LA 2LYSA 2O49A 4JCXA 3QOWA 3SR4A 2LYKA 2BJCA 1O4XA 3RZZA 2PXQA 2PE5A 2PUAA 3GUUA 4PU8A 4X4FA 3TELA 1QPZA 2LCVA 2IVQA 1LMB3 1JWLA 5DTRA 3LQXA 5DSXA 1PRAA 2ICPA 3G7DA 1PNRA 3FYMA 3GN5B 2IU7A 2HINA 3JXCL 1QP7A 2GRMA 4IA8A 2EF8A 3TFLA 1RZRD 1RZRA 4O8BA 4I6RA 4YG1A 2PXKA 1B0NA 3JXBC 3IVPA 2KZ8A 2A6CA 4GQMA 2LYJA 3SX0A 1YSEA 4PU7A 2XIUA 3LISA 3DNVB 2MXDA 3OP9A 3ZKCA 2BNOA 1LLIA 1WH6A 4Z5CA 1Y9QA 4GHJA 3CROL 2R1JL 4X4CA 4FBIA 2PXFA 2V3CC 1BDHA 1ZZ6A 2ICTA 3MEJA 1QP0A 4Z58A 3UFDA 1QP4A 1CJGA 3QWGA 2JVLA 4WVLA 3CECA 2EWTA 1RZSA 3NZLA 3VWSA 1ZZ9A 4X4HA 1NERA 2PUGA 2R63A 4MCTA 1VPWA 3OKZA 1LCCA 1UTXA 3A9ZA 1QZXA 2OR1L 2MEZA 2XXAA 4X4BA 2LYPA 2PUEA 4Z5HA 2XSDC 4I6TA 2BNNA 3B7HA 2H8RA 3FMYA 1BDIA 4OB4A 3R09A 2AWIA 1JFSA 4NDWA 3QQ6A 4JQDA 3OWQA 1ZVVA 2JQEA 1HQ1A 3BDNA 3EUSA 4J1WA 4EQZA 2LLWA 1PRUA 3BS3A 5JUWA 2J7UA 1DW9A 3H5TA 4Z5DA 1IC8A 2HCNA 3JXDL 2PXEA 4EZIA 1POUA 2AXVA 5DRTA 2GRLA 4YARA 2ODRD 4F8DA 2PXLA 3G5GA 3NXHA 4YG7B 2PUCA 2VEOA 1GT0C 3PXPA 1ZPQA 2L1PA 4ER6A 1JH9A 4OBMA 3QF3A 2O38A 1NEQA 1QB2A 5DT2A 2AXUA 2L49A 2LYQA 3QYXA 3A9YA 1ADRA 1ZZBA 2KEJA 1MFQC 3NROA 1SQ8A 4EKGA 2PUFA 5DTMA 3L1PA 5GAHi 2GZUA 2AW6A 1PRVA 3MLFA 2IUOA 2XJ3A 2M4HA 3VK0A 2PXPA 2KEIA 2FFHA 4ER0A 3G0TA 2BNMA 3A9XA 3F51A 2PPXA 3NDBB 2XI8A 2PXBA 3SCFA 3PE5A 4YG4A 2J7WA 1ZAYA 2LYLA 4DE8A 3ME5A 2AUWA 2HSGA 4HRAA 2D5VA 1WH8A 4X4IA 2PUBA 1UXCA 4ER7A 3F52A 1JFTA 1PERL 1OSLA 3M9LA 4X4DA 4Y42A 2JCGA 3HZIB 2FJRA 1DWKA
chains in the Genus database with same CATH topology
1RIOA 2AXZA 4I8TA 3JXBC 3U3WA 1POUA 3IVPA 2AXVA 2KZ8A 2A6CA 1Y7YA 2GRLA 4YARA 4MCXA 3OMTA 2WIUB 4GQMA 3ZHIA 2LYJA 2CROA 1YSEA 4F8DA 1R69A 4PU7A 3G5GA 3OQNA 2XIUA 4YG7B 3OQOA 1WIZA 4YBAA 2L8NA 3LISA 2PUCA 3DNVB 1GT0C 3OP9A 3PXPA 1ZPQA 3ZKCA 4X4EA 1UXDA 2BNOA 4PU3C 3F6WA 3GN5A 1JH9A 1LLIA 1WH6A 4Z5CA 2KEKA 1X57A 3QF3A 2B5AA 4FN3A 2O38A 1NEQA 1Y9QA 4GHJA 3KJXA 3CROL 3CLCA 2R1JL 1S7EA 4FBIA 4X4CA 3KXAA 1BDHA 2AXUA 2L49A 1ZZ6A 1QQBA 1ZZ8A 1E3OC 1R63A 2LYQA 2PIJA 1ZZCA 3QYXA 3KZ3A 1ADRA 1ZZBA 1ZUGA 2KEJA 4IWRA 1SQ8A 2ICTA 2KPJA 1CQTA 2PUFA 2IV1A 1QP0A 1HF0A 4Z58A 3UFDA 3L1PA 2WUSR 2GZUA 1X2LA 2AW6A 1QP4A 1CJGA 3QWGA 1PRVA 2JVLA 2LYSA 3CECA 2EWTA 3MLFA 2O49A 1RZSA 2IUOA 1AU7A 4JCXA 2XJ3A 5A7LA 3VK0A 3OQMA 3BD1A 1RPEL 1ZZ9A 4X4HA 2KEIA 1NERA 2PUGA 2R63A 4J1XA 4MCTA 1VPWA 3O9XA 3ZHMA 4X4GA 2LYKA 1LCCA 1UTXA 2BNMA 2BJCA 1O4XA 3GBFA 3RZZA 2MQKA 2PE5A 2PUAA 3F51A 2PPXA 4PU8A 4X4FA 3TRBA 2OR1L 2MEZA 2XI8A 1QPZA 2LCVA 3FYAA 3SCFA 4X4BA 4JCYA 2IVQA 4IVZA 1LMB3 2LYPA 1JWLA 2PUEA 3D1NI 5K98B 4YG4A 4Z5HA 2XSDC 1ZAYA 1PRAA 2LYLA 4I6TA 3SCHA 2ICPA 2BNNA 3B7HA 3G7DA 3SCGA 1LCDA 1PNRA 1L1MA 1ZZ7A 1ZS4A 3FMYA 1BDIA 2H8RA 4OB4A 2AUWA 3FYMA 2AWIA 3GN5B 2IU7A 2HSGA 1JFSA 4NDWA 3QQ6A 2HINA 3R1FA 3JXCL 3S8QA 4JQDA 1QP7A 1WH8A 2D5VA 2GRMA 1ZVVA 4X4IA 1XWRA 2O4AA 4IA8A 3BDNA 1UXCA 2PUBA 3EUSA 4J1WA 1EFAA 2EF8A 1QQAA 3F52A 4Z59A 1LQCA 1PRUA 3BS3A 4I6UA 1RZRD 1JFTA 1PERL 1RZRA 1OSLA 2XCJA 4X4DA 1WETA 4O8BA 1DW9A 2LYRA 2JCGA 4Y42A 3HZIB 3H5TA 3LFPA 4I6RA 4Z5DA 2EBYA 2FJRA 2CSFA 4YG1A 1IC8A 2PUDA 1OCTC 4PU4C 2OFYA 3JXDL 2IVGA 1DWKA 1B0NA 2IVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RIO A;  2AXZ A;  4I8T A;  3JXB C;  3U3W A;  1POU A;  3IVP A;  2AXV A;  2KZ8 A;  2A6C A;  1Y7Y A;  2GRL A;  4YAR A;  4MCX A;  3OMT A;  2WIU B;  4GQM A;  3ZHI A;  2LYJ A;  2CRO A;  1YSE A;  4F8D A;  1R69 A;  4PU7 A;  3G5G A;  3OQN A;  2XIU A;  4YG7 B;  3OQO A;  1WIZ A;  4YBA A;  2L8N A;  3LIS A;  2PUC A;  3DNV B;  1GT0 C;  3OP9 A;  3PXP A;  1ZPQ A;  3ZKC A;  4X4E A;  1UXD A;  2BNO A;  4PU3 C;  3F6W A;  3GN5 A;  1JH9 A;  1LLI A;  1WH6 A;  4Z5C A;  2KEK A;  1X57 A;  3QF3 A;  2B5A A;  4FN3 A;  2O38 A;  1NEQ A;  1Y9Q A;  4GHJ A;  3KJX A;  3CRO L;  3CLC A;  2R1J L;  1S7E A;  4FBI A;  4X4C A;  3KXA A;  1BDH A;  2AXU A;  2L49 A;  1ZZ6 A;  1QQB A;  1ZZ8 A;  1E3O C;  1R63 A;  2LYQ A;  2PIJ A;  1ZZC A;  3QYX A;  3KZ3 A;  1ADR A;  1ZZB A;  1ZUG A;  2KEJ A;  4IWR A;  1SQ8 A;  2ICT A;  2KPJ A;  1CQT A;  2PUF A;  2IV1 A;  1QP0 A;  1HF0 A;  4Z58 A;  3UFD A;  3L1P A;  2WUS R;  2GZU A;  1X2L A;  2AW6 A;  1QP4 A;  1CJG A;  3QWG A;  1PRV A;  2JVL A;  2LYS A;  3CEC A;  2EWT A;  3MLF A;  2O49 A;  1RZS A;  2IUO A;  1AU7 A;  4JCX A;  2XJ3 A;  5A7L A;  3VK0 A;  3OQM A;  3BD1 A;  1RPE L;  1ZZ9 A;  4X4H A;  2KEI A;  1NER A;  2PUG A;  2R63 A;  4J1X A;  4MCT A;  1VPW A;  3O9X A;  3ZHM A;  4X4G A;  2LYK A;  1LCC A;  1UTX A;  2BNM A;  2BJC A;  1O4X A;  3GBF A;  3RZZ A;  2MQK A;  2PE5 A;  2PUA A;  3F51 A;  2PPX A;  4PU8 A;  4X4F A;  3TRB A;  2OR1 L;  2MEZ A;  2XI8 A;  1QPZ A;  2LCV A;  3FYA A;  3SCF A;  4X4B A;  4JCY A;  2IVQ A;  4IVZ A;  1LMB 3;  2LYP A;  1JWL A;  2PUE A;  3D1N I;  5K98 B;  4YG4 A;  4Z5H A;  2XSD C;  1ZAY A;  1PRA A;  2LYL A;  4I6T A;  3SCH A;  2ICP A;  2BNN A;  3B7H A;  3G7D A;  3SCG A;  1LCD A;  1PNR A;  1L1M A;  1ZZ7 A;  1ZS4 A;  3FMY A;  1BDI A;  2H8R A;  4OB4 A;  2AUW A;  3FYM A;  2AWI A;  3GN5 B;  2IU7 A;  2HSG A;  1JFS A;  4NDW A;  3QQ6 A;  2HIN A;  3R1F A;  3JXC L;  3S8Q A;  4JQD A;  1QP7 A;  1WH8 A;  2D5V A;  2GRM A;  1ZVV A;  4X4I A;  1XWR A;  2O4A A;  4IA8 A;  3BDN A;  1UXC A;  2PUB A;  3EUS A;  4J1W A;  1EFA A;  2EF8 A;  1QQA A;  3F52 A;  4Z59 A;  1LQC A;  1PRU A;  3BS3 A;  4I6U A;  1RZR D;  1JFT A;  1PER L;  1RZR A;  1OSL A;  2XCJ A;  4X4D A;  1WET A;  4O8B A;  1DW9 A;  2LYR A;  2JCG A;  4Y42 A;  3HZI B;  3H5T A;  3LFP A;  4I6R A;  4Z5D A;  2EBY A;  2FJR A;  2CSF A;  4YG1 A;  1IC8 A;  2PUD A;  1OCT C;  4PU4 C;  2OFY A;  3JXD L;  2IVG A;  1DWK A;  1B0N A;  2IVB A; 
#chains in the Genus database with same CATH topology
 1RIO A;  3U3W A;  4ER3 A;  1Y7Y A;  2WIU B;  3ZHI A;  2PXV A;  3OQN A;  5DRY A;  3OQO A;  4YBA A;  1DUL A;  5GAG i;  3GZD C;  4X4E A;  3GN5 A;  1X57 A;  3KL4 A;  3CLC A;  4EKI A;  1QQB A;  1ZZ8 A;  1R63 A;  1ZZC A;  2LLV A;  3GZD A;  4IWR A;  2KPJ A;  2IV1 A;  1HF0 A;  1NW3 A;  2WUS R;  2XXQ A;  3QOX A;  1AU7 A;  5A7L A;  3OQM A;  3BD1 A;  4J1X A;  3O9X A;  3ZHM A;  4X4G A;  3QFI A;  3GZC A;  3UWP A;  3GBF A;  2MQK A;  3TRB A;  3FYA A;  2HFZ A;  4JCY A;  4IVZ A;  3D1N I;  5K98 B;  3SCH A;  3SCG A;  1L1M A;  1ZZ7 A;  1ZS4 A;  2XXP A;  2HCS A;  3R1F A;  3S8Q A;  3TEP A;  1XWR A;  2O4A A;  1U2Z A;  2YBD A;  1EFA A;  1QQA A;  4Z59 A;  2PXU A;  1LQC A;  4I6U A;  2XCJ A;  3ZPX A;  1WET A;  2LYR A;  4ER5 A;  3LFP A;  2EBY A;  2CSF A;  4DE9 A;  2PUD A;  4EK9 A;  1OCT C;  4PU4 C;  2OFY A;  3DM5 A;  2IVG A;  1RPE L;  1LCD A;  2IVB A;  2AXZ A;  4I8T A;  4MCX A;  3OMT A;  2PXT A;  2CRO A;  4Q2J A;  1R69 A;  1WIZ A;  2L8N A;  4PU3 C;  1UXD A;  2PXD A;  3F6W A;  2KEK A;  2B5A A;  4FN3 A;  2LNM A;  3KJX A;  1S7E A;  3KXA A;  5DTQ A;  1E3O C;  2PIJ A;  3KZ3 A;  1ZUG A;  1CQT A;  1X2L A;  2LYS A;  2O49 A;  4JCX A;  3QOW A;  3SR4 A;  2LYK A;  2BJC A;  1O4X A;  3RZZ A;  2PXQ A;  2PE5 A;  2PUA A;  3GUU A;  4PU8 A;  4X4F A;  3TEL A;  1QPZ A;  2LCV A;  2IVQ A;  1LMB 3;  1JWL A;  5DTR A;  3LQX A;  5DSX A;  1PRA A;  2ICP A;  3G7D A;  1PNR A;  3FYM A;  3GN5 B;  2IU7 A;  2HIN A;  3JXC L;  1QP7 A;  2GRM A;  4IA8 A;  2EF8 A;  3TFL A;  1RZR D;  1RZR A;  4O8B A;  4I6R A;  4YG1 A;  2PXK A;  1B0N A;  3JXB C;  3IVP A;  2KZ8 A;  2A6C A;  4GQM A;  2LYJ A;  3SX0 A;  1YSE A;  4PU7 A;  2XIU A;  3LIS A;  3DNV B;  2MXD A;  3OP9 A;  3ZKC A;  2BNO A;  1LLI A;  1WH6 A;  4Z5C A;  1Y9Q A;  4GHJ A;  3CRO L;  2R1J L;  4X4C A;  4FBI A;  2PXF A;  2V3C C;  1BDH A;  1ZZ6 A;  2ICT A;  3MEJ A;  1QP0 A;  4Z58 A;  3UFD A;  1QP4 A;  1CJG A;  3QWG A;  2JVL A;  4WVL A;  3CEC A;  2EWT A;  1RZS A;  3NZL A;  3VWS A;  1ZZ9 A;  4X4H A;  1NER A;  2PUG A;  2R63 A;  4MCT A;  1VPW A;  3OKZ A;  1LCC A;  1UTX A;  3A9Z A;  1QZX A;  2OR1 L;  2MEZ A;  2XXA A;  4X4B A;  2LYP A;  2PUE A;  4Z5H A;  2XSD C;  4I6T A;  2BNN A;  3B7H A;  2H8R A;  3FMY A;  1BDI A;  4OB4 A;  3R09 A;  2AWI A;  1JFS A;  4NDW A;  3QQ6 A;  4JQD A;  3OWQ A;  1ZVV A;  2JQE A;  1HQ1 A;  3BDN A;  3EUS A;  4J1W A;  4EQZ A;  2LLW A;  1PRU A;  3BS3 A;  5JUW A;  2J7U A;  1DW9 A;  3H5T A;  4Z5D A;  1IC8 A;  2HCN A;  3JXD L;  2PXE A;  4EZI A;  1POU A;  2AXV A;  5DRT A;  2GRL A;  4YAR A;  2ODR D;  4F8D A;  2PXL A;  3G5G A;  3NXH A;  4YG7 B;  2PUC A;  2VEO A;  1GT0 C;  3PXP A;  1ZPQ A;  2L1P A;  4ER6 A;  1JH9 A;  4OBM A;  3QF3 A;  2O38 A;  1NEQ A;  1QB2 A;  5DT2 A;  2AXU A;  2L49 A;  2LYQ A;  3QYX A;  3A9Y A;  1ADR A;  1ZZB A;  2KEJ A;  1MFQ C;  3NRO A;  1SQ8 A;  4EKG A;  2PUF A;  5DTM A;  3L1P A;  5GAH i;  2GZU A;  2AW6 A;  1PRV A;  3MLF A;  2IUO A;  2XJ3 A;  2M4H A;  3VK0 A;  2PXP A;  2KEI A;  2FFH A;  4ER0 A;  3G0T A;  2BNM A;  3A9X A;  3F51 A;  2PPX A;  3NDB B;  2XI8 A;  2PXB A;  3SCF A;  3PE5 A;  4YG4 A;  2J7W A;  1ZAY A;  2LYL A;  4DE8 A;  3ME5 A;  2AUW A;  2HSG A;  4HRA A;  2D5V A;  1WH8 A;  4X4I A;  2PUB A;  1UXC A;  4ER7 A;  3F52 A;  1JFT A;  1PER L;  1OSL A;  3M9L A;  4X4D A;  4Y42 A;  2JCG A;  3HZI B;  2FJR A;  1DWK A; 
#chains in the Genus database with same CATH homology
 1RIO A;  2AXZ A;  4I8T A;  3JXB C;  3U3W A;  1POU A;  3IVP A;  2AXV A;  2KZ8 A;  2A6C A;  1Y7Y A;  2GRL A;  4YAR A;  4MCX A;  3OMT A;  2WIU B;  4GQM A;  3ZHI A;  2LYJ A;  2CRO A;  1YSE A;  4F8D A;  1R69 A;  4PU7 A;  3G5G A;  3OQN A;  2XIU A;  4YG7 B;  3OQO A;  1WIZ A;  4YBA A;  2L8N A;  3LIS A;  2PUC A;  3DNV B;  1GT0 C;  3OP9 A;  3PXP A;  1ZPQ A;  3ZKC A;  4X4E A;  1UXD A;  2BNO A;  4PU3 C;  3F6W A;  3GN5 A;  1JH9 A;  1LLI A;  1WH6 A;  4Z5C A;  2KEK A;  1X57 A;  3QF3 A;  2B5A A;  4FN3 A;  2O38 A;  1NEQ A;  1Y9Q A;  4GHJ A;  3KJX A;  3CRO L;  3CLC A;  2R1J L;  1S7E A;  4FBI A;  4X4C A;  3KXA A;  1BDH A;  2AXU A;  2L49 A;  1ZZ6 A;  1QQB A;  1ZZ8 A;  1E3O C;  1R63 A;  2LYQ A;  2PIJ A;  1ZZC A;  3QYX A;  3KZ3 A;  1ADR A;  1ZZB A;  1ZUG A;  2KEJ A;  4IWR A;  1SQ8 A;  2ICT A;  2KPJ A;  1CQT A;  2PUF A;  2IV1 A;  1QP0 A;  1HF0 A;  4Z58 A;  3UFD A;  3L1P A;  2WUS R;  2GZU A;  1X2L A;  2AW6 A;  1QP4 A;  1CJG A;  3QWG A;  1PRV A;  2JVL A;  2LYS A;  3CEC A;  2EWT A;  3MLF A;  2O49 A;  1RZS A;  2IUO A;  1AU7 A;  4JCX A;  2XJ3 A;  5A7L A;  3VK0 A;  3OQM A;  3BD1 A;  1RPE L;  1ZZ9 A;  4X4H A;  2KEI A;  1NER A;  2PUG A;  2R63 A;  4J1X A;  4MCT A;  1VPW A;  3O9X A;  3ZHM A;  4X4G A;  2LYK A;  1LCC A;  1UTX A;  2BNM A;  2BJC A;  1O4X A;  3GBF A;  3RZZ A;  2MQK A;  2PE5 A;  2PUA A;  3F51 A;  2PPX A;  4PU8 A;  4X4F A;  3TRB A;  2OR1 L;  2MEZ A;  2XI8 A;  1QPZ A;  2LCV A;  3FYA A;  3SCF A;  4X4B A;  4JCY A;  2IVQ A;  4IVZ A;  1LMB 3;  2LYP A;  1JWL A;  2PUE A;  3D1N I;  5K98 B;  4YG4 A;  4Z5H A;  2XSD C;  1ZAY A;  1PRA A;  2LYL A;  4I6T A;  3SCH A;  2ICP A;  2BNN A;  3B7H A;  3G7D A;  3SCG A;  1LCD A;  1PNR A;  1L1M A;  1ZZ7 A;  1ZS4 A;  3FMY A;  1BDI A;  2H8R A;  4OB4 A;  2AUW A;  3FYM A;  2AWI A;  3GN5 B;  2IU7 A;  2HSG A;  1JFS A;  4NDW A;  3QQ6 A;  2HIN A;  3R1F A;  3JXC L;  3S8Q A;  4JQD A;  1QP7 A;  1WH8 A;  2D5V A;  2GRM A;  1ZVV A;  4X4I A;  1XWR A;  2O4A A;  4IA8 A;  3BDN A;  1UXC A;  2PUB A;  3EUS A;  4J1W A;  1EFA A;  2EF8 A;  1QQA A;  3F52 A;  4Z59 A;  1LQC A;  1PRU A;  3BS3 A;  4I6U A;  1RZR D;  1JFT A;  1PER L;  1RZR A;  1OSL A;  2XCJ A;  4X4D A;  1WET A;  4O8B A;  1DW9 A;  2LYR A;  2JCG A;  4Y42 A;  3HZI B;  3H5T A;  3LFP A;  4I6R A;  4Z5D A;  2EBY A;  2FJR A;  2CSF A;  4YG1 A;  1IC8 A;  2PUD A;  1OCT C;  4PU4 C;  2OFY A;  3JXD L;  2IVG A;  1DWK A;  1B0N A;  2IVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...