3B7XA

Crystal structure of human fk506-binding protein 6
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
117
Chain Sequence
QSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDRPFDSNLMKLEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELLDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human FK506-Binding Protein 6.
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords FK506-binding protein 6
total genus 29
structure length 117
sequence length 125
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3b7xA00
2ZR6A 1B6CA 2ZR5A 1P5QA 3RGCA 4LAYA 1FAPA 4DRQA 5B8IC 2XP6A 3O5IA 2VCDA 4NNRA 5HKGA 1KT0A 1PBKA 1F40A 2XP3A 3CGMA 1Q6IA 1TCOC 2ZQVA 2M2AA 3O5GA 4G2PA 1EYMA 4ODNA 1EQ3A 4FAPA 1D6OA 3O5MA 5I98A 2PV3A 2KE0A 5HTGA 3O5DA 2ITKA 3JXVA 2MF9A 5HW6A 2XP5A 3KZ7A 1Q6HA 2JZVA 3O5OA 4J4NA 4ODQA 2OFNA 4O2TA 4LAXA 4JFIA 4DRHA 1FKGA 4QIBA 4DT4A 1A7XA 4TYOA 1QZ2A 1FKJA 3KAGA 4IQ2A 4TNSA 3EY6A 4U86A 4IPXA 1C9HA 4TW6A 2ZQSA 5DIVA 3UQAA 1T11A 3IK8A 5HT1A 3NTPA 1Q6UA 2N87A 3KACA 2IF4A 1PINA 3IKGA 2XP7A 1NMWA 1R9HA 4GGQA 2XPAA 3IHZA 3LUOA 4ODLA 1Y0OA 3O5LA 4W9PA 4U85A 3GPKA 1FKSA 1J4HA 3RFWA 2RUDA 2KR7A 3H9RB 1J4IA 4DRJA 2FAPA 1U79A 3O5FA 1JNSA 2RUQA 1F8AB 2L2SA 4ODOA 2PPPA 5BXJA 2XPBA 3O5QA 4TX0A 3KCEA 3UF8A 3KAHA 4G50A 2VN1A 3KADA 4JFJA 4JFMA 5GPGA 5HUAA 3JYJA 4ITZA 2DG4A 2UZ5A 1FKBA 2ZQTA 5D75A 3PA7A 2M08A 2DG9A 4DZ2A 3UI6A 3PRDA 1JVWA 1FKFA 4QT3A 3UI4A 1FJDA 4JFLA 2RURA 3OOBA 4TW8A 1JNTA 4U84A 2F4EA 4JYSA 2KI3A 3VAWA 2M1IA 2RUCA 4QT2A 4DROA 3NI6A 3TCZA 4BF8A 2PV1A 4N19A 4W9QA 3UQBA 4ODKA 1FKIA 5HWCA 5DIUA 2F21A 2K8IA 3JYMA 1KT1A 4GIVA 2ZR4A 3UI5A 2KO7A 3PRBA 4ODMA 4W9OA 1L1PA 2XP9A 2PPOA 2F2DA 2LKNA 1FKHA 3O5EA 1BL4A 2KGJA 4DRNA 5J6EA 2RQSA 1D7HA 3IKDA 4MSPA 3MDYB 4DRMA 4DZ3A 5HW8A 4LAWA 2MPHA 3KAIA 4R0XA 3UQIA 2MLXA 3TDBA 1J4RA 1NMVA 2RSEA 1W26A 3TC5A 2PPNA 4J4OA 1NSGA 1QPLA 1QPFA 4C02B 3WH0A 4DRPA 1ZCNA 3NRKA 4JFKA 1D7IA 2XP4A 1FKKA 4IQCA 4TW7A 1ZK6A 2MNTA 4DIPA 3ODKA 2MLZA 2Y78A 2PV2A 1FKDA 2D9FA 2Q5AA 1M5YA 4DRKA 3I6CA 2LGOA 3O5PA 1ROTA 5HW7A 1J6YA 3O5JA 4MGVA 4ODRA 4ODPA 2XP8A 4DH0A 2PBCA 1ROUA 3KAFA 4LAVA 3KABA 2LPVA 1D7JA 2LJ4A 2MLYA 3O5KA 2FKEA 1BKFA 2DG3A 3B7XA 2KFWA 3O5RA 1HXVA 1FKTA 4FN2A 1Q1CA 1YATA 1FKLA 2AWGA 3FAPA 5HWBA 1N1AA 5DITA 1YW5A 1FKRA 4DRIA 1FD9A 3CGNA 2ZQUA
chains in the Genus database with same CATH superfamily
5JH8A 2ZR6A 1LL4A 1W9UA 3B9EA 3GTYX 4LAYA 1H0IA 4DRQA 2XP6A 3O5IA 2B5UB 1W9VA 1CTNA 2ZQVA 1EDQA 2M2AA 5GQBA 5DO2A 1EQ3A 3WQWA 1HKJA 3ARTA 3O5OA 3G6LA 3CHDA 2A3EA 4O2TA 3WIJA 1FKGA 4DT4A 1A7XA 4MNKA 3KAGA 4TYOA 3EY6A 1HJVA 4U86A 1ZL1A 4R5EA 3NTPA 1GPFA 2N87A 2IF4A 3IKGA 2XP7A 3IHZA 3LUOA 3WD0A 4ODLA 1Y0OA 3O5LA 4MNJA 3RFWA 4Q22A 2RUDA 2KR7A 3H9RB 2G41A 3O5FA 2RUQA 1F8AB 5BXJA 3ARSA 3O5QA 3CH9A 4JFJA 4JFMA 5GPGA 1SYTA 3CHEA 3PRDA 3ALFA 4QT3A 3WD4A 3UI4A 1LG1A 3OOBA 1JNDA 1HKMA 2DT3A 1E15A 1RD6A 3RM9A 1NWUA 2K8IA 3JYMA 1KT1A 4GIVA 4W9OA 2XP9A 4LGXA 2O9OA 2KGJA 1D7HA 5DEZA 2MLXA 3WL0A 1NSGA 1QPFA 3AS2A 4IT6A 2YBUA 4DWSB 3NRKA 1D7IA 3ARWA 1ZK6A 2MNTA 4PTMA 1FFRA 4DIPA 2EULA 1H0GA 2MLZA 2Y78A 1FKDA 4DRKA 2LGOA 3O5PA 5HW7A 1J6YA 1E6RA 4DH0A 2DPEA 4LAVA 1ZBCA 2LPVA 1D7JA 1WNOA 4WKHA 2KFWA 2AWGA 1FKLA 3ARRA 3FAPA 4NSBA 1FD9A 3CGNA 2ZQUA 4ZPTR 4WKFA 4KQZA 3ARZA 5HKGA 4L72B 3AROA 1PBKA 4AY1A 1TCOC 3O5GA 1OGBA 1UR8A 3B8SA 3O5MA 2PV3A 1HKIA 3CHFA 4IT4A 2ITKA 3JXVA 1Q6HA 4ODQA 2OFNA 4Z2KA 4QIBA 4TNSA 4IPXA 1C9HA 1VF8A 1UR9A 3ARQA 1R9HA 1E44A 2XPAA 2DSWA 3GPKA 3RMEA 4DRJA 2FAPA 1U79A 1E6NA 1JNSA 1LQ0A 2PPPA 2XPBA 3KCEA 3UF8A 4P8XA 2DG4A 4DZ2A 3PA7A 2WLYA 3UI6A 1JVWA 1FKFA 2QF8A 4JYSA 4KR0B 1IX5A 2KI3A 2M1IA 2RUCA 4QT2A 5GPRA 3NI6A 4DROA 4BF8A 2PV1A 4W9QA 3UQBA 4P8WA 5DIUA 2PI6A 4ZPWR 1K9TA 2PPOA 3OA5A 1FKHA 1O6IA 3O5EA 1BL4A 4S3KA 2RQSA 4DZ3A 4DRMA 1ZBKA 4QZVB 3QOKA 5J6EA 3PRAA 1X6LA 4DWSD 4Z2LA 1NMVA 4Z2IA 1E9LA 3TC5A 4J4OA 4DRPA 4JFKA 3BMBA 1LJYA 4TW7A 3WD1A 4HARA 3I6CA 3BXWA 3AS1A 1HKKA 2PN0A 3ARXA 4MNLA 1ROUA 4ZPVR 4MAVA 2MLYA 1SR0A 5HBFA 2DG3A 2F23A 3O5RA 1EHNA 5HWBA 1N1AA 1YW5A 4DRIA 3G6MA 4URIA 1B6CA 2ZR5A 2G8ZA 1P5QA 1GRJA 1FAPA 5B8IC 4NNRA 3FY1A 1F40A 1X6NA 2XP3A 2DSUA 3CHCA 4G2PA 1WAWA 1EYMA 2DSVA 1D6OA 5HTGA 2KE0A 4DWSC 1GUVA 2FDMA 2MF9A 1OWQA 3KZ7A 4J4NA 4MPKA 4LAXA 4DRHA 4MTVA 1QZ2A 2ZQSA 2YBTA 2P4VA 3IK8A 5HT1A 1Q6UA 1NWRA 1PINA 1NMWA 4UDMA 3B9DA 1J4HA 3WD2A 3AS0A 1LL7A 2WM0A 1W1VA 2ETNA 4TX0A 3KAHA 2VN1A 1FFQA 4ITZA 2UZ5A 1FKBA 2ZQTA 2M08A 1EIBA 1E6PA 4P8VA 2RURA 2WK2A 1W1PA 2F4EA 3VAWA 3EIPA 3RM8A 4N19A 4Z2GA 1W1YA 5HWCA 2F21A 1D2KA 1L1PA 3UI5A 2ZR4A 4Z2HA 2LKNA 1JCHB 4DRNA 2A3AA 1OGGA 4MSPA 5HW8A 3MDYB 4WK9A 1XRVA 1WB0A 2MPHA 3UQIA 1ZBWA 1XHGA 1J4RA 4ZS6A 1W26A 3FXYA 1QPLA 4C02B 2WLZA 1FKKA 1LL6A 4W5UA 1NWTA 2IUZA 2PV2A 2D9FA 2O92A 4Z2JA 1ROTA 2ESCA 3O5JA 4MGVA 2PBCA 3KAFA 1ITXA 4DWSA 1BKFA 3B7XA 2AOSA 1FKTA 4FN2A 1Q1CA 3ARPA 3ARYA 5DITA 1HJWA 2DT1A 1W9PA 3RGCA 1E6ZA 3B9AA 2VCDA 1KT0A 3CGMA 1Q6IA 4ODNA 4FAPA 1LG2A 5I98A 3O5DA 5HW6A 2XP5A 2JZVA 2DSZA 1TFVA 4JFIA 2OLHA 1FKJA 4IQ2A 4TW6A 5DIVA 3UQAA 1T11A 3KACA 5DF0A 4GGQA 3WQVA 1ZB5A 4W9PA 4U85A 1FKSA 3GU0A 1J4IA 1ZU8A 2B31A 2L2SA 4ODOA 4L3NA 4G50A 5HUAA 3KADA 4ML4A 3JYJA 5D75A 4MNMA 2DG9A 1W1TA 2A3BA 3PR9A 1FJDA 4JFLA 4TW8A 1JNTA 4U84A 3RM4A 3TCZA 3AQUA 3AS3A 4HBEA 4ODKA 1FKIA 1NH6A 2KO7A 2DT2A 3PRBA 4ODMA 2DT0A 2F2DA 3CZ8A 3ARUA 4XAKA 1KFWA 3IKDA 4WKAA 4LAWA 3KAIA 4NZCA 4R0XA 3W4RA 3TDBA 2RSEA 2PPNA 3ARVA 3ALGA 3WH0A 1ZCNA 1NWSA 2XP4A 3WL1A 4IQCA 1JNEA 4S3JA 3ODKA 4P8UA 2Q5AA 1M5YA 1HJXA 4ODRA 4ODPA 2XP8A 2A3CA 1ZBVA 4WJXA 3KABA 4WIWA 2LJ4A 3O5KA 2FKEA 1HXVA 1GOIA 1YATA 3WD3A 4HBOA 4Q7NA 1FKRA 3WKZA
chains in the Genus database with same CATH topology
5JH8A 2ZR6A 1LL4A 1W9UA 3B9EA 4LAYA 4DRQA 1H0IA 2XP6A 3O5IA 1W9VA 1CTNA 2ZQVA 1EDQA 2M2AA 5GQBA 5DO2A 1EQ3A 3WQWA 1HKJA 3ARTA 3O5OA 3G6LA 3CHDA 2A3EA 4O2TA 3WIJA 1FKGA 4DT4A 1A7XA 4MNKA 3KAGA 4TYOA 3EY6A 1HJVA 4U86A 1ZL1A 4R5EA 3NTPA 1GPFA 2N87A 2IF4A 3IKGA 2XP7A 3IHZA 3LUOA 3WD0A 4ODLA 1Y0OA 3O5LA 4MNJA 3RFWA 4Q22A 2RUDA 2KR7A 3H9RB 2G41A 3O5FA 2RUQA 1F8AB 5BXJA 3ARSA 3O5QA 3CH9A 4JFJA 4JFMA 5GPGA 1SYTA 3CHEA 3PRDA 3ALFA 4QT3A 3WD4A 3UI4A 1LG1A 3OOBA 1JNDA 1HKMA 2DT3A 1E15A 1RD6A 3RM9A 1NWUA 2K8IA 3JYMA 1KT1A 4GIVA 4W9OA 2XP9A 4LGXA 2O9OA 2KGJA 1D7HA 5DEZA 2MLXA 3WL0A 1NSGA 1QPFA 3AS2A 4IT6A 2YBUA 4DWSB 3NRKA 1D7IA 3ARWA 1ZK6A 2MNTA 4PTMA 1FFRA 4DIPA 1H0GA 2MLZA 2Y78A 1FKDA 4DRKA 2LGOA 3O5PA 5HW7A 1J6YA 1E6RA 4DH0A 2DPEA 4LAVA 1ZBCA 2LPVA 1D7JA 1WNOA 4WKHA 2KFWA 2AWGA 1FKLA 3ARRA 3FAPA 4NSBA 1FD9A 3CGNA 2ZQUA 4ZPTR 4WKFA 4KQZA 3ARZA 5HKGA 4L72B 3AROA 1PBKA 4AY1A 1TCOC 3O5GA 1OGBA 1UR8A 3B8SA 3O5MA 2PV3A 1HKIA 3CHFA 4IT4A 2ITKA 3JXVA 1Q6HA 4ODQA 2OFNA 4Z2KA 4QIBA 4TNSA 4IPXA 1C9HA 1VF8A 1UR9A 3ARQA 1R9HA 2XPAA 2DSWA 3GPKA 3RMEA 4DRJA 2FAPA 1U79A 1E6NA 1JNSA 1LQ0A 2PPPA 2XPBA 3KCEA 3UF8A 4P8XA 2DG4A 4DZ2A 3PA7A 2WLYA 3UI6A 1JVWA 1FKFA 2QF8A 4JYSA 4KR0B 1IX5A 2KI3A 2M1IA 2RUCA 4QT2A 5GPRA 3NI6A 4DROA 4BF8A 2PV1A 4W9QA 3UQBA 4P8WA 5DIUA 2PI6A 4ZPWR 1K9TA 2PPOA 3OA5A 1FKHA 1O6IA 3O5EA 1BL4A 4S3KA 2RQSA 4DZ3A 4DRMA 1ZBKA 4QZVB 3QOKA 5J6EA 3PRAA 1X6LA 4DWSD 4Z2LA 1NMVA 4Z2IA 1E9LA 3TC5A 4J4OA 4DRPA 4JFKA 1LJYA 4TW7A 3WD1A 4HARA 3I6CA 3BXWA 3AS1A 1HKKA 3ARXA 4MNLA 1ROUA 4ZPVR 4MAVA 2MLYA 1SR0A 5HBFA 2DG3A 3O5RA 1EHNA 5HWBA 1N1AA 1YW5A 4DRIA 3G6MA 4URIA 1B6CA 2ZR5A 2G8ZA 1P5QA 1FAPA 5B8IC 4NNRA 3FY1A 1F40A 1X6NA 2XP3A 2DSUA 3CHCA 4G2PA 1WAWA 1EYMA 2DSVA 1D6OA 5HTGA 2KE0A 4DWSC 1GUVA 2FDMA 2MF9A 1OWQA 3KZ7A 4J4NA 4MPKA 4LAXA 4DRHA 4MTVA 1QZ2A 2ZQSA 2YBTA 3IK8A 5HT1A 1Q6UA 1NWRA 1PINA 1NMWA 3B9DA 1J4HA 3WD2A 3AS0A 1LL7A 2WM0A 1W1VA 4TX0A 3KAHA 2VN1A 4ITZA 1FFQA 2UZ5A 1FKBA 2ZQTA 2M08A 1EIBA 1E6PA 4P8VA 2RURA 2WK2A 1W1PA 2F4EA 3VAWA 3RM8A 4N19A 4Z2GA 1W1YA 5HWCA 2F21A 1D2KA 1L1PA 3UI5A 2ZR4A 4Z2HA 2LKNA 4DRNA 2A3AA 1OGGA 4MSPA 5HW8A 3MDYB 4WK9A 1XRVA 1WB0A 2MPHA 3UQIA 1ZBWA 1XHGA 1J4RA 4ZS6A 1W26A 3FXYA 1QPLA 4C02B 2WLZA 1FKKA 1LL6A 4W5UA 1NWTA 2IUZA 2PV2A 2D9FA 2O92A 4Z2JA 1ROTA 2ESCA 3O5JA 4MGVA 2PBCA 3KAFA 1ITXA 4DWSA 1BKFA 3B7XA 2AOSA 1FKTA 4FN2A 1Q1CA 3ARPA 3ARYA 5DITA 1HJWA 2DT1A 1W9PA 3RGCA 1E6ZA 3B9AA 2VCDA 1KT0A 3CGMA 1Q6IA 4ODNA 4FAPA 1LG2A 5I98A 3O5DA 5HW6A 2XP5A 2JZVA 2DSZA 1TFVA 4JFIA 2OLHA 1FKJA 4IQ2A 4TW6A 5DIVA 3UQAA 1T11A 3KACA 5DF0A 4GGQA 3WQVA 1ZB5A 4W9PA 4U85A 1FKSA 1J4IA 1ZU8A 2B31A 2L2SA 4ODOA 4L3NA 4G50A 5HUAA 3KADA 4ML4A 3JYJA 5D75A 4MNMA 2DG9A 1W1TA 2A3BA 3PR9A 1FJDA 4JFLA 4TW8A 1JNTA 4U84A 3RM4A 3TCZA 3AQUA 3AS3A 4HBEA 4ODKA 1FKIA 1NH6A 2KO7A 2DT2A 3PRBA 4ODMA 2DT0A 2F2DA 3CZ8A 3ARUA 4XAKA 1KFWA 3IKDA 4WKAA 4LAWA 3KAIA 4NZCA 4R0XA 3W4RA 3TDBA 2RSEA 2PPNA 3ARVA 3ALGA 3WH0A 1ZCNA 1NWSA 2XP4A 3WL1A 4IQCA 1JNEA 4S3JA 3ODKA 4P8UA 2Q5AA 1M5YA 1HJXA 4ODRA 4ODPA 2XP8A 2A3CA 1ZBVA 4WJXA 3KABA 4WIWA 2LJ4A 3O5KA 2FKEA 1HXVA 1GOIA 1YATA 3WD3A 4HBOA 4Q7NA 1FKRA 3WKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZR6 A;  1B6C A;  2ZR5 A;  1P5Q A;  3RGC A;  4LAY A;  1FAP A;  4DRQ A;  5B8I C;  2XP6 A;  3O5I A;  2VCD A;  4NNR A;  5HKG A;  1KT0 A;  1PBK A;  1F40 A;  2XP3 A;  3CGM A;  1Q6I A;  1TCO C;  2ZQV A;  2M2A A;  3O5G A;  4G2P A;  1EYM A;  4ODN A;  1EQ3 A;  4FAP A;  1D6O A;  3O5M A;  5I98 A;  2PV3 A;  2KE0 A;  5HTG A;  3O5D A;  2ITK A;  3JXV A;  2MF9 A;  5HW6 A;  2XP5 A;  3KZ7 A;  1Q6H A;  2JZV A;  3O5O A;  4J4N A;  4ODQ A;  2OFN A;  4O2T A;  4LAX A;  4JFI A;  4DRH A;  1FKG A;  4QIB A;  4DT4 A;  1A7X A;  4TYO A;  1QZ2 A;  1FKJ A;  3KAG A;  4IQ2 A;  4TNS A;  3EY6 A;  4U86 A;  4IPX A;  1C9H A;  4TW6 A;  2ZQS A;  5DIV A;  3UQA A;  1T11 A;  3IK8 A;  5HT1 A;  3NTP A;  1Q6U A;  2N87 A;  3KAC A;  2IF4 A;  1PIN A;  3IKG A;  2XP7 A;  1NMW A;  1R9H A;  4GGQ A;  2XPA A;  3IHZ A;  3LUO A;  4ODL A;  1Y0O A;  3O5L A;  4W9P A;  4U85 A;  3GPK A;  1FKS A;  1J4H A;  3RFW A;  2RUD A;  2KR7 A;  3H9R B;  1J4I A;  4DRJ A;  2FAP A;  1U79 A;  3O5F A;  1JNS A;  2RUQ A;  1F8A B;  2L2S A;  4ODO A;  2PPP A;  5BXJ A;  2XPB A;  3O5Q A;  4TX0 A;  3KCE A;  3UF8 A;  3KAH A;  4G50 A;  2VN1 A;  3KAD A;  4JFJ A;  4JFM A;  5GPG A;  5HUA A;  3JYJ A;  4ITZ A;  2DG4 A;  2UZ5 A;  1FKB A;  2ZQT A;  5D75 A;  3PA7 A;  2M08 A;  2DG9 A;  4DZ2 A;  3UI6 A;  3PRD A;  1JVW A;  1FKF A;  4QT3 A;  3UI4 A;  1FJD A;  4JFL A;  2RUR A;  3OOB A;  4TW8 A;  1JNT A;  4U84 A;  2F4E A;  4JYS A;  2KI3 A;  3VAW A;  2M1I A;  2RUC A;  4QT2 A;  4DRO A;  3NI6 A;  3TCZ A;  4BF8 A;  2PV1 A;  4N19 A;  4W9Q A;  3UQB A;  4ODK A;  1FKI A;  5HWC A;  5DIU A;  2F21 A;  2K8I A;  3JYM A;  1KT1 A;  4GIV A;  2ZR4 A;  3UI5 A;  2KO7 A;  3PRB A;  4ODM A;  4W9O A;  1L1P A;  2XP9 A;  2PPO A;  2F2D A;  2LKN A;  1FKH A;  3O5E A;  1BL4 A;  2KGJ A;  4DRN A;  5J6E A;  2RQS A;  1D7H A;  3IKD A;  4MSP A;  3MDY B;  4DRM A;  4DZ3 A;  5HW8 A;  4LAW A;  2MPH A;  3KAI A;  4R0X A;  3UQI A;  2MLX A;  3TDB A;  1J4R A;  1NMV A;  2RSE A;  1W26 A;  3TC5 A;  2PPN A;  4J4O A;  1NSG A;  1QPL A;  1QPF A;  4C02 B;  3WH0 A;  4DRP A;  1ZCN A;  3NRK A;  4JFK A;  1D7I A;  2XP4 A;  1FKK A;  4IQC A;  4TW7 A;  1ZK6 A;  2MNT A;  4DIP A;  3ODK A;  2MLZ A;  2Y78 A;  2PV2 A;  1FKD A;  2D9F A;  2Q5A A;  1M5Y A;  4DRK A;  3I6C A;  2LGO A;  3O5P A;  1ROT A;  5HW7 A;  1J6Y A;  3O5J A;  4MGV A;  4ODR A;  4ODP A;  2XP8 A;  4DH0 A;  2PBC A;  1ROU A;  3KAF A;  4LAV A;  3KAB A;  2LPV A;  1D7J A;  2LJ4 A;  2MLY A;  3O5K A;  2FKE A;  1BKF A;  2DG3 A;  3B7X A;  2KFW A;  3O5R A;  1HXV A;  1FKT A;  4FN2 A;  1Q1C A;  1YAT A;  1FKL A;  2AWG A;  3FAP A;  5HWB A;  1N1A A;  5DIT A;  1YW5 A;  1FKR A;  4DRI A;  1FD9 A;  3CGN A;  2ZQU A; 
#chains in the Genus database with same CATH topology
 5JH8 A;  2ZR6 A;  1LL4 A;  1W9U A;  3B9E A;  3GTY X;  4LAY A;  1H0I A;  4DRQ A;  2XP6 A;  3O5I A;  2B5U B;  1W9V A;  1CTN A;  2ZQV A;  1EDQ A;  2M2A A;  5GQB A;  5DO2 A;  1EQ3 A;  3WQW A;  1HKJ A;  3ART A;  3O5O A;  3G6L A;  3CHD A;  2A3E A;  4O2T A;  3WIJ A;  1FKG A;  4DT4 A;  1A7X A;  4MNK A;  3KAG A;  4TYO A;  3EY6 A;  1HJV A;  4U86 A;  1ZL1 A;  4R5E A;  3NTP A;  1GPF A;  2N87 A;  2IF4 A;  3IKG A;  2XP7 A;  3IHZ A;  3LUO A;  3WD0 A;  4ODL A;  1Y0O A;  3O5L A;  4MNJ A;  3RFW A;  4Q22 A;  2RUD A;  2KR7 A;  3H9R B;  2G41 A;  3O5F A;  2RUQ A;  1F8A B;  5BXJ A;  3ARS A;  3O5Q A;  3CH9 A;  4JFJ A;  4JFM A;  5GPG A;  1SYT A;  3CHE A;  3PRD A;  3ALF A;  4QT3 A;  3WD4 A;  3UI4 A;  1LG1 A;  3OOB A;  1JND A;  1HKM A;  2DT3 A;  1E15 A;  1RD6 A;  3RM9 A;  1NWU A;  2K8I A;  3JYM A;  1KT1 A;  4GIV A;  4W9O A;  2XP9 A;  4LGX A;  2O9O A;  2KGJ A;  1D7H A;  5DEZ A;  2MLX A;  3WL0 A;  1NSG A;  1QPF A;  3AS2 A;  4IT6 A;  2YBU A;  4DWS B;  3NRK A;  1D7I A;  3ARW A;  1ZK6 A;  2MNT A;  4PTM A;  1FFR A;  4DIP A;  2EUL A;  1H0G A;  2MLZ A;  2Y78 A;  1FKD A;  4DRK A;  2LGO A;  3O5P A;  5HW7 A;  1J6Y A;  1E6R A;  4DH0 A;  2DPE A;  4LAV A;  1ZBC A;  2LPV A;  1D7J A;  1WNO A;  4WKH A;  2KFW A;  2AWG A;  1FKL A;  3ARR A;  3FAP A;  4NSB A;  1FD9 A;  3CGN A;  2ZQU A;  4ZPT R;  4WKF A;  4KQZ A;  3ARZ A;  5HKG A;  4L72 B;  3ARO A;  1PBK A;  4AY1 A;  1TCO C;  3O5G A;  1OGB A;  1UR8 A;  3B8S A;  3O5M A;  2PV3 A;  1HKI A;  3CHF A;  4IT4 A;  2ITK A;  3JXV A;  1Q6H A;  4ODQ A;  2OFN A;  4Z2K A;  4QIB A;  4TNS A;  4IPX A;  1C9H A;  1VF8 A;  1UR9 A;  3ARQ A;  1R9H A;  1E44 A;  2XPA A;  2DSW A;  3GPK A;  3RME A;  4DRJ A;  2FAP A;  1U79 A;  1E6N A;  1JNS A;  1LQ0 A;  2PPP A;  2XPB A;  3KCE A;  3UF8 A;  4P8X A;  2DG4 A;  4DZ2 A;  3PA7 A;  2WLY A;  3UI6 A;  1JVW A;  1FKF A;  2QF8 A;  4JYS A;  4KR0 B;  1IX5 A;  2KI3 A;  2M1I A;  2RUC A;  4QT2 A;  5GPR A;  3NI6 A;  4DRO A;  4BF8 A;  2PV1 A;  4W9Q A;  3UQB A;  4P8W A;  5DIU A;  2PI6 A;  4ZPW R;  1K9T A;  2PPO A;  3OA5 A;  1FKH A;  1O6I A;  3O5E A;  1BL4 A;  4S3K A;  2RQS A;  4DZ3 A;  4DRM A;  1ZBK A;  4QZV B;  3QOK A;  5J6E A;  3PRA A;  1X6L A;  4DWS D;  4Z2L A;  1NMV A;  4Z2I A;  1E9L A;  3TC5 A;  4J4O A;  4DRP A;  4JFK A;  3BMB A;  1LJY A;  4TW7 A;  3WD1 A;  4HAR A;  3I6C A;  3BXW A;  3AS1 A;  1HKK A;  2PN0 A;  3ARX A;  4MNL A;  1ROU A;  4ZPV R;  4MAV A;  2MLY A;  1SR0 A;  5HBF A;  2DG3 A;  2F23 A;  3O5R A;  1EHN A;  5HWB A;  1N1A A;  1YW5 A;  4DRI A;  3G6M A;  4URI A;  1B6C A;  2ZR5 A;  2G8Z A;  1P5Q A;  1GRJ A;  1FAP A;  5B8I C;  4NNR A;  3FY1 A;  1F40 A;  1X6N A;  2XP3 A;  2DSU A;  3CHC A;  4G2P A;  1WAW A;  1EYM A;  2DSV A;  1D6O A;  5HTG A;  2KE0 A;  4DWS C;  1GUV A;  2FDM A;  2MF9 A;  1OWQ A;  3KZ7 A;  4J4N A;  4MPK A;  4LAX A;  4DRH A;  4MTV A;  1QZ2 A;  2ZQS A;  2YBT A;  2P4V A;  3IK8 A;  5HT1 A;  1Q6U A;  1NWR A;  1PIN A;  1NMW A;  4UDM A;  3B9D A;  1J4H A;  3WD2 A;  3AS0 A;  1LL7 A;  2WM0 A;  1W1V A;  2ETN A;  4TX0 A;  3KAH A;  2VN1 A;  1FFQ A;  4ITZ A;  2UZ5 A;  1FKB A;  2ZQT A;  2M08 A;  1EIB A;  1E6P A;  4P8V A;  2RUR A;  2WK2 A;  1W1P A;  2F4E A;  3VAW A;  3EIP A;  3RM8 A;  4N19 A;  4Z2G A;  1W1Y A;  5HWC A;  2F21 A;  1D2K A;  1L1P A;  3UI5 A;  2ZR4 A;  4Z2H A;  2LKN A;  1JCH B;  4DRN A;  2A3A A;  1OGG A;  4MSP A;  5HW8 A;  3MDY B;  4WK9 A;  1XRV A;  1WB0 A;  2MPH A;  3UQI A;  1ZBW A;  1XHG A;  1J4R A;  4ZS6 A;  1W26 A;  3FXY A;  1QPL A;  4C02 B;  2WLZ A;  1FKK A;  1LL6 A;  4W5U A;  1NWT A;  2IUZ A;  2PV2 A;  2D9F A;  2O92 A;  4Z2J A;  1ROT A;  2ESC A;  3O5J A;  4MGV A;  2PBC A;  3KAF A;  1ITX A;  4DWS A;  1BKF A;  3B7X A;  2AOS A;  1FKT A;  4FN2 A;  1Q1C A;  3ARP A;  3ARY A;  5DIT A;  1HJW A;  2DT1 A;  1W9P A;  3RGC A;  1E6Z A;  3B9A A;  2VCD A;  1KT0 A;  3CGM A;  1Q6I A;  4ODN A;  4FAP A;  1LG2 A;  5I98 A;  3O5D A;  5HW6 A;  2XP5 A;  2JZV A;  2DSZ A;  1TFV A;  4JFI A;  2OLH A;  1FKJ A;  4IQ2 A;  4TW6 A;  5DIV A;  3UQA A;  1T11 A;  3KAC A;  5DF0 A;  4GGQ A;  3WQV A;  1ZB5 A;  4W9P A;  4U85 A;  1FKS A;  3GU0 A;  1J4I A;  1ZU8 A;  2B31 A;  2L2S A;  4ODO A;  4L3N A;  4G50 A;  5HUA A;  3KAD A;  4ML4 A;  3JYJ A;  5D75 A;  4MNM A;  2DG9 A;  1W1T A;  2A3B A;  3PR9 A;  1FJD A;  4JFL A;  4TW8 A;  1JNT A;  4U84 A;  3RM4 A;  3TCZ A;  3AQU A;  3AS3 A;  4HBE A;  4ODK A;  1FKI A;  1NH6 A;  2KO7 A;  2DT2 A;  3PRB A;  4ODM A;  2DT0 A;  2F2D A;  3CZ8 A;  3ARU A;  4XAK A;  1KFW A;  3IKD A;  4WKA A;  4LAW A;  3KAI A;  4NZC A;  4R0X A;  3W4R A;  3TDB A;  2RSE A;  2PPN A;  3ARV A;  3ALG A;  3WH0 A;  1ZCN A;  1NWS A;  2XP4 A;  3WL1 A;  4IQC A;  1JNE A;  4S3J A;  3ODK A;  4P8U A;  2Q5A A;  1M5Y A;  1HJX A;  4ODR A;  4ODP A;  2XP8 A;  2A3C A;  1ZBV A;  4WJX A;  3KAB A;  4WIW A;  2LJ4 A;  3O5K A;  2FKE A;  1HXV A;  1GOI A;  1YAT A;  3WD3 A;  4HBO A;  4Q7N A;  1FKR A;  3WKZ A; 
#chains in the Genus database with same CATH homology
 5JH8 A;  2ZR6 A;  1LL4 A;  1W9U A;  3B9E A;  4LAY A;  4DRQ A;  1H0I A;  2XP6 A;  3O5I A;  1W9V A;  1CTN A;  2ZQV A;  1EDQ A;  2M2A A;  5GQB A;  5DO2 A;  1EQ3 A;  3WQW A;  1HKJ A;  3ART A;  3O5O A;  3G6L A;  3CHD A;  2A3E A;  4O2T A;  3WIJ A;  1FKG A;  4DT4 A;  1A7X A;  4MNK A;  3KAG A;  4TYO A;  3EY6 A;  1HJV A;  4U86 A;  1ZL1 A;  4R5E A;  3NTP A;  1GPF A;  2N87 A;  2IF4 A;  3IKG A;  2XP7 A;  3IHZ A;  3LUO A;  3WD0 A;  4ODL A;  1Y0O A;  3O5L A;  4MNJ A;  3RFW A;  4Q22 A;  2RUD A;  2KR7 A;  3H9R B;  2G41 A;  3O5F A;  2RUQ A;  1F8A B;  5BXJ A;  3ARS A;  3O5Q A;  3CH9 A;  4JFJ A;  4JFM A;  5GPG A;  1SYT A;  3CHE A;  3PRD A;  3ALF A;  4QT3 A;  3WD4 A;  3UI4 A;  1LG1 A;  3OOB A;  1JND A;  1HKM A;  2DT3 A;  1E15 A;  1RD6 A;  3RM9 A;  1NWU A;  2K8I A;  3JYM A;  1KT1 A;  4GIV A;  4W9O A;  2XP9 A;  4LGX A;  2O9O A;  2KGJ A;  1D7H A;  5DEZ A;  2MLX A;  3WL0 A;  1NSG A;  1QPF A;  3AS2 A;  4IT6 A;  2YBU A;  4DWS B;  3NRK A;  1D7I A;  3ARW A;  1ZK6 A;  2MNT A;  4PTM A;  1FFR A;  4DIP A;  1H0G A;  2MLZ A;  2Y78 A;  1FKD A;  4DRK A;  2LGO A;  3O5P A;  5HW7 A;  1J6Y A;  1E6R A;  4DH0 A;  2DPE A;  4LAV A;  1ZBC A;  2LPV A;  1D7J A;  1WNO A;  4WKH A;  2KFW A;  2AWG A;  1FKL A;  3ARR A;  3FAP A;  4NSB A;  1FD9 A;  3CGN A;  2ZQU A;  4ZPT R;  4WKF A;  4KQZ A;  3ARZ A;  5HKG A;  4L72 B;  3ARO A;  1PBK A;  4AY1 A;  1TCO C;  3O5G A;  1OGB A;  1UR8 A;  3B8S A;  3O5M A;  2PV3 A;  1HKI A;  3CHF A;  4IT4 A;  2ITK A;  3JXV A;  1Q6H A;  4ODQ A;  2OFN A;  4Z2K A;  4QIB A;  4TNS A;  4IPX A;  1C9H A;  1VF8 A;  1UR9 A;  3ARQ A;  1R9H A;  2XPA A;  2DSW A;  3GPK A;  3RME A;  4DRJ A;  2FAP A;  1U79 A;  1E6N A;  1JNS A;  1LQ0 A;  2PPP A;  2XPB A;  3KCE A;  3UF8 A;  4P8X A;  2DG4 A;  4DZ2 A;  3PA7 A;  2WLY A;  3UI6 A;  1JVW A;  1FKF A;  2QF8 A;  4JYS A;  4KR0 B;  1IX5 A;  2KI3 A;  2M1I A;  2RUC A;  4QT2 A;  5GPR A;  3NI6 A;  4DRO A;  4BF8 A;  2PV1 A;  4W9Q A;  3UQB A;  4P8W A;  5DIU A;  2PI6 A;  4ZPW R;  1K9T A;  2PPO A;  3OA5 A;  1FKH A;  1O6I A;  3O5E A;  1BL4 A;  4S3K A;  2RQS A;  4DZ3 A;  4DRM A;  1ZBK A;  4QZV B;  3QOK A;  5J6E A;  3PRA A;  1X6L A;  4DWS D;  4Z2L A;  1NMV A;  4Z2I A;  1E9L A;  3TC5 A;  4J4O A;  4DRP A;  4JFK A;  1LJY A;  4TW7 A;  3WD1 A;  4HAR A;  3I6C A;  3BXW A;  3AS1 A;  1HKK A;  3ARX A;  4MNL A;  1ROU A;  4ZPV R;  4MAV A;  2MLY A;  1SR0 A;  5HBF A;  2DG3 A;  3O5R A;  1EHN A;  5HWB A;  1N1A A;  1YW5 A;  4DRI A;  3G6M A;  4URI A;  1B6C A;  2ZR5 A;  2G8Z A;  1P5Q A;  1FAP A;  5B8I C;  4NNR A;  3FY1 A;  1F40 A;  1X6N A;  2XP3 A;  2DSU A;  3CHC A;  4G2P A;  1WAW A;  1EYM A;  2DSV A;  1D6O A;  5HTG A;  2KE0 A;  4DWS C;  1GUV A;  2FDM A;  2MF9 A;  1OWQ A;  3KZ7 A;  4J4N A;  4MPK A;  4LAX A;  4DRH A;  4MTV A;  1QZ2 A;  2ZQS A;  2YBT A;  3IK8 A;  5HT1 A;  1Q6U A;  1NWR A;  1PIN A;  1NMW A;  3B9D A;  1J4H A;  3WD2 A;  3AS0 A;  1LL7 A;  2WM0 A;  1W1V A;  4TX0 A;  3KAH A;  2VN1 A;  4ITZ A;  1FFQ A;  2UZ5 A;  1FKB A;  2ZQT A;  2M08 A;  1EIB A;  1E6P A;  4P8V A;  2RUR A;  2WK2 A;  1W1P A;  2F4E A;  3VAW A;  3RM8 A;  4N19 A;  4Z2G A;  1W1Y A;  5HWC A;  2F21 A;  1D2K A;  1L1P A;  3UI5 A;  2ZR4 A;  4Z2H A;  2LKN A;  4DRN A;  2A3A A;  1OGG A;  4MSP A;  5HW8 A;  3MDY B;  4WK9 A;  1XRV A;  1WB0 A;  2MPH A;  3UQI A;  1ZBW A;  1XHG A;  1J4R A;  4ZS6 A;  1W26 A;  3FXY A;  1QPL A;  4C02 B;  2WLZ A;  1FKK A;  1LL6 A;  4W5U A;  1NWT A;  2IUZ A;  2PV2 A;  2D9F A;  2O92 A;  4Z2J A;  1ROT A;  2ESC A;  3O5J A;  4MGV A;  2PBC A;  3KAF A;  1ITX A;  4DWS A;  1BKF A;  3B7X A;  2AOS A;  1FKT A;  4FN2 A;  1Q1C A;  3ARP A;  3ARY A;  5DIT A;  1HJW A;  2DT1 A;  1W9P A;  3RGC A;  1E6Z A;  3B9A A;  2VCD A;  1KT0 A;  3CGM A;  1Q6I A;  4ODN A;  4FAP A;  1LG2 A;  5I98 A;  3O5D A;  5HW6 A;  2XP5 A;  2JZV A;  2DSZ A;  1TFV A;  4JFI A;  2OLH A;  1FKJ A;  4IQ2 A;  4TW6 A;  5DIV A;  3UQA A;  1T11 A;  3KAC A;  5DF0 A;  4GGQ A;  3WQV A;  1ZB5 A;  4W9P A;  4U85 A;  1FKS A;  1J4I A;  1ZU8 A;  2B31 A;  2L2S A;  4ODO A;  4L3N A;  4G50 A;  5HUA A;  3KAD A;  4ML4 A;  3JYJ A;  5D75 A;  4MNM A;  2DG9 A;  1W1T A;  2A3B A;  3PR9 A;  1FJD A;  4JFL A;  4TW8 A;  1JNT A;  4U84 A;  3RM4 A;  3TCZ A;  3AQU A;  3AS3 A;  4HBE A;  4ODK A;  1FKI A;  1NH6 A;  2KO7 A;  2DT2 A;  3PRB A;  4ODM A;  2DT0 A;  2F2D A;  3CZ8 A;  3ARU A;  4XAK A;  1KFW A;  3IKD A;  4WKA A;  4LAW A;  3KAI A;  4NZC A;  4R0X A;  3W4R A;  3TDB A;  2RSE A;  2PPN A;  3ARV A;  3ALG A;  3WH0 A;  1ZCN A;  1NWS A;  2XP4 A;  3WL1 A;  4IQC A;  1JNE A;  4S3J A;  3ODK A;  4P8U A;  2Q5A A;  1M5Y A;  1HJX A;  4ODR A;  4ODP A;  2XP8 A;  2A3C A;  1ZBV A;  4WJX A;  3KAB A;  4WIW A;  2LJ4 A;  3O5K A;  2FKE A;  1HXV A;  1GOI A;  1YAT A;  3WD3 A;  4HBO A;  4Q7N A;  1FKR A;  3WKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...