3B7XA

Crystal structure of human fk506-binding protein 6
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
125
structure length
117
Chain Sequence
QSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDRPFDSNLMKLEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELLDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-binding protein 6
publication title Human FK506-Binding Protein 6.
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 29
structure length 117
sequence length 125
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2007-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3b7xA00
4LAVA 3KACA 2LJ4A 2IF4A 2K8IA 2XP4A 5HKGA 3ODKA 1D7JA 1PINA 3IHZA 3JYJA 1F8AB 5GPGA 4BF8A 1D6OA 4MGVA 2ZR5A 3O5PA 4W9PA 2XP3A 2F21A 4R0XA 1YW5A 5HWBA 4JYSA 2RQSA 3KAIA 5DIVA 4DROA 1TCOC 3IK8A 4U84A 2ZQSA 3UI4A 4GIVA 4QT3A 4DH0A 1FKTA 1BL4A 2AWGA 3H9RB 1QPLA 2XP6A 2ZQTA 2UZ5A 1KT1A 4LAXA 3IKDA 4ODNA 2FAPA 2F4EA 3VAWA 4JFJA 2ZQUA 1JNSA 1B6CA 2VCDA 4FAPA 2RUQA 2M2AA 2XPAA 3UI5A 3TC5A 4DT4A 1FJDA 2RUDA 3O5GA 4DRMA 1Q6HA 3IKGA 4G50A 4IQ2A 2KGJA 4TNSA 5HW8A 4NNRA 1Q6UA 4ODLA 2PPOA 1FKRA 4ODKA 4DRKA 2Q5AA 4TW7A 5HTGA 4DRHA 1NSGA 3KAHA 1YATA 3NI6A 4U85A 4DRIA 1FKSA 5HW6A 3O5KA 2PBCA 2LKNA 2ZR4A 1R9HA 2F2DA 3FAPA 3O5IA 1P5QA 1ZK6A 1C9HA 3UI6A 4DZ3A 2MLZA 4DRJA 1U79A 1D7HA 1ROUA 2XP9A 3KABA 5B8IC 1L1PA 2L2SA 2LPVA 3RGCA 1FKBA 3MDYB 5D75A 4JFIA 2M08A 3O5FA 2MLXA 1FKDA 3GPKA 3KADA 4O2TA 4TW8A 4DRNA 1J4RA 1D7IA 1W26A 2DG4A 3O5QA 2MNTA 1FKFA 1Q1CA 4IQCA 1NMWA 4N19A 5DITA 3TCZA 2KI3A 4DRQA 4W9QA 1Y0OA 1ZCNA 3PA7A 3O5OA 4J4OA 3EY6A 1FD9A 1JNTA 1J4IA 2ZR6A 2PV1A 3UQAA 3PRDA 4LAYA 2FKEA 3OOBA 4TW6A 1PBKA 1FKKA 2M1IA 4ODPA 5HW7A 2LGOA 4QT2A 3RFWA 2D9FA 3TDBA 2PV3A 3O5LA 5J6EA 3JXVA 1FKIA 3JYMA 4ODMA 4ODOA 1JVWA 2KO7A 2KFWA 1FKGA 4IPXA 3WH0A 1NMVA 1M5YA 2JZVA 1F40A 1EQ3A 1N1AA 4DIPA 2N87A 2PV2A 4MSPA 4QIBA 4TYOA 5DIUA 1J4HA 1FAPA 3PRBA 1T11A 2RUCA 3O5JA 3O5DA 2VN1A 2KR7A 2RURA 4W9OA 1FKHA 5BXJA 4G2PA 4DRPA 3B7XA 2ITKA 1HXVA 2MLYA 1EYMA 4GGQA 3NTPA 3O5RA 4FN2A 1KT0A 1A7XA 2XP5A 3CGMA 4JFLA 1QZ2A 4TX0A 2XP8A 2MPHA 2ZQVA 4ITZA 2PPPA 2Y78A 5HUAA 2DG9A 1FKLA 3NRKA 1J6YA 3CGNA 5HT1A 3UF8A 4U86A 2RSEA 3KCEA 5HWCA 3UQBA 4LAWA 2KE0A 3KAGA 4ODRA 2XP7A 3I6CA 3O5EA 4C02B 1ROTA 1Q6IA 2XPBA 3O5MA 1FKJA 4JFKA 3UQIA 2OFNA 4JFMA 3LUOA 5I98A 4J4NA 3KZ7A 2PPNA 1QPFA 2DG3A 2MF9A 3KAFA 4DZ2A 4ODQA 1BKFA
chains in the Genus database with same CATH superfamily
4LAVA 1E6PA 4QZVB 2XP4A 4Z2GA 3IHZA 2ETNA 4P8XA 4BF8A 3O5PA 2XP3A 4R0XA 4XAKA 1YW5A 4JYSA 1E6RA 3KAIA 5JH8A 2DT1A 4DH0A 4U84A 3UI4A 4GIVA 3H9RB 2ZQTA 3FY1A 3VAWA 1B6CA 1NWRA 2WK2A 3TC5A 1ZL1A 2RUDA 3ARTA 4IQ2A 4ZS6A 2KGJA 4NNRA 1Q6UA 2PPOA 1KFWA 1EHNA 3KAHA 1FKSA 3RM8A 2PBCA 3CHCA 4IT6A 3WQWA 1P5QA 4DRJA 5B8IC 1ROUA 2OLHA 3MDYB 4JFIA 1VF8A 2M08A 4DWSB 2YBTA 1J4RA 2DG4A 1FKFA 4HBOA 1W1PA 4N19A 3AS2A 4DRQA 4W9QA 1LG1A 1ZCNA 3O5OA 1K9TA 1NWUA 1FD9A 1JNTA 2PV1A 3PRDA 3RM9A 2FKEA 4Z2KA 1ZU8A 1PBKA 4LGXA 3ARSA 3CHEA 3WQVA 3RFWA 1E44A 3ARXA 3JXVA 1FKIA 4ODMA 4ODOA 1JVWA 3W4RA 4DWSD 1FKGA 4DIPA 4QIBA 4TYOA 1E6NA 3PRBA 3G6LA 1HKJA 1T11A 4WIWA 2VN1A 3B9DA 1GUVA 4G2PA 3B7XA 1HXVA 1EYMA 1GPFA 4FN2A 4L72B 1A7XA 2MPHA 4KQZA 2DT0A 2Y78A 1HKMA 3CHDA 5HT1A 3UF8A 5HWCA 3B9AA 1OWQA 4NZCA 1FKJA 4ZPVR 3KZ7A 2DG3A 3KAFA 3WD3A 3B8SA 4UDMA 3ARUA 1PINA 2DSVA 1UR8A 2F21A 4WKHA 4L3NA 2RQSA 1HKIA 3ARPA 1SYTA 4QT3A 1QPLA 2XP6A 3QOKA 5GQBA 3IKDA 2EULA 2F4EA 3ARZA 3CZ8A 1JNSA 2WLZA 2RUQA 4DT4A 4DRMA 4G50A 2DT2A 1O6IA 4ODKA 4DRKA 1LJYA 1NSGA 1YATA 4DRIA 3ARVA 3AROA 3UI6A 1C9HA 4Q7NA 1U79A 2XP9A 5DF0A 4R5EA 3RGCA 1FKBA 1FKDA 4O2TA 1D7IA 3O5QA 2MNTA 1Q1CA 3ALFA 4Z2HA 4MNLA 3ALGA 1J4IA 1XHGA 3PRAA 4LAYA 1X6NA 1FKKA 2M1IA 4ODPA 2LGOA 4DWSC 3O5LA 1NH6A 1W1YA 1NWSA 1E9LA 2KFWA 4IPXA 2JZVA 2QF8A 4ML4A 1W9PA 5HBFA 1ZBWA 1FAPA 2PN0A 2RUCA 3O5DA 2A3AA 4W9OA 5BXJA 4NSBA 2ITKA 1W9VA 2MLYA 2O92A 4GGQA 1GOIA 3AS0A 1CTNA 4S3JA 3ARWA 4ITZA 1ZBCA 1FKLA 1J6YA 3G6MA 2RSEA 5DEZA 3WL0A 4ODRA 2XP7A 3I6CA 3O5EA 1W1TA 2OFNA 1FFRA 1LL7A 4WK9A 2MF9A 4MNMA 1BKFA 5HKGA 1WNOA 3EIPA 2LJ4A 1X6LA 2IF4A 2K8IA 4Z2JA 1D7JA 4KR0B 3JYJA 5GPGA 1F8AB 3RMEA 1HJVA 1D6OA 4MGVA 1JCHB 2ZR5A 4W9PA 2DPEA 1TCOC 3IK8A 2ZQSA 1BL4A 2AWGA 1ITXA 1KT1A 4URIA 2FAPA 4JFJA 2ZQUA 2VCDA 1FJDA 1Q6HA 4HBEA 1UR9A 2YBUA 4TNSA 4ZPTR 4WJXA 1FKRA 4ODLA 4TW7A 3NI6A 5HW6A 1RD6A 2LKNA 4DZ3A 1R9HA 3FAPA 1D2KA 1ZK6A 3CHFA 2MLZA 3KABA 2L2SA 1EDQA 1OGBA 4DRNA 4TW8A 1W26A 4IQCA 1NMWA 3TCZA 2KI3A 3PA7A 4J4OA 4Z2LA 4MAVA 5DO2A 3B9EA 4ZPWR 1HJWA 4TW6A 4IT4A 3GTYX 1W1VA 5HW7A 1TFVA 1EIBA 3TDBA 4DWSA 2PV3A 4WKAA 3BMBA 3JYMA 2KO7A 2DT3A 1F40A 1H0GA 3WD2A 2N87A 1OGGA 2PV2A 5DIUA 1J4HA 2A3EA 3ARRA 3O5JA 1IX5A 2KR7A 1FKHA 2B31A 4DRPA 1GRJA 3WKZA 3RM4A 4P8UA 2DG9A 1HJXA 2AOSA 2DSUA 2IUZA 3NRKA 3WL1A 3CGNA 1H0IA 4U86A 3KCEA 1E6ZA 2F23A 3UQBA 2FDMA 4C02B 1ROTA 5I98A 4J4NA 2PPNA 4P8WA 4AY1A 1QPFA 4DZ2A 3ARQA 4ODQA 2WM0A 2PI6A 3ARYA 3KACA 3WD4A 2ESCA 3AQUA 3ODKA 1JNEA 5HWBA 5DIVA 4DROA 1FKTA 2UZ5A 3CH9A 4LAXA 1FFQA 4P8VA 4ODNA 1LL6A 3PR9A 4FAPA 2B5UB 2M2AA 1ZB5A 2XPAA 3UI5A 4Z2IA 1E15A 3O5GA 3IKGA 2G41A 4MNJA 1W9UA 4MNKA 5HW8A 2G8ZA 4MTVA 2Q5AA 3WD0A 5HTGA 4DRHA 3FXYA 2P4VA 1LQ0A 4U85A 5GPRA 3O5KA 2ZR4A 2F2DA 3O5IA 2WLYA 1JNDA 1D7HA 1L1PA 2LPVA 5D75A 4WKFA 3O5FA 2MLXA 3GPKA 3KADA 2DSWA 5DITA 3WIJA 1Y0OA 1ZBVA 3GU0A 3EY6A 4W5UA 2ZR6A 4PTMA 3UQAA 3OOBA 4QT2A 2D9FA 1LL4A 5J6EA 4MPKA 3WH0A 1NMVA 1M5YA 1EQ3A 2DSZA 1N1AA 4MSPA 2O9OA 4S3KA 1LG2A 1HKKA 2RURA 3WD1A 1SR0A 1WB0A 3NTPA 1KT0A 2XP5A 4JFLA 3CGMA 1QZ2A 3AS1A 4TX0A 2XP8A 2A3CA 1ZBKA 3BXWA 2ZQVA 2PPPA 3AS3A 2A3BA 5HUAA 1XRVA 1WAWA 4Q22A 1NWTA 4LAWA 2KE0A 3KAGA 2XPBA 1Q6IA 3O5MA 4JFKA 3UQIA 3OA5A 4HARA 4JFMA 3LUOA 3O5RA
chains in the Genus database with same CATH topology
4LAVA 1E6PA 4QZVB 2XP4A 4Z2GA 3IHZA 4P8XA 4BF8A 3O5PA 2XP3A 4R0XA 4XAKA 1YW5A 4JYSA 1E6RA 3KAIA 5JH8A 2DT1A 4DH0A 4U84A 3UI4A 4GIVA 3H9RB 2ZQTA 3FY1A 3VAWA 1B6CA 1NWRA 2WK2A 3TC5A 1ZL1A 2RUDA 3ARTA 4IQ2A 4ZS6A 2KGJA 4NNRA 1Q6UA 2PPOA 1KFWA 1EHNA 3KAHA 1FKSA 3RM8A 2PBCA 3CHCA 4IT6A 3WQWA 1P5QA 4DRJA 5B8IC 1ROUA 2OLHA 3MDYB 4JFIA 1VF8A 2M08A 4DWSB 2YBTA 1J4RA 2DG4A 1FKFA 4HBOA 1W1PA 4N19A 3AS2A 4DRQA 4W9QA 1LG1A 1ZCNA 3O5OA 1K9TA 1NWUA 1FD9A 1JNTA 2PV1A 3PRDA 3RM9A 2FKEA 4Z2KA 1ZU8A 1PBKA 4LGXA 3ARSA 3CHEA 3WQVA 3RFWA 3ARXA 3JXVA 1FKIA 4ODMA 4ODOA 1JVWA 3W4RA 4DWSD 1FKGA 4DIPA 4QIBA 4TYOA 1E6NA 3PRBA 3G6LA 1HKJA 1T11A 4WIWA 2VN1A 3B9DA 1GUVA 4G2PA 3B7XA 1HXVA 1EYMA 1GPFA 4FN2A 4L72B 1A7XA 2MPHA 4KQZA 2DT0A 2Y78A 1HKMA 3CHDA 5HT1A 3UF8A 5HWCA 3B9AA 1OWQA 4NZCA 1FKJA 4ZPVR 3KZ7A 2DG3A 3KAFA 3WD3A 3B8SA 3ARUA 1PINA 2DSVA 1UR8A 2F21A 4WKHA 4L3NA 2RQSA 1HKIA 3ARPA 1SYTA 4QT3A 1QPLA 2XP6A 3QOKA 5GQBA 3IKDA 2F4EA 3ARZA 3CZ8A 1JNSA 2WLZA 2RUQA 4DT4A 4DRMA 4G50A 2DT2A 1O6IA 4ODKA 4DRKA 1LJYA 1NSGA 1YATA 4DRIA 3ARVA 3AROA 3UI6A 1C9HA 4Q7NA 1U79A 2XP9A 5DF0A 4R5EA 3RGCA 1FKBA 1FKDA 4O2TA 1D7IA 3O5QA 2MNTA 1Q1CA 3ALFA 4Z2HA 4MNLA 3ALGA 1J4IA 1XHGA 3PRAA 4LAYA 1X6NA 1FKKA 2M1IA 4ODPA 2LGOA 4DWSC 3O5LA 1NH6A 1W1YA 1NWSA 1E9LA 2KFWA 4IPXA 2JZVA 2QF8A 4ML4A 1W9PA 5HBFA 1ZBWA 1FAPA 2RUCA 3O5DA 2A3AA 4W9OA 5BXJA 4NSBA 2ITKA 1W9VA 2MLYA 2O92A 4GGQA 1GOIA 3AS0A 1CTNA 4S3JA 3ARWA 4ITZA 1ZBCA 1FKLA 1J6YA 3G6MA 2RSEA 5DEZA 3WL0A 4ODRA 2XP7A 3I6CA 3O5EA 1W1TA 2OFNA 1FFRA 1LL7A 4WK9A 2MF9A 4MNMA 1BKFA 5HKGA 1WNOA 2LJ4A 1X6LA 2IF4A 2K8IA 4Z2JA 1D7JA 4KR0B 3JYJA 5GPGA 1F8AB 3RMEA 1HJVA 1D6OA 4MGVA 2ZR5A 4W9PA 2DPEA 1TCOC 3IK8A 2ZQSA 1BL4A 2AWGA 1ITXA 1KT1A 4URIA 2FAPA 4JFJA 2ZQUA 2VCDA 1FJDA 1Q6HA 4HBEA 1UR9A 2YBUA 4TNSA 4ZPTR 4WJXA 1FKRA 4ODLA 4TW7A 3NI6A 5HW6A 1RD6A 2LKNA 4DZ3A 1R9HA 3FAPA 1D2KA 1ZK6A 3CHFA 2MLZA 3KABA 2L2SA 1EDQA 1OGBA 4DRNA 4TW8A 1W26A 4IQCA 1NMWA 3TCZA 2KI3A 3PA7A 4J4OA 4Z2LA 4MAVA 5DO2A 3B9EA 4ZPWR 1HJWA 4TW6A 4IT4A 5HW7A 1W1VA 1TFVA 1EIBA 3TDBA 4DWSA 2PV3A 4WKAA 3JYMA 2KO7A 2DT3A 1F40A 1H0GA 3WD2A 2N87A 1OGGA 2PV2A 5DIUA 1J4HA 2A3EA 3ARRA 3O5JA 1IX5A 2KR7A 1FKHA 2B31A 4DRPA 3WKZA 3RM4A 4P8UA 2DG9A 1HJXA 2AOSA 2DSUA 2IUZA 3NRKA 3WL1A 3CGNA 1H0IA 4U86A 3KCEA 1E6ZA 3UQBA 2FDMA 4C02B 1ROTA 5I98A 4J4NA 2PPNA 4P8WA 4AY1A 1QPFA 4DZ2A 3ARQA 4ODQA 2WM0A 2PI6A 3ARYA 3KACA 3WD4A 2ESCA 3AQUA 3ODKA 1JNEA 5HWBA 5DIVA 4DROA 1FKTA 2UZ5A 3CH9A 4LAXA 1FFQA 4P8VA 4ODNA 1LL6A 3PR9A 4FAPA 2M2AA 1ZB5A 2XPAA 3UI5A 4Z2IA 1E15A 3O5GA 3IKGA 2G41A 4MNJA 1W9UA 4MNKA 5HW8A 2G8ZA 4MTVA 2Q5AA 3WD0A 5HTGA 4DRHA 3FXYA 5GPRA 1LQ0A 4U85A 3O5KA 2ZR4A 2F2DA 3O5IA 2WLYA 1JNDA 1D7HA 1L1PA 2LPVA 5D75A 4WKFA 3O5FA 2MLXA 3GPKA 3KADA 2DSWA 5DITA 3WIJA 1Y0OA 1ZBVA 3EY6A 4W5UA 2ZR6A 4PTMA 3UQAA 3OOBA 4QT2A 2D9FA 1LL4A 5J6EA 4MPKA 3WH0A 1NMVA 1M5YA 1EQ3A 2DSZA 1N1AA 4MSPA 2O9OA 4S3KA 1LG2A 1HKKA 2RURA 3WD1A 1SR0A 1WB0A 3NTPA 1KT0A 2XP5A 4JFLA 3CGMA 1QZ2A 3AS1A 4TX0A 2XP8A 2A3CA 1ZBKA 3BXWA 2ZQVA 2PPPA 3AS3A 2A3BA 5HUAA 1XRVA 1WAWA 4Q22A 1NWTA 4LAWA 2KE0A 3KAGA 2XPBA 1Q6IA 3O5MA 4JFKA 3UQIA 3OA5A 4HARA 4JFMA 3LUOA 3O5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAV A;  3KAC A;  2LJ4 A;  2IF4 A;  2K8I A;  2XP4 A;  5HKG A;  3ODK A;  1D7J A;  1PIN A;  3IHZ A;  3JYJ A;  1F8A B;  5GPG A;  4BF8 A;  1D6O A;  4MGV A;  2ZR5 A;  3O5P A;  4W9P A;  2XP3 A;  2F21 A;  4R0X A;  1YW5 A;  5HWB A;  4JYS A;  2RQS A;  3KAI A;  5DIV A;  4DRO A;  1TCO C;  3IK8 A;  4U84 A;  2ZQS A;  3UI4 A;  4GIV A;  4QT3 A;  4DH0 A;  1FKT A;  1BL4 A;  2AWG A;  3H9R B;  1QPL A;  2XP6 A;  2ZQT A;  2UZ5 A;  1KT1 A;  4LAX A;  3IKD A;  4ODN A;  2FAP A;  2F4E A;  3VAW A;  4JFJ A;  2ZQU A;  1JNS A;  1B6C A;  2VCD A;  4FAP A;  2RUQ A;  2M2A A;  2XPA A;  3UI5 A;  3TC5 A;  4DT4 A;  1FJD A;  2RUD A;  3O5G A;  4DRM A;  1Q6H A;  3IKG A;  4G50 A;  4IQ2 A;  2KGJ A;  4TNS A;  5HW8 A;  4NNR A;  1Q6U A;  4ODL A;  2PPO A;  1FKR A;  4ODK A;  4DRK A;  2Q5A A;  4TW7 A;  5HTG A;  4DRH A;  1NSG A;  3KAH A;  1YAT A;  3NI6 A;  4U85 A;  4DRI A;  1FKS A;  5HW6 A;  3O5K A;  2PBC A;  2LKN A;  2ZR4 A;  1R9H A;  2F2D A;  3FAP A;  3O5I A;  1P5Q A;  1ZK6 A;  1C9H A;  3UI6 A;  4DZ3 A;  2MLZ A;  4DRJ A;  1U79 A;  1D7H A;  1ROU A;  2XP9 A;  3KAB A;  5B8I C;  1L1P A;  2L2S A;  2LPV A;  3RGC A;  1FKB A;  3MDY B;  5D75 A;  4JFI A;  2M08 A;  3O5F A;  2MLX A;  1FKD A;  3GPK A;  3KAD A;  4O2T A;  4TW8 A;  4DRN A;  1J4R A;  1D7I A;  1W26 A;  2DG4 A;  3O5Q A;  2MNT A;  1FKF A;  1Q1C A;  4IQC A;  1NMW A;  4N19 A;  5DIT A;  3TCZ A;  2KI3 A;  4DRQ A;  4W9Q A;  1Y0O A;  1ZCN A;  3PA7 A;  3O5O A;  4J4O A;  3EY6 A;  1FD9 A;  1JNT A;  1J4I A;  2ZR6 A;  2PV1 A;  3UQA A;  3PRD A;  4LAY A;  2FKE A;  3OOB A;  4TW6 A;  1PBK A;  1FKK A;  2M1I A;  4ODP A;  5HW7 A;  2LGO A;  4QT2 A;  3RFW A;  2D9F A;  3TDB A;  2PV3 A;  3O5L A;  5J6E A;  3JXV A;  1FKI A;  3JYM A;  4ODM A;  4ODO A;  1JVW A;  2KO7 A;  2KFW A;  1FKG A;  4IPX A;  3WH0 A;  1NMV A;  1M5Y A;  2JZV A;  1F40 A;  1EQ3 A;  1N1A A;  4DIP A;  2N87 A;  2PV2 A;  4MSP A;  4QIB A;  4TYO A;  5DIU A;  1J4H A;  1FAP A;  3PRB A;  1T11 A;  2RUC A;  3O5J A;  3O5D A;  2VN1 A;  2KR7 A;  2RUR A;  4W9O A;  1FKH A;  5BXJ A;  4G2P A;  4DRP A;  3B7X A;  2ITK A;  1HXV A;  2MLY A;  1EYM A;  4GGQ A;  3NTP A;  3O5R A;  4FN2 A;  1KT0 A;  1A7X A;  2XP5 A;  3CGM A;  4JFL A;  1QZ2 A;  4TX0 A;  2XP8 A;  2MPH A;  2ZQV A;  4ITZ A;  2PPP A;  2Y78 A;  5HUA A;  2DG9 A;  1FKL A;  3NRK A;  1J6Y A;  3CGN A;  5HT1 A;  3UF8 A;  4U86 A;  2RSE A;  3KCE A;  5HWC A;  3UQB A;  4LAW A;  2KE0 A;  3KAG A;  4ODR A;  2XP7 A;  3I6C A;  3O5E A;  4C02 B;  1ROT A;  1Q6I A;  2XPB A;  3O5M A;  1FKJ A;  4JFK A;  3UQI A;  2OFN A;  4JFM A;  3LUO A;  5I98 A;  4J4N A;  3KZ7 A;  2PPN A;  1QPF A;  2DG3 A;  2MF9 A;  3KAF A;  4DZ2 A;  4ODQ A;  1BKF A; 
#chains in the Genus database with same CATH topology
 4LAV A;  1E6P A;  4QZV B;  2XP4 A;  4Z2G A;  3IHZ A;  2ETN A;  4P8X A;  4BF8 A;  3O5P A;  2XP3 A;  4R0X A;  4XAK A;  1YW5 A;  4JYS A;  1E6R A;  3KAI A;  5JH8 A;  2DT1 A;  4DH0 A;  4U84 A;  3UI4 A;  4GIV A;  3H9R B;  2ZQT A;  3FY1 A;  3VAW A;  1B6C A;  1NWR A;  2WK2 A;  3TC5 A;  1ZL1 A;  2RUD A;  3ART A;  4IQ2 A;  4ZS6 A;  2KGJ A;  4NNR A;  1Q6U A;  2PPO A;  1KFW A;  1EHN A;  3KAH A;  1FKS A;  3RM8 A;  2PBC A;  3CHC A;  4IT6 A;  3WQW A;  1P5Q A;  4DRJ A;  5B8I C;  1ROU A;  2OLH A;  3MDY B;  4JFI A;  1VF8 A;  2M08 A;  4DWS B;  2YBT A;  1J4R A;  2DG4 A;  1FKF A;  4HBO A;  1W1P A;  4N19 A;  3AS2 A;  4DRQ A;  4W9Q A;  1LG1 A;  1ZCN A;  3O5O A;  1K9T A;  1NWU A;  1FD9 A;  1JNT A;  2PV1 A;  3PRD A;  3RM9 A;  2FKE A;  4Z2K A;  1ZU8 A;  1PBK A;  4LGX A;  3ARS A;  3CHE A;  3WQV A;  3RFW A;  1E44 A;  3ARX A;  3JXV A;  1FKI A;  4ODM A;  4ODO A;  1JVW A;  3W4R A;  4DWS D;  1FKG A;  4DIP A;  4QIB A;  4TYO A;  1E6N A;  3PRB A;  3G6L A;  1HKJ A;  1T11 A;  4WIW A;  2VN1 A;  3B9D A;  1GUV A;  4G2P A;  3B7X A;  1HXV A;  1EYM A;  1GPF A;  4FN2 A;  4L72 B;  1A7X A;  2MPH A;  4KQZ A;  2DT0 A;  2Y78 A;  1HKM A;  3CHD A;  5HT1 A;  3UF8 A;  5HWC A;  3B9A A;  1OWQ A;  4NZC A;  1FKJ A;  4ZPV R;  3KZ7 A;  2DG3 A;  3KAF A;  3WD3 A;  3B8S A;  4UDM A;  3ARU A;  1PIN A;  2DSV A;  1UR8 A;  2F21 A;  4WKH A;  4L3N A;  2RQS A;  1HKI A;  3ARP A;  1SYT A;  4QT3 A;  1QPL A;  2XP6 A;  3QOK A;  5GQB A;  3IKD A;  2EUL A;  2F4E A;  3ARZ A;  3CZ8 A;  1JNS A;  2WLZ A;  2RUQ A;  4DT4 A;  4DRM A;  4G50 A;  2DT2 A;  1O6I A;  4ODK A;  4DRK A;  1LJY A;  1NSG A;  1YAT A;  4DRI A;  3ARV A;  3ARO A;  3UI6 A;  1C9H A;  4Q7N A;  1U79 A;  2XP9 A;  5DF0 A;  4R5E A;  3RGC A;  1FKB A;  1FKD A;  4O2T A;  1D7I A;  3O5Q A;  2MNT A;  1Q1C A;  3ALF A;  4Z2H A;  4MNL A;  3ALG A;  1J4I A;  1XHG A;  3PRA A;  4LAY A;  1X6N A;  1FKK A;  2M1I A;  4ODP A;  2LGO A;  4DWS C;  3O5L A;  1NH6 A;  1W1Y A;  1NWS A;  1E9L A;  2KFW A;  4IPX A;  2JZV A;  2QF8 A;  4ML4 A;  1W9P A;  5HBF A;  1ZBW A;  1FAP A;  2PN0 A;  2RUC A;  3O5D A;  2A3A A;  4W9O A;  5BXJ A;  4NSB A;  2ITK A;  1W9V A;  2MLY A;  2O92 A;  4GGQ A;  1GOI A;  3AS0 A;  1CTN A;  4S3J A;  3ARW A;  4ITZ A;  1ZBC A;  1FKL A;  1J6Y A;  3G6M A;  2RSE A;  5DEZ A;  3WL0 A;  4ODR A;  2XP7 A;  3I6C A;  3O5E A;  1W1T A;  2OFN A;  1FFR A;  1LL7 A;  4WK9 A;  2MF9 A;  4MNM A;  1BKF A;  5HKG A;  1WNO A;  3EIP A;  2LJ4 A;  1X6L A;  2IF4 A;  2K8I A;  4Z2J A;  1D7J A;  4KR0 B;  3JYJ A;  5GPG A;  1F8A B;  3RME A;  1HJV A;  1D6O A;  4MGV A;  1JCH B;  2ZR5 A;  4W9P A;  2DPE A;  1TCO C;  3IK8 A;  2ZQS A;  1BL4 A;  2AWG A;  1ITX A;  1KT1 A;  4URI A;  2FAP A;  4JFJ A;  2ZQU A;  2VCD A;  1FJD A;  1Q6H A;  4HBE A;  1UR9 A;  2YBU A;  4TNS A;  4ZPT R;  4WJX A;  1FKR A;  4ODL A;  4TW7 A;  3NI6 A;  5HW6 A;  1RD6 A;  2LKN A;  4DZ3 A;  1R9H A;  3FAP A;  1D2K A;  1ZK6 A;  3CHF A;  2MLZ A;  3KAB A;  2L2S A;  1EDQ A;  1OGB A;  4DRN A;  4TW8 A;  1W26 A;  4IQC A;  1NMW A;  3TCZ A;  2KI3 A;  3PA7 A;  4J4O A;  4Z2L A;  4MAV A;  5DO2 A;  3B9E A;  4ZPW R;  1HJW A;  4TW6 A;  4IT4 A;  3GTY X;  1W1V A;  5HW7 A;  1TFV A;  1EIB A;  3TDB A;  4DWS A;  2PV3 A;  4WKA A;  3BMB A;  3JYM A;  2KO7 A;  2DT3 A;  1F40 A;  1H0G A;  3WD2 A;  2N87 A;  1OGG A;  2PV2 A;  5DIU A;  1J4H A;  2A3E A;  3ARR A;  3O5J A;  1IX5 A;  2KR7 A;  1FKH A;  2B31 A;  4DRP A;  1GRJ A;  3WKZ A;  3RM4 A;  4P8U A;  2DG9 A;  1HJX A;  2AOS A;  2DSU A;  2IUZ A;  3NRK A;  3WL1 A;  3CGN A;  1H0I A;  4U86 A;  3KCE A;  1E6Z A;  2F23 A;  3UQB A;  2FDM A;  4C02 B;  1ROT A;  5I98 A;  4J4N A;  2PPN A;  4P8W A;  4AY1 A;  1QPF A;  4DZ2 A;  3ARQ A;  4ODQ A;  2WM0 A;  2PI6 A;  3ARY A;  3KAC A;  3WD4 A;  2ESC A;  3AQU A;  3ODK A;  1JNE A;  5HWB A;  5DIV A;  4DRO A;  1FKT A;  2UZ5 A;  3CH9 A;  4LAX A;  1FFQ A;  4P8V A;  4ODN A;  1LL6 A;  3PR9 A;  4FAP A;  2B5U B;  2M2A A;  1ZB5 A;  2XPA A;  3UI5 A;  4Z2I A;  1E15 A;  3O5G A;  3IKG A;  2G41 A;  4MNJ A;  1W9U A;  4MNK A;  5HW8 A;  2G8Z A;  4MTV A;  2Q5A A;  3WD0 A;  5HTG A;  4DRH A;  3FXY A;  2P4V A;  1LQ0 A;  4U85 A;  5GPR A;  3O5K A;  2ZR4 A;  2F2D A;  3O5I A;  2WLY A;  1JND A;  1D7H A;  1L1P A;  2LPV A;  5D75 A;  4WKF A;  3O5F A;  2MLX A;  3GPK A;  3KAD A;  2DSW A;  5DIT A;  3WIJ A;  1Y0O A;  1ZBV A;  3GU0 A;  3EY6 A;  4W5U A;  2ZR6 A;  4PTM A;  3UQA A;  3OOB A;  4QT2 A;  2D9F A;  1LL4 A;  5J6E A;  4MPK A;  3WH0 A;  1NMV A;  1M5Y A;  1EQ3 A;  2DSZ A;  1N1A A;  4MSP A;  2O9O A;  4S3K A;  1LG2 A;  1HKK A;  2RUR A;  3WD1 A;  1SR0 A;  1WB0 A;  3NTP A;  1KT0 A;  2XP5 A;  4JFL A;  3CGM A;  1QZ2 A;  3AS1 A;  4TX0 A;  2XP8 A;  2A3C A;  1ZBK A;  3BXW A;  2ZQV A;  2PPP A;  3AS3 A;  2A3B A;  5HUA A;  1XRV A;  1WAW A;  4Q22 A;  1NWT A;  4LAW A;  2KE0 A;  3KAG A;  2XPB A;  1Q6I A;  3O5M A;  4JFK A;  3UQI A;  3OA5 A;  4HAR A;  4JFM A;  3LUO A;  3O5R A; 
#chains in the Genus database with same CATH homology
 4LAV A;  1E6P A;  4QZV B;  2XP4 A;  4Z2G A;  3IHZ A;  4P8X A;  4BF8 A;  3O5P A;  2XP3 A;  4R0X A;  4XAK A;  1YW5 A;  4JYS A;  1E6R A;  3KAI A;  5JH8 A;  2DT1 A;  4DH0 A;  4U84 A;  3UI4 A;  4GIV A;  3H9R B;  2ZQT A;  3FY1 A;  3VAW A;  1B6C A;  1NWR A;  2WK2 A;  3TC5 A;  1ZL1 A;  2RUD A;  3ART A;  4IQ2 A;  4ZS6 A;  2KGJ A;  4NNR A;  1Q6U A;  2PPO A;  1KFW A;  1EHN A;  3KAH A;  1FKS A;  3RM8 A;  2PBC A;  3CHC A;  4IT6 A;  3WQW A;  1P5Q A;  4DRJ A;  5B8I C;  1ROU A;  2OLH A;  3MDY B;  4JFI A;  1VF8 A;  2M08 A;  4DWS B;  2YBT A;  1J4R A;  2DG4 A;  1FKF A;  4HBO A;  1W1P A;  4N19 A;  3AS2 A;  4DRQ A;  4W9Q A;  1LG1 A;  1ZCN A;  3O5O A;  1K9T A;  1NWU A;  1FD9 A;  1JNT A;  2PV1 A;  3PRD A;  3RM9 A;  2FKE A;  4Z2K A;  1ZU8 A;  1PBK A;  4LGX A;  3ARS A;  3CHE A;  3WQV A;  3RFW A;  3ARX A;  3JXV A;  1FKI A;  4ODM A;  4ODO A;  1JVW A;  3W4R A;  4DWS D;  1FKG A;  4DIP A;  4QIB A;  4TYO A;  1E6N A;  3PRB A;  3G6L A;  1HKJ A;  1T11 A;  4WIW A;  2VN1 A;  3B9D A;  1GUV A;  4G2P A;  3B7X A;  1HXV A;  1EYM A;  1GPF A;  4FN2 A;  4L72 B;  1A7X A;  2MPH A;  4KQZ A;  2DT0 A;  2Y78 A;  1HKM A;  3CHD A;  5HT1 A;  3UF8 A;  5HWC A;  3B9A A;  1OWQ A;  4NZC A;  1FKJ A;  4ZPV R;  3KZ7 A;  2DG3 A;  3KAF A;  3WD3 A;  3B8S A;  3ARU A;  1PIN A;  2DSV A;  1UR8 A;  2F21 A;  4WKH A;  4L3N A;  2RQS A;  1HKI A;  3ARP A;  1SYT A;  4QT3 A;  1QPL A;  2XP6 A;  3QOK A;  5GQB A;  3IKD A;  2F4E A;  3ARZ A;  3CZ8 A;  1JNS A;  2WLZ A;  2RUQ A;  4DT4 A;  4DRM A;  4G50 A;  2DT2 A;  1O6I A;  4ODK A;  4DRK A;  1LJY A;  1NSG A;  1YAT A;  4DRI A;  3ARV A;  3ARO A;  3UI6 A;  1C9H A;  4Q7N A;  1U79 A;  2XP9 A;  5DF0 A;  4R5E A;  3RGC A;  1FKB A;  1FKD A;  4O2T A;  1D7I A;  3O5Q A;  2MNT A;  1Q1C A;  3ALF A;  4Z2H A;  4MNL A;  3ALG A;  1J4I A;  1XHG A;  3PRA A;  4LAY A;  1X6N A;  1FKK A;  2M1I A;  4ODP A;  2LGO A;  4DWS C;  3O5L A;  1NH6 A;  1W1Y A;  1NWS A;  1E9L A;  2KFW A;  4IPX A;  2JZV A;  2QF8 A;  4ML4 A;  1W9P A;  5HBF A;  1ZBW A;  1FAP A;  2RUC A;  3O5D A;  2A3A A;  4W9O A;  5BXJ A;  4NSB A;  2ITK A;  1W9V A;  2MLY A;  2O92 A;  4GGQ A;  1GOI A;  3AS0 A;  1CTN A;  4S3J A;  3ARW A;  4ITZ A;  1ZBC A;  1FKL A;  1J6Y A;  3G6M A;  2RSE A;  5DEZ A;  3WL0 A;  4ODR A;  2XP7 A;  3I6C A;  3O5E A;  1W1T A;  2OFN A;  1FFR A;  1LL7 A;  4WK9 A;  2MF9 A;  4MNM A;  1BKF A;  5HKG A;  1WNO A;  2LJ4 A;  1X6L A;  2IF4 A;  2K8I A;  4Z2J A;  1D7J A;  4KR0 B;  3JYJ A;  5GPG A;  1F8A B;  3RME A;  1HJV A;  1D6O A;  4MGV A;  2ZR5 A;  4W9P A;  2DPE A;  1TCO C;  3IK8 A;  2ZQS A;  1BL4 A;  2AWG A;  1ITX A;  1KT1 A;  4URI A;  2FAP A;  4JFJ A;  2ZQU A;  2VCD A;  1FJD A;  1Q6H A;  4HBE A;  1UR9 A;  2YBU A;  4TNS A;  4ZPT R;  4WJX A;  1FKR A;  4ODL A;  4TW7 A;  3NI6 A;  5HW6 A;  1RD6 A;  2LKN A;  4DZ3 A;  1R9H A;  3FAP A;  1D2K A;  1ZK6 A;  3CHF A;  2MLZ A;  3KAB A;  2L2S A;  1EDQ A;  1OGB A;  4DRN A;  4TW8 A;  1W26 A;  4IQC A;  1NMW A;  3TCZ A;  2KI3 A;  3PA7 A;  4J4O A;  4Z2L A;  4MAV A;  5DO2 A;  3B9E A;  4ZPW R;  1HJW A;  4TW6 A;  4IT4 A;  5HW7 A;  1W1V A;  1TFV A;  1EIB A;  3TDB A;  4DWS A;  2PV3 A;  4WKA A;  3JYM A;  2KO7 A;  2DT3 A;  1F40 A;  1H0G A;  3WD2 A;  2N87 A;  1OGG A;  2PV2 A;  5DIU A;  1J4H A;  2A3E A;  3ARR A;  3O5J A;  1IX5 A;  2KR7 A;  1FKH A;  2B31 A;  4DRP A;  3WKZ A;  3RM4 A;  4P8U A;  2DG9 A;  1HJX A;  2AOS A;  2DSU A;  2IUZ A;  3NRK A;  3WL1 A;  3CGN A;  1H0I A;  4U86 A;  3KCE A;  1E6Z A;  3UQB A;  2FDM A;  4C02 B;  1ROT A;  5I98 A;  4J4N A;  2PPN A;  4P8W A;  4AY1 A;  1QPF A;  4DZ2 A;  3ARQ A;  4ODQ A;  2WM0 A;  2PI6 A;  3ARY A;  3KAC A;  3WD4 A;  2ESC A;  3AQU A;  3ODK A;  1JNE A;  5HWB A;  5DIV A;  4DRO A;  1FKT A;  2UZ5 A;  3CH9 A;  4LAX A;  1FFQ A;  4P8V A;  4ODN A;  1LL6 A;  3PR9 A;  4FAP A;  2M2A A;  1ZB5 A;  2XPA A;  3UI5 A;  4Z2I A;  1E15 A;  3O5G A;  3IKG A;  2G41 A;  4MNJ A;  1W9U A;  4MNK A;  5HW8 A;  2G8Z A;  4MTV A;  2Q5A A;  3WD0 A;  5HTG A;  4DRH A;  3FXY A;  5GPR A;  1LQ0 A;  4U85 A;  3O5K A;  2ZR4 A;  2F2D A;  3O5I A;  2WLY A;  1JND A;  1D7H A;  1L1P A;  2LPV A;  5D75 A;  4WKF A;  3O5F A;  2MLX A;  3GPK A;  3KAD A;  2DSW A;  5DIT A;  3WIJ A;  1Y0O A;  1ZBV A;  3EY6 A;  4W5U A;  2ZR6 A;  4PTM A;  3UQA A;  3OOB A;  4QT2 A;  2D9F A;  1LL4 A;  5J6E A;  4MPK A;  3WH0 A;  1NMV A;  1M5Y A;  1EQ3 A;  2DSZ A;  1N1A A;  4MSP A;  2O9O A;  4S3K A;  1LG2 A;  1HKK A;  2RUR A;  3WD1 A;  1SR0 A;  1WB0 A;  3NTP A;  1KT0 A;  2XP5 A;  4JFL A;  3CGM A;  1QZ2 A;  3AS1 A;  4TX0 A;  2XP8 A;  2A3C A;  1ZBK A;  3BXW A;  2ZQV A;  2PPP A;  3AS3 A;  2A3B A;  5HUA A;  1XRV A;  1WAW A;  4Q22 A;  1NWT A;  4LAW A;  2KE0 A;  3KAG A;  2XPB A;  1Q6I A;  3O5M A;  4JFK A;  3UQI A;  3OA5 A;  4HAR A;  4JFM A;  3LUO A;  3O5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...