3B8NA

Structure of fepe- bacterial polysaccharide co-polymerase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
266
structure length
241
Chain Sequence
WTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAFNLFIKKFQSVSLLEEYLRSSPYVMDQLDLHRAIVALSEKMKAVDDSLYTSWTLSFTAPTSEEAQTVLSGYIDYISALVVKESIENVRNKLEIKTQFEKEKLAQDRIKMKNQLDANIQRLNYSLDIANAAGIKKPVYDPDFSISLGADGIERKLEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNFTPFKYQLSPSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferric enterobactin (Enterochelin) transport
publication title Bacterial polysaccharide co-polymerases share a common framework for control of polymer length
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 84
structure length 241
sequence length 266
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2007-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3b8nA02
3.30.1890.10 Alpha Beta 2-Layer Sandwich Bacterial polysaccharide co-polymerase-like FepE-like 3b8nA01
1JQ0A 3B77A 1ENVA 1QR8A 5KA6A 2OT5A 2P6JA 3MHSC 3B8PA 4E2HA 1K33A 3H01A 2EZPA 4JGSA 5KA5A 1MOFA 3K9AA 1SZTA 3M99B 4N23A 5HFLA 4ZM5A 4JPRA 4FIPC 4FK5C 5CMUA 5HFMA 3B8MA 2LP7A 4E29A 1F23A 1QCEA 3MHHC 4G2KA 3WFVA 1DF4A 1JPXA 2MK3A 3CYOA 3GWOA 3CP1A 1QBZA 2EBOA 1DLBA 1Y66A 1Y4MA 4E2CA 5CN0A 2X7RB 5H9CA 4FJCC 1MG1A 2EZOA 4JF3A 3B8OA 1I5YA 2M7WA 4N21A 4ZM1A 1I5XA 1EBOA 3B8NA 1QR9A 3P30A 1K34A 4E2LA 1DF5A
chains in the Genus database with same CATH superfamily
3B77A 2IU3A 1GN2A 4KHPB 5KHGA 4DUZB 3H9VA 1XNQB 1MMMA 4X1IA 1SZTA 1HR0B 5B1NA 2EJ7A 3STZC 2QSAA 1G8MA 5ITZB 1NVPB 1S0VA 2YICA 1M57C 4FMTA 3RYIA 3UCSC 2NN4A 1G4YB 4MTGA 2AZ2A 3H1LH 1IBKO 4JAVA 1THZA 1MG1A 4DXWA 3CCEV 1U97A 2N74A 4CH6A 3RYHB 3B2EE 3T1YO 4I0XB 2PI4A 4MT8A 3U0ZA 5DECA 4GKJB 5LXTA 3AG1C 2E5LO 4DV7O 1K5SA 1Y67A 3A0HZ 4K3AA 4J80A 1WPXA 3ZRWA 2B9ZA 1Q90D 4OX9B 5FPOA 2IH3C 4GX5A 1S77D 3QVNA 1BQ0A 4J41A 4O4JB 3ABKC 2YSUB 4GYCB 3FB7C 4TQFA 3RYFA 3BY6A 1RM1B 1S5JA 1ORQC 1OCOC 4LWSB 1FFXA 2R9AA 1FKAO 1XHXA 4TWKA 2ADPA 3E22A 5IJ0A 5L3CA 2YXHA 2VWJA 4UV8A 4ZM1A 2A7WA 4PDMA 3FAVA 1XHZA 3L70H 4KUMA 3IGAC 4DO2A 2CH7B 3SPIA 1VP7A 1AR4A 4PA4A 5JH7A 3EVKA 4YJ2A 2VQEB 2Q7GA 2Y4TA 3P3PA 4DR5O 2IJHA 3UO3A 4MTOA 5CN0A 1K4DC 2DQ3A 4X1YA 2WLKA 4H37A 2BSKA 2UUAO 5LL6Y 4RAIA 3APOA 2EZPA 1HNXO 3O65A 3RYCA 2AXTZ 3C3TA 3FD9A 1A32A 3OT7A 4EFBA 4QIWF 3J7AU 3D3QA 3CSXA 1TVKB 2HHHB 2EINB 4TQDA 3ZEDA 4DYLA 1GTOA 4IT5A 4X66O 3OMNB 5KAIZ 5JVDB 4EEQA 1OCCC 3G71V 1NVPD 4A5UB 2N04A 4UCOA 4UCUA 4MVRA 3CCRV 4JYAB 3AG2B 1XMQO 4ZI7A 3QTCA 2UUBB 1NQTA 2IJKA 4OPAA 4DR1O 1HNWO 1FJGB 3AEIA 2D2CB 1J5EO 3MDSA 5BR8O 4QGPA 4BR6A 3RVZA 2ODMA 2R70A 3L71H 2YIBD 2Q8VA 2F43G 4O2AB 2Z5UA 3T4ZA 3EXAA 1N0NA 5DEDA 2QE7G 2IBZH 1GM9A 5BXZA 2IW5A 1QU7A 3K57A 1SQFA 1JQ0A 2ZDIA 4FLXA 3CRQA 1PNKA 4JV5B 1S5LZ 1S5HC 3AG7A 2OCCB 1T5EA 3JD1A 5B3SB 1XNRB 2OCHA 3R65A 1BHBA 5B5EZ 1Y66A 1KC8W 1Y76A 4LFCO 4YY3B 1BCCH 4X8AA 5A2QN 4DV3O 2FL4A 2Q9LA 1ZL8A 5IWAO 1EN6A 3OGIB 1NT2B 3IC7A 5CA0B 2JK5C 4CC5A 3ZRVA 4JI0O 1KP3A 4B3RB 1XILA 5FLXN 1F51A 2P22C 2ETNA 4AQYO 4NXNO 2DQ0A 1TAEA 1WB8A 4LFAO 1SQBH 2Q73A 3N27A 5LMUO 1O9GA 1ZSPA 2LW7A 3M99B 1VARA 2E76B 3G6BA 1IXBA 3H1JH 3F5TA 2XTAA 4JI5O 1NR7A 4C7UA 3T1HB 2PZSA 1VMGA 1G1XB 4DR6O 4DV5B 1Z2GA 2ITCC 2CTWA 2WLJA 1KB9F 4JI2B 1F4NA 2XNDG 1MZEA 5KMGA 1VQ9V 4X1KA 3UQ8A 4D6TH 1IBKB 2A3QA 5FL7G 1B3QA 3OTOO 2JRIA 3C3SA 2QM7A 3DXRA 4DRXA 2Q68A 4P2ZA 2BE3A 1RSOA 3NXSA 3ZMTA 2QTOA 4LNUA 4LR3A 1PD3A 4LFBO 2R9RB 1XDCA 2JS3A 4DV6O 1H2GA 1RM1C 5B1OA 3E8GA 2UXBO 1ENVA 2DWDC 2Y0PA 4MS2A 1Q43A 3J80N 4O2BB 4J9ZB 1VQ5V 3ICXA 3N2GA 1QCEA 5KHIA 4TT3G 4XBFA 4GX1A 2CTRA 1XL4A 1K9MW 3I5DA 4DUYB 2PI5A 1Q3EA 1GN3A 4F6RA 4K8XA 5EBLC 4O4HB 3D36A 4U7NA 5B1AB 1SQGA 2HG5C 4KP4A 2EULA 4X88A 3K58A 3RT3C 4TSFG 4DV2O 1BS3A 3AG4B 4QNHB 1K7DA 1D2DA 3JD2A 4WFEA 2B5UA 4PELA 4WF9V 2QWNB 2ZE5A 1L0LH 2UXCO 1SRYA 1BZKA 2Q7EA 1M9NA 3ZN0A 3A0BZ 1LUWA 1L0NH 1WJZA 5JCOC 1LR1A 3Q4HA 2IJIA 2XAFA 3JALB 2WLLA 3N2KA 2UXDB 1E1QG 3RVYA 5LMNB 5DN6G 1AI6A 1GKFA 2P67A 3RFRA 1RPOA 4B3MB 4RO2A 2A0LA 1QQCA 3KZIZ 2Y4UA 2XAJA 4R6ZA 4I50B 1H2KA 1ZWIC 2Q0AA 4UCTA 4DV4B 4JI1O 1OJHA 1CEZA 3ABKB 2MW2B 1KYOF 3LDEA 2KB1A 4G2KA 3BFRA 2V7QG 2HP8A 1HNWB 4TOIA 3ABMB 1CPYA 3KKYA 3ZHTA 1RPRA 2PGGA 3LSUA 5L3GA 2KG7B 1PP9H 2ZM6B 2IU0A 2YS8A 3CD6V 1YIJV 5IJ9A 3ZRXA 4LF7B 4ABMA 1R3KC 4G28B 4IIJA 3W7SA 3CX5F 1MSWD 4CH5A 1SQQH 2YEVA 3GVMA 4P9PA 5AG2A 1GAXA 3LDDA 1IX9A 1H2MA 5CB4A 5CBHA 1K8AW 4MW3A 2OCCC 5B3SC 3M8AA 3OW2U 1EN4A 2P7TC 2Y69C 2VWKA 3CXCU 2BCCH 3SJBC 5JJJB 1OHHG 4LH6A 1WAZA 3X2QB 1D5NA 4JI6B 2LGWA 3OR6C 1JJOA 1YCIA 3CRRA 4IYHA 3RYHA 1P7BA 4I0XA 4PI2A 4LBEC 1IXMA 3VQVA 2YIBA 5EBWC 3IC9A 4JYYA 2Z0AA 4Z2WA 3ZHRA 1R3LC 1DLBA 5H2FZ 2F4VO 4YHHO 4UVBA 2GSMB 4O4JA 3STLC 3CCSV 4LF8B 1KBHA 5L3DA 1QR9A 5EZYB 4UVCA 3ASNB 1M90W 1YHQV 4LF4O 1N34O 2UXXA 2UUCO 4DR3B 4JGSA 1NZ6A 1ROPA 4ZM5A 2JIZG 4LWSA 4YIOA 4CS4A 4I55B 4MVMA 1WA8B 3RN4A 2Q69A 5EIBD 3H1KH 3OTOB 1SA0B 3CC2V 5GONB 3R66A 4X89A 1N4CA 5IYZB 2M7WA 1KMIZ 2IM9A 4PDLA 4ZHQB 2F66C 2CH7A 4FM1A 3K5LA 3ZX6A 2DE0X 4H33A 4LFBB 3BHPA 1SERA 3UM7A 4DV6B 2EBOA 3OGCC 3ML0A 1Y74B 3SPHA 3JARB 1CXZB 4WFGA 1GN6A 2HVKC 4KL1A 4MVSA 1QR8A 3VQYA 1H8EG 5EYPB 4B3TO 5JCOA 4RQFA 1PKXA 2G38A 1W2BU 3HKDB 5B1AC 2CTQA 3GWOA 2ZE8A 5BZBA 4PV1B 1TVKA 2ZINA 4NKGB 1W0KG 1I08A 3AG4C 1IBMO 2F23A 2QWQB 4HNAB 1SQPH 3TGUH 2Q6AA 3IFXA 5JVDA 1H38A 2XAHA 3CC7V 1OZ0A 3NR7A 2QEXV 2GUZA 2LP7A 4J9YB 5KAFZ 4E4EA 2UXCB 3CP1A 1H2NA 4K0KO 1JJ2U 1FPOA 2Y0IA 5B66Z 3K03A 2ZQMA 4HBNA 4QPJA 3E35A 4LF6O 4E2LA 4DV1B 4ZOLB 1SC5B 3TETA 1VEWA 1Q86W 4DR7O 4O4IB 4X65O 1R1BA 3D8CA 1N36B 4CZZA 4JPRA 4O2AA 4OGQB 4JTAB 5HFMA 4JI8O 4JI3O 5EIBC 1QVFU 2QKAA 3DTUB 1M93A 4MSWC 3OEHG 4CH3A 5JQGA 3OAAG 3QO5A 5E1AC 2LFSA 1XMOO 1VF7A 1VQ8V 1FXKB 3ZN1A 2FB5A 3JD3A 2P6JA 1N33O 4NXMO 1J95A 5IYCO 4UV9A 3ABMC 1OCRB 5C8YB 1V55B 4JI4B 2WPDG 4ASUG 3ABTA 3MHHC 1QBZA 5IT9N 2DWEC 2VRZA 3K79A 1HNZB 1QHTA 2VQFO 4I4TB 2JGDA 1Q81W 1FAFA 4WFHA 2JGUA 4D7SA 4JI7O 3AK2A 3HB3B 4FLZA 1M56B 2WA3A 4LH7A 4Z1VA 2JJ2G 5H6QA 1N0JA 4AILC 2UU9B 1VF6A 2LJ2A 1HWYA 5E79Z 2EX3A 5KHKA 1NH2B 3ABLB 1Y4MA 1M4UA 4UUJC 3WU2Z 5L3BA 1DF5A 2WLIB 3W7TA 2R9IA 2EIMB 2OTJV 3X2QC 1K92A 2L6LA 2WSSG 4DR2B 2YC0A 2A79B 1XL6A 2H3OA 1JCHA 4BWAA 2A06H 2VS0A 3KCXA 3SJCC 2CGNA 1AI7A 1JMKC 2ZR2A 1M1KW 4LF5B 2P90A 4X20A 2HFEC 3JCZA 3H01A 3ASOB 1E79G 1SESA 1GK9A 1R3IC 1R3JC 1AI5A 1LNQA 4TV8A 5IYBO 3CWBH 1GRJA 2GTSA 3ASNC 2WLNA 4W4LA 3L9DA 4MW8A 2X6CA 1PV0A 5LHGA 2W6JG 2YIAA 3LDCA 4H44B 2GTAA 2DMXA 3JASB 4JZGA 4N23A 2QGNA 4PJ0Z 2D3OW 5TISZ 1UPGA 5H6RA 5JJEB 2OIGA 2BOBC 3CXHF 3RYIB 5LHIA 4OPHA 4J11A 3AK3A 4GKKB 2ZD9A 3OE7G 1JFFB 1SQVH 2PYLA 3VQWA 5LXTB 1AJNA 4CH4A 4FM0A 2ZE7A 2JEXA 1I7FA 1Y6XA 3W7XA 2Y69B 4GCZA 1N32O 1WPBA 4UXNA 3F7YC 1I5XA 4WFAV 3CB2A 4JTDB 1HW7A 3G80A 4QE7A 3JALA 4B3SB 3RYFB 4FFBB 1BHAA 3K59A 3G67A 1XREA 3JD4A 3SJQC 1E1RG 5LGTA 2WAMA 1NH2D 1AB3A 2ZIMA 3ETEA 5K1PA 4D7TA 4I9WA 5J9PC 3RGBA 3CCJV 4I50A 4DR4O 1S76D 4CS2A 4JAAA 4FLVA 3BAAA 5L3FA 3QO7A 1R6TA 4K0KB 1OV9A 3P3NA 2P06A 1V54B 4X64O 2PF4E 2KG7A 4EKWA 5JJNB 1FXVA 2ARHA 3T1YB 3IAYA 2RJZA 3OFNG 2E5LB 4DV7B 4JI8B 3RYCB 4O4LB 4PA9A 1IBLO 2HJDA 3SJAC 3UO2A 4EFEA 2QA4V 1FXKC 4RQEA 2ZE6A 1ZUQA 3L72H 1XMOB 1NJIW 1K3EA 4B7EA 5KLVH 1OCRC 1V55C 4MVQA 5KA6A 5IYDO 5J2TB 4Z1MG 2F95B 4NR1A 1Q7YW 1TUBB 3OMIB 2P4VA 1YXBA 1RP3B 1RFYA 1Q6UA 1YTFB 1M56C 3GWKC 2GDSA 4U3FH 2JS5A 1VQNV 1HDJA 3K5OA 1U96A 3LNMB 1TA8A 4L87A 2X6BA 5CBFA 3SDLA 3ABLC 5LOVA 3ZMZA 1QNMA 2B1IA 2F1MA 4DR5B 2YUAA 3CCLV 1YVWA 3A8TA 3CYOA 4YJ3B 1SETA 3CMAV 2B1GA 3PN1A 4GZRB 1FD9A 3AG3B 5GTHZ 2EIMC 3JD0A 2EIKC 1H8HG 1PPJH 1YDXA 5KX5B 2UUAB 4I5SA 5EZYA 3H1IH 4FFKA 5BMVB 3A2FA 4F4LA 1HNXB 2QJ1A 4X62O 2Q0OC 4KHPO 1IURA 1XNQO 1VQ4V 4JYCA 4I55A 2GV9A 3B8MA 1XBLA 4TUYB 1SA0A 5GONA 5CA1A 5IYZA 3ASOC 1LUVA 3FB6C 2W0FC 3CCQV 4X66B 2PY5A 3CCVV 4ZHQA 3TJTA 3WB2A 3JCUZ 1BGYH 3CCUV 5LYJA 2YXLA 4R7CA 4GKJO 1GMGA 2E74B 2LW1A 2BOCC 2ZT9B 1XMQB 5IDJA 1JVMA 3FYEB 3HKBB 3SR2C 2C2AA 1MSDA 4WBNB 4DR1B 1R73A 4PA3A 4OX9O 3HR0A 1Y74A 3OM3B 1J5EB 4GX0A 3JARA 4J7ZA 2W6IG 5BR8B 5KHJA 4BW5A 3LUTB 5EYPA 2YIDA 1TGOA 4CC6A 3SYCA 4IGGA 3LSSA 4J42A 1SF9A 1NTZH 1EN5A 5CA3A 2RNBA 1KP2A 2PUSA 4K8ZA 4I7ZB 3HKDA 1DF4A 4FZ1A 2Y48A 3ZHUA 1YJWV 4ICGA 1FFTB 2EZOA 4L8JA 4BAYA 1K5QA 4HNAA 1BQZA 1URFA 4DRXB 4GLXA 1RSOB 4KFMA 2DYRC 3ZJZA 3KCYA 4LNUB 2HKOA 3L75H 4DK0A 1R6KA 1Z5VA 1P7GA 4FK5C 3ABUA 5D5PA 3FYIB 2O57A 5ITZA 1WB7A 2VQEO 2OWOA 2Q67A 4LFCB 3CC4V 1Q5OA 1YTFD 3OUFA 4DV3B 3K0DA 3C90A 3I55V 3MD0A 1FXHA 2BTOA 4ZOLA 5IWAB 2XOKG 5J2UB 4UCRA 5KUMA 4JI0B 4DW1A 3ZMVA 2N05A 3CE2A 5FNVB 1XOUA 1P84F 3RWRD 4AQYB 1VF5B 4NXNB 2Q4PA 4LFAB 3ZHQA 4IHJB 5LMUB 1VQMV 2RCVA 1M5IA 3K0GA 2RMKB 4QE9A 1K73W 3E86A 1JA8A 4UFZA 1UJWB 4JI5B 3SGIA 3B8PA 1VQKV 5LP6B 4DR6B 1NS1A 2WWWA 1V54C 5C8YA 3JATB 1OCZB 4Q20A 3K5MA 4JYAO 3JYCA 2R72A 2V1DA 1YSCA 5B1BB 1YJ9V 4NTYA 2UUBO 4AI8A 2YXYA 4LP8A 4I4TA 3QO8A 4N21A 3EFFK 3JAWB 1YI2V 1K97A 2AHZA 2K9PA 1PL4A 5CBGA 1HP8A 1XEQA 3OEEG 3CHXA 2QTSA 1AR1B 1EZJA 1NTKH 2XHBA 1KQSU 1KKDA 4W4KA 1FS0G 3BA9A 4OXSA 4XDLA 2QWPB 2UXBB 4Q6GA 2GBOA 2WLIA 1YZBA 3BCCH 3E8HA 2LGQA 2P5OA 3UT5B 4EB6B 4P30A 1AR5A 1EM1A 1S72V 1XNRO 1NBMG 3ZMSA 2X0LA 2ZNJA 1W59A 1COWG 1Q8IA 4MVZA 1P4RA 4YY3O 1H2LA 1ZAUA 3B8NA 1AILA 4PHZA 4DV2B 5DM6V 5KA5A 1WN7A 2K1EA 3AG3C 4B3RO 1AP6A 3K5NA 2CDYA 4FLUA 3WFVA 4R8CA 3UKMA 1S3JA 2QM8A 2ZDIC 3CPWU 1YJNV 4FM2A 4YXWG 3SYAA 1EZVH 5H9CA 4RUFA 1L1FA 4X62B 3CJHB 1SQXH 1WNSA 1KU9A 3JASA 2H8PC 3G4SV 2Q7HA 2ZCEA 4UCSA 2E75B 2AHYA 5CMUA 3T1HO 1GM7A 2OTLV 3HKEB 4DV5O 2BTQB 4JI2O 5C93A 2CE4A 2FKXA 3E2EA 2YI8A 5EK0A 3K3WA 4B7KA 5H5NA 4CS3A 1JFFA 2H94A 3MHSC 4JI1B 4I9QA 4FIPC 1F4MA 5EBMC 2QWOB 3E89A 4NTWA 3ETQA 5JWPA 3QF7A 2QWRB 1I5YA 4DV0O 4TV9B 4UB6Z 4HAMA 5D5QA 2NNUA 2JJ1G 5EC1C 5CA0A 4B08A 1UFIA 4FFBA 1W0JG 3ZIAG 2P4KA 1AROP 3T1CA 3U10A 4IYIA 3H1HH 1BSMA 2M6YA 1GN4A 1N8RW 2NLJC 1QVGU 1BT8A 1MZFA 3J81N 4DUYO 1KECA 5F2VO 3S3WA 3CRAA 5A9GA 1AJQA 1SKVA 2EIKB 3JAKB 2UXNA 5LA6B 3B4SA 3HKCB 5LGNA 3SPGA 2QR4A 4LF9O 4U3JB 3SPJA 3VQXA 3BEHA 1ZTEA 1B06A 1DK1A 3OR7C 4U7OA 1US6A 1WP8A 1H2SB 2ATKC 2ZR3A 3FKSG 3SYPA 4O4LA 3ZS8C 1KKCA 3E83A 4PDRA 2EILC 2UXDO 3D36C 5LMNO 2F4VB 2MK3A 4YHHB 2HVJC 4PDVA 1JOYA 1QLNA 4B3MO 5LP6C 4DW0A 2DYSC 4LF4B 1N34B 1OCZC 2UUCB 4WFBV 3F5WC 4E2HA 4GT1A 4X1IB 1TUEB 2ZNIA 5B1BC 3RBZA 4FLYA 5J2TA 1IDSA 4O2BA 4DV4O 2GUZB 2WA4A 3W7UA 1IZ3A 3K04A 2IJJA 1VIBA 1TUBA 3ZRSA 2IH1C 4H0LB 5K1XA 3A0RA 2YI9A 2Z3YA 4GX2A 1WP7A 2LFRA 3B40A 3QG5A 1VQOV 3K9SA 1PNLA 3WG7B 4O4HA 3BVOA 3CS5A 3ETDA 2ZM6O 1VQ6V 1SZXA 1I94O 2CAZC 4AHCA 1F7YA 4LF7O 2Q5ZA 4YIPA 4YJ3A 3ZRWB 2DYRB 5IY5B 5JQGB 5KX5A 1CP9A 3P30A 2OIEA 5BMVA 3PJSK 3SYOA 4B3TB 1YEWA 2W0XA 3JAMN 2ADQB 2DN9A 2HR3A 4NB5A 3W7WA 2KSDA 1FFXB 1BL8A 2ILMA 4JASA 3TXQA 4UB8Z 4TUYA 3SYQA 3E22B 3TCUA 4MTFA 1BMFG 5KHHA 5IJ0B 1Z5WA 1L8DA 4G27B 1IBMB 2JGDB 2QM4A 1EBOA 4JI6O 3DC5A 5LHHA 3FAVB 1NTMH 3APQA 3THOA 3K9AA 5JH7B 2X6AA 1O9HA 4YJ2B 3HKBA 4X9QA 4WBNA 1VQ7V 4JTCB 4X1YB 4JAUA 4LF6B 4HZ3A 3OUSA 4LF8O 2L35A 2BSKB 1B04A 1KUQA 3I56V 4DR7B 4X65B 4LCUC 2JEUA 2ITDC 4HYOA 4CBCA 3BABA 4R50A 5HFLA 4DR3O 2ZXWB 4JI3B 2HLDG 1MABG 5L3EA 3L73H 5KUKA 3WB0A 4NYKA 3DC6A 2KKWA 3F7VC 4WFFA 4XDKA 4UVAA 1QLEB 1N33B 4NXMB 3BPZA 3CEIA 4X20B 5LBQA 2QDOA 4PA7A 3JSLA 3L74H 4TV8B 2EIJB 1NR1A 5GW7A 2GHYA 1YITV 4ZI7B 4BIUA 4NTXA 2JVDA 2XUMA 2VQFB 4DV0B 3CCMV 4JI7B 1PNMA 4PI0A 5J2UA 3VOUA 3KG2A 3ZBHA 4F6EA 2XAGA 3B09A 3D3IA 3P32A 2YDEA 5FNVA 4NVPA 5FPRA 1V9PA 2FYUH 4IHJA 3FB5C 3SPCA 3FB8C 1Q82W 3MAQA 1X4TA 1WLEA 1NI8A 5IE9A 3E8BA 5LP6A 2LO1A 1KD1W 4MTXA 1GO3F 3S3XA 4IL6Z 1PL0A 4DUZO 4LF9B 3JATA 1DGSA 1HR0O 2LQTA 4H13B 1WA8A 4QPKA 4E2CA 1Y76B 4K35A 3ZHVA 5BY1A 3EHBB 3JAWA 3T2MA 1M57B 2FTKA 3OD4A 4J7JA 4DK1A 3JSNA 1ZL8B 3TK1A 2OT5A 4DV1O 1XUQA 1N36O 2EINC 1GH6A 1JR9A 1BE3H 3AG1B 4RUEA 3U11A 1P49A 4FJCC 5LGUA 1YF2A 4BW9A 3AG2C 2V4DA 4ZBMA 1K33A 3ZHSA 1JX9A 1DTOA 3UT5A 4EB6A 4JI4O 3WG7C 5KMGB 4X1KB 1OCOB 2X7RB 1GM8A 4J10A 3RW0A 4LC1A 1HNZO 4FVMA 1D5AA 4PA6A 3DXRB 4JZ2A 1I94B 1ZX3A 3GB7C 5IY5C 1G6UA 1I0HA 2CUGA 3E8FA 3OMAB 3CRCA 3HPLC 4BIZA 2CGOA 3BRCA 2UU9O 1N32B 4J7KA 2CTPA 1Q6HA 3ZMUA 4MVUA 2ZKOA 1NKDA 4FLTA 3CJHA 2QKSA 1XI1A 2DW4A 2XT9A 4O4IA 3T4DA 2WLHA 1K4CC 3HKEA 3K06A 3TXSA 2NR5A 3N2GB 2BTQA 1JPXA 4RWUA 4DR2O 2ZIOA 2XAQA 3QNEA 4F6RB 2E3CA 2CK3G 2EILB 2HHHO 3VBBA 4DR4B 1VF6C 1FXKA 4LF5O 5GTIZ 1MOFA 1VQLV 5LOVB 4WCEV 2F93B 4MVOA 2AW9A 2DYSB 4UCVA 2DOSA 3G6EV 3BA8A 4X64B 4QJFB 1IVSA 1AJPA 1OCCB 2RQ6A 3LSQA 2EJRA 4JF3A 3LNNA 2JDIG 4TV9A 1FYJA 2ZXWC 1FJGO 4FPPA 2RDCA 3FFQA 1B6QA 2OYQA 3ZCCA 3Q4HB 3ETGA 1VQPV 2KQXA 2WLLB 3N2KB 1AI4A 1IBLB 2AZ0A 4FLWA 4E29A 1PM9A 4GUNA 1AP5A 2A9HA 3FX7A 1MA1A 1QLEC 1ZLZA 2RN9A 1Q6IA 5CA1B 3OTFA 4GKKO 1EFRG 1AVMA 3CRMA 2EIJC 2FMLA 4P9OA 5LYJB 2XASA 3JAKA 5LA6A 4JV5O 3HKCA 2AGAA 4JYBA 4U3JA 1F23A 3O9OA 1XQ8A 2PYJA 3AK1A 2PTMA 2WLMA 4BIOA 1MNGA 3B8OA 4ZKIA 2QKCA 1K34A 4ZIBA 4FZ0A 3IJ4A 3M7MX 2HEPA 4B3SO 5IJ9B 4PD4F 3K08A 2DJVA 5EC2C 4IIJB 3CMEV 1SS3A 1X59A 2HJFC 2YEVB 3DSQA 5CB4B 4XDJA 1NU1H 3DGEA 4KXRA 1R6NA 3WB1A
chains in the Genus database with same CATH topology
1OCZC 1V55C 5B3SC 3B77A 4MVQA 2IU3A 5KA6A 4WFBV 3F5WC 3OW2U 4E2HA 4GT1A 2P7TC 2Y69C 1TUEB 3CXCU 5B1BC 1SZTA 3RBZA 5IYDO 5B1NA 4Z1MG 3STZC 1G8MA 3W7UA 1NVPB 1S0VA 3K04A 2IJJA 1Q7YW 1M57C 1OHHG 4FMTA 3OMIB 2IH1C 3ZRSA 3A0RA 2Z3YA 1G4YB 4GX2A 1M56C 4MTGA 1YTFB 2LFRA 3X2QB 4JAVA 1THZA 1MG1A 4DXWA 3CCEV 3OR6C 1VQOV 1PNLA 3WG7B 1VQNV 3ETDA 1P7BA 3LNMB 1VQ6V 2PI4A 4L87A 2X6BA 4MT8A 5CBFA 4LBEC 3AG1C 3ABLC 1IXMA 1K5SA 3ZMZA 2B1IA 5EBWC 3CCLV 1WPXA 3ZRWA 3CYOA 3ZRWB 2DYRB 1SETA 3CMAV 2IH3C 1R3LC 1DLBA 2B1GA 4GX5A 5IY5B 1S77D 3AG3B 4UVBA 2GSMB 2EIMC 3JD0A 2EIKC 3STLC 3CCSV 1H8HG 1CP9A 5L3DA 4I5SA 3P30A 1QR9A 3ABKC 2YSUB 4UVCA 3ASNB 1M90W 1YHQV 3PJSK 3FB7C 3SYOA 2UXXA 4F4LA 3BY6A 4JGSA 1RM1B 1ORQC 1ROPA 1VQ4V 4ZM5A 2HR3A 2JIZG 4JYCA 1OCOC 3W7WA 3B8MA 4MVMA 1BL8A 4TWKA 4JASA 3SYQA 3TCUA 4MTFA 1BMFG 5L3CA 2Q69A 3CC2V 4G27B 4UV8A 4X89A 4ZM1A 3ASOC 2M7WA 4PDMA 1EBOA 3FB6C 2W0FC 3CCQV 5LHHA 3CCVV 4PDLA 4KUMA 3IGAC 4DO2A 3CCUV 3SPIA 4PA4A 4R7CA 3K9AA 4H33A 1GMGA 2X6AA 2BOCC 5IDJA 1JVMA 3FYEB 1SERA 2IJHA 2C2AA 3UM7A 2EBOA 4MTOA 3OGCC 1R73A 1K4DC 2DQ3A 3ML0A 4JTCB 4PA3A 5CN0A 3OM3B 1VQ7V 4JAUA 4GX0A 3SPHA 4HZ3A 2W6IG 2WLKA 4H37A 3OUSA 4BW5A 4WFGA 3LUTB 2HVKC 4MVSA 4RAIA 3I56V 1QR8A 1H8EG 4LCUC 2JEUA 3SYCA 2EZPA 3LSSA 2ITDC 4HYOA 4CBCA 4R50A 5HFLA 2ZXWB 5CA3A 4RQFA 2HLDG 1KP2A 1PKXA 1MABG 5L3EA 1W2BU 1DF4A 5B1AC 3GWOA 5BZBA 5KUKA 4QIWF 2Y48A 1YJWV 3F7VC 1FFTB 1W0KG 2EZOA 4WFFA 4XDKA 4BAYA 3AG4C 2EINB 1K5QA 4UVAA 1QLEB 1GTOA 2Q6AA 3IFXA 3OMNB 1H38A 4KFMA 2DYRC 2XAHA 3ZJZA 5LBQA 4PA7A 2HKOA 3CC7V 1OZ0A 2QEXV 1R6KA 1OCCC 3G71V 1NVPD 2EIJB 4FK5C 3ABUA 2LP7A 3FYIB 1NR1A 4MVRA 3CCRV 5GW7A 2GHYA 3AG2B 4J9YB 1YITV 2Q67A 3CC4V 3CP1A 4BIUA 1YTFD 1JJ2U 1NQTA 3OUFA 2IJKA 3K0DA 3K03A 2ZQMA 3CCMV 3I55V 4QPJA 3AEIA 3E35A 3MD0A 1FXHA 1PNMA 4E2LA 3VOUA 2XOKG 3TETA 3KG2A 5KUMA 1Q86W 2XAGA 3RVZA 3ZMVA 3D3IA 3P32A 4CZZA 4JPRA 2F43G 4JTAB 5HFMA 2Z5UA 1QVFU 3DTUB 4MSWC 3T4ZA 3OEHG 1VQMV 3FB5C 3K0GA 3SPCA 3FB8C 3OAAG 2QE7G 3QO5A 4QE9A 5E1AC 1Q82W 2LFSA 1GM9A 1K73W 3E86A 1WLEA 2IW5A 1VQ8V 1JQ0A 1FXKB 2ZDIA 3ZN1A 1UJWB 3JD3A 3E8BA 1PNKA 2P6JA 3B8PA 1J95A 5IYCO 1VQKV 1KD1W 1S5HC 1GO3F 2WWWA 4MTXA 4UV9A 1PL0A 1V54C 3ABMC 2OCCB 1OCRB 1OCZB 1V55B 3JD1A 2WPDG 4Q20A 5B3SB 4ASUG 3ABTA 3MHHC 3R65A 1BHBA 4QPKA 3JYCA 1QBZA 2V1DA 1YSCA 1Y66A 2DWEC 5B1BB 1YJ9V 1KC8W 4E2CA 3K79A 4LP8A 4X8AA 3EHBB 3QO8A 1Q81W 4N21A 3EFFK 4WFHA 3T2MA 1M57B 1YI2V 1K97A 2AHZA 2FTKA 3HB3B 5CBGA 3TK1A 2OT5A 1M56B 3IC7A 2JK5C 3ZRVA 2JJ2G 1KP3A 5H6QA 3OEEG 1AR1B 1F51A 2EINC 1HWYA 1EZJA 3AG1B 2DQ0A 4RUEA 1NH2B 3ABLB 1Y4MA 1KQSU 1KKDA 4FJCC 4UUJC 1FS0G 4OXSA 4XDLA 5LGUA 5L3BA 1DF5A 3M99B 2WLIA 3AG2C 2WLIB 3W7TA 2R9IA 4ZBMA 2EIMB 1K33A 2OTJV 1NR7A 3E8HA 1JX9A 1DTOA 3X2QC 1K92A 2ITCC 2WLJA 4P30A 1F4NA 2XNDG 1S72V 3WG7C 2WSSG 1VQ9V 1NBMG 3ZMSA 2A79B 1XL6A 2X0LA 1COWG 1JCHA 1OCOB 2X7RB 4MVZA 1P4RA 5FL7G 1GM8A 3RW0A 4LC1A 3B8NA 1AI7A 4PA6A 2ZR2A 2QM7A 1M1KW 2P90A 2Q68A 4P2ZA 3NXSA 3ZMTA 2HFEC 2QTOA 3JCZA 3H01A 5DM6V 3GB7C 3ASOB 5KA5A 5IY5C 1E79G 1SESA 1GK9A 1R3IC 2K1EA 3AG3C 1R3JC 3E8FA 3OMAB 1AI5A 1LNQA 1PD3A 3HPLC 5IYBO 4BIZA 3WFVA 4R8CA 3UKMA 2R9RB 1S3JA 3ASNC 2QM8A 2ZDIC 3CPWU 1YJNV 4YXWG 3SYAA 2WLNA 4MW8A 2X6CA 5H9CA 1H2GA 3ZMUA 1RM1C 5LHGA 4MVUA 2W6JG 4RUFA 5B1OA 3E8GA 1L1FA 3LDCA 1NKDA 2QKSA 1ENVA 2DWDC 4MS2A 2DW4A 2H8PC 3T4DA 3G4SV 2WLHA 4N23A 2D3OW 2AHYA 5H6RA 4J9ZB 5CMUA 1GM7A 1K4CC 1VQ5V 3K06A 2OTLV 1QCEA 2BOBC 4TT3G 4XBFA 1JPXA 5LHIA 4GX1A 1XL4A 1K9MW 5C93A 2PI5A 2XAQA 3QNEA 3E2EA 2ZD9A 2CK3G 5EK0A 3K3WA 5EBLC 2EILB 3D36A 4U7NA 5B1AB 3VBBA 2HG5C 4KP4A 1FXKA 3OE7G 4X88A 2H94A 3MHSC 4TSFG 1MOFA 1AJNA 1VQLV 3AG4B 4QNHB 1K7DA 4WCEV 4MVOA 2DYSB 4FIPC 1F4MA 3JD2A 2JEXA 5EBMC 4WFEA 2B5UA 4PELA 3W7XA 3G6EV 4WF9V 3E89A 2Y69B 4QJFB 1AJPA 4GCZA 1OCCB 1SRYA 3LSQA 2EJRA 4UXNA 4JF3A 3F7YC 1I5YA 1M9NA 2JDIG 3ZN0A 1I5XA 4WFAV 2ZXWC 4FPPA 4JTDB 4HAMA 2NNUA 1B6QA 2JJ1G 3ZCCA 4QE7A 3ETGA 2IJIA 2XAFA 1VQPV 5EC1C 2WLLA 2WLLB 1W0JG 3ZIAG 1BHAA 1AI4A 1AROP 3T1CA 3JD4A 1E1QG 4E29A 3RVYA 5DN6G 3SJQC 1AI6A 1E1RG 1GKFA 2A9HA 5LGTA 2WAMA 1NH2D 1QLEC 2P67A 1N8RW 1RPOA 2NLJC 1QVGU 3ETEA 1KECA 4RO2A 1EFRG 4I9WA 2A0LA 2EIJC 5J9PC 2XAJA 3CCJV 4R6ZA 4P9OA 1S76D 1AJQA 1ZWIC 2EIKB 2XASA 2UXNA 1CEZA 5LGNA 3SPGA 3ABKB 4JYBA 5L3FA 1F23A 3LDEA 3QO7A 2KB1A 4G2KA 3SPJA 2V7QG 1V54B 1CPYA 3ABMB 2WLMA 3BEHA 1RPRA 3B8OA 4ZKIA 4EKWA 5L3GA 1FXVA 1K34A 3OR7C 4U7OA 2IU0A 2ATKC 3OFNG 3CD6V 2ZR3A 3FKSG 3SYPA 1YIJV 3ZRXA 3E83A 4PA9A 3K08A 4PDRA 1R3KC 4G28B 5EC2C 2EILC 3W7SA 3CMEV 2MK3A 1MSWD 2YEVA 4P9PA 2QA4V 2HVJC 2HJFC 2YEVB 1FXKC 3LDDA 4PDVA 4RQEA 1JOYA 1QLNA 1NJIW 4XDJA 1K3EA 5CBHA 2DYSC 3DGEA 1K8AW 4MW3A 1R6NA 2OCCC 1OCRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQ0 A;  3B77 A;  1ENV A;  1QR8 A;  5KA6 A;  2OT5 A;  2P6J A;  3MHS C;  3B8P A;  4E2H A;  1K33 A;  3H01 A;  2EZP A;  4JGS A;  5KA5 A;  1MOF A;  3K9A A;  1SZT A;  3M99 B;  4N23 A;  5HFL A;  4ZM5 A;  4JPR A;  4FIP C;  4FK5 C;  5CMU A;  5HFM A;  3B8M A;  2LP7 A;  4E29 A;  1F23 A;  1QCE A;  3MHH C;  4G2K A;  3WFV A;  1DF4 A;  1JPX A;  2MK3 A;  3CYO A;  3GWO A;  3CP1 A;  1QBZ A;  2EBO A;  1DLB A;  1Y66 A;  1Y4M A;  4E2C A;  5CN0 A;  2X7R B;  5H9C A;  4FJC C;  1MG1 A;  2EZO A;  4JF3 A;  3B8O A;  1I5Y A;  2M7W A;  4N21 A;  4ZM1 A;  1I5X A;  1EBO A;  3B8N A;  1QR9 A;  3P30 A;  1K34 A;  4E2L A;  1DF5 A; 
#chains in the Genus database with same CATH topology
 3B77 A;  2IU3 A;  1GN2 A;  4KHP B;  5KHG A;  4DUZ B;  3H9V A;  1XNQ B;  1MMM A;  4X1I A;  1SZT A;  1HR0 B;  5B1N A;  2EJ7 A;  3STZ C;  2QSA A;  1G8M A;  5ITZ B;  1NVP B;  1S0V A;  2YIC A;  1M57 C;  4FMT A;  3RYI A;  3UCS C;  2NN4 A;  1G4Y B;  4MTG A;  2AZ2 A;  3H1L H;  1IBK O;  4JAV A;  1THZ A;  1MG1 A;  4DXW A;  3CCE V;  1U97 A;  2N74 A;  4CH6 A;  3RYH B;  3B2E E;  3T1Y O;  4I0X B;  2PI4 A;  4MT8 A;  3U0Z A;  5DEC A;  4GKJ B;  5LXT A;  3AG1 C;  2E5L O;  4DV7 O;  1K5S A;  1Y67 A;  3A0H Z;  4K3A A;  4J80 A;  1WPX A;  3ZRW A;  2B9Z A;  1Q90 D;  4OX9 B;  5FPO A;  2IH3 C;  4GX5 A;  1S77 D;  3QVN A;  1BQ0 A;  4J41 A;  4O4J B;  3ABK C;  2YSU B;  4GYC B;  3FB7 C;  4TQF A;  3RYF A;  3BY6 A;  1RM1 B;  1S5J A;  1ORQ C;  1OCO C;  4LWS B;  1FFX A;  2R9A A;  1FKA O;  1XHX A;  4TWK A;  2ADP A;  3E22 A;  5IJ0 A;  5L3C A;  2YXH A;  2VWJ A;  4UV8 A;  4ZM1 A;  2A7W A;  4PDM A;  3FAV A;  1XHZ A;  3L70 H;  4KUM A;  3IGA C;  4DO2 A;  2CH7 B;  3SPI A;  1VP7 A;  1AR4 A;  4PA4 A;  5JH7 A;  3EVK A;  4YJ2 A;  2VQE B;  2Q7G A;  2Y4T A;  3P3P A;  4DR5 O;  2IJH A;  3UO3 A;  4MTO A;  5CN0 A;  1K4D C;  2DQ3 A;  4X1Y A;  2WLK A;  4H37 A;  2BSK A;  2UUA O;  5LL6 Y;  4RAI A;  3APO A;  2EZP A;  1HNX O;  3O65 A;  3RYC A;  2AXT Z;  3C3T A;  3FD9 A;  1A32 A;  3OT7 A;  4EFB A;  4QIW F;  3J7A U;  3D3Q A;  3CSX A;  1TVK B;  2HHH B;  2EIN B;  4TQD A;  3ZED A;  4DYL A;  1GTO A;  4IT5 A;  4X66 O;  3OMN B;  5KAI Z;  5JVD B;  4EEQ A;  1OCC C;  3G71 V;  1NVP D;  4A5U B;  2N04 A;  4UCO A;  4UCU A;  4MVR A;  3CCR V;  4JYA B;  3AG2 B;  1XMQ O;  4ZI7 A;  3QTC A;  2UUB B;  1NQT A;  2IJK A;  4OPA A;  4DR1 O;  1HNW O;  1FJG B;  3AEI A;  2D2C B;  1J5E O;  3MDS A;  5BR8 O;  4QGP A;  4BR6 A;  3RVZ A;  2ODM A;  2R70 A;  3L71 H;  2YIB D;  2Q8V A;  2F43 G;  4O2A B;  2Z5U A;  3T4Z A;  3EXA A;  1N0N A;  5DED A;  2QE7 G;  2IBZ H;  1GM9 A;  5BXZ A;  2IW5 A;  1QU7 A;  3K57 A;  1SQF A;  1JQ0 A;  2ZDI A;  4FLX A;  3CRQ A;  1PNK A;  4JV5 B;  1S5L Z;  1S5H C;  3AG7 A;  2OCC B;  1T5E A;  3JD1 A;  5B3S B;  1XNR B;  2OCH A;  3R65 A;  1BHB A;  5B5E Z;  1Y66 A;  1KC8 W;  1Y76 A;  4LFC O;  4YY3 B;  1BCC H;  4X8A A;  5A2Q N;  4DV3 O;  2FL4 A;  2Q9L A;  1ZL8 A;  5IWA O;  1EN6 A;  3OGI B;  1NT2 B;  3IC7 A;  5CA0 B;  2JK5 C;  4CC5 A;  3ZRV A;  4JI0 O;  1KP3 A;  4B3R B;  1XIL A;  5FLX N;  1F51 A;  2P22 C;  2ETN A;  4AQY O;  4NXN O;  2DQ0 A;  1TAE A;  1WB8 A;  4LFA O;  1SQB H;  2Q73 A;  3N27 A;  5LMU O;  1O9G A;  1ZSP A;  2LW7 A;  3M99 B;  1VAR A;  2E76 B;  3G6B A;  1IXB A;  3H1J H;  3F5T A;  2XTA A;  4JI5 O;  1NR7 A;  4C7U A;  3T1H B;  2PZS A;  1VMG A;  1G1X B;  4DR6 O;  4DV5 B;  1Z2G A;  2ITC C;  2CTW A;  2WLJ A;  1KB9 F;  4JI2 B;  1F4N A;  2XND G;  1MZE A;  5KMG A;  1VQ9 V;  4X1K A;  3UQ8 A;  4D6T H;  1IBK B;  2A3Q A;  5FL7 G;  1B3Q A;  3OTO O;  2JRI A;  3C3S A;  2QM7 A;  3DXR A;  4DRX A;  2Q68 A;  4P2Z A;  2BE3 A;  1RSO A;  3NXS A;  3ZMT A;  2QTO A;  4LNU A;  4LR3 A;  1PD3 A;  4LFB O;  2R9R B;  1XDC A;  2JS3 A;  4DV6 O;  1H2G A;  1RM1 C;  5B1O A;  3E8G A;  2UXB O;  1ENV A;  2DWD C;  2Y0P A;  4MS2 A;  1Q43 A;  3J80 N;  4O2B B;  4J9Z B;  1VQ5 V;  3ICX A;  3N2G A;  1QCE A;  5KHI A;  4TT3 G;  4XBF A;  4GX1 A;  2CTR A;  1XL4 A;  1K9M W;  3I5D A;  4DUY B;  2PI5 A;  1Q3E A;  1GN3 A;  4F6R A;  4K8X A;  5EBL C;  4O4H B;  3D36 A;  4U7N A;  5B1A B;  1SQG A;  2HG5 C;  4KP4 A;  2EUL A;  4X88 A;  3K58 A;  3RT3 C;  4TSF G;  4DV2 O;  1BS3 A;  3AG4 B;  4QNH B;  1K7D A;  1D2D A;  3JD2 A;  4WFE A;  2B5U A;  4PEL A;  4WF9 V;  2QWN B;  2ZE5 A;  1L0L H;  2UXC O;  1SRY A;  1BZK A;  2Q7E A;  1M9N A;  3ZN0 A;  3A0B Z;  1LUW A;  1L0N H;  1WJZ A;  5JCO C;  1LR1 A;  3Q4H A;  2IJI A;  2XAF A;  3JAL B;  2WLL A;  3N2K A;  2UXD B;  1E1Q G;  3RVY A;  5LMN B;  5DN6 G;  1AI6 A;  1GKF A;  2P67 A;  3RFR A;  1RPO A;  4B3M B;  4RO2 A;  2A0L A;  1QQC A;  3KZI Z;  2Y4U A;  2XAJ A;  4R6Z A;  4I50 B;  1H2K A;  1ZWI C;  2Q0A A;  4UCT A;  4DV4 B;  4JI1 O;  1OJH A;  1CEZ A;  3ABK B;  2MW2 B;  1KYO F;  3LDE A;  2KB1 A;  4G2K A;  3BFR A;  2V7Q G;  2HP8 A;  1HNW B;  4TOI A;  3ABM B;  1CPY A;  3KKY A;  3ZHT A;  1RPR A;  2PGG A;  3LSU A;  5L3G A;  2KG7 B;  1PP9 H;  2ZM6 B;  2IU0 A;  2YS8 A;  3CD6 V;  1YIJ V;  5IJ9 A;  3ZRX A;  4LF7 B;  4ABM A;  1R3K C;  4G28 B;  4IIJ A;  3W7S A;  3CX5 F;  1MSW D;  4CH5 A;  1SQQ H;  2YEV A;  3GVM A;  4P9P A;  5AG2 A;  1GAX A;  3LDD A;  1IX9 A;  1H2M A;  5CB4 A;  5CBH A;  1K8A W;  4MW3 A;  2OCC C;  5B3S C;  3M8A A;  3OW2 U;  1EN4 A;  2P7T C;  2Y69 C;  2VWK A;  3CXC U;  2BCC H;  3SJB C;  5JJJ B;  1OHH G;  4LH6 A;  1WAZ A;  3X2Q B;  1D5N A;  4JI6 B;  2LGW A;  3OR6 C;  1JJO A;  1YCI A;  3CRR A;  4IYH A;  3RYH A;  1P7B A;  4I0X A;  4PI2 A;  4LBE C;  1IXM A;  3VQV A;  2YIB A;  5EBW C;  3IC9 A;  4JYY A;  2Z0A A;  4Z2W A;  3ZHR A;  1R3L C;  1DLB A;  5H2F Z;  2F4V O;  4YHH O;  4UVB A;  2GSM B;  4O4J A;  3STL C;  3CCS V;  4LF8 B;  1KBH A;  5L3D A;  1QR9 A;  5EZY B;  4UVC A;  3ASN B;  1M90 W;  1YHQ V;  4LF4 O;  1N34 O;  2UXX A;  2UUC O;  4DR3 B;  4JGS A;  1NZ6 A;  1ROP A;  4ZM5 A;  2JIZ G;  4LWS A;  4YIO A;  4CS4 A;  4I55 B;  4MVM A;  1WA8 B;  3RN4 A;  2Q69 A;  5EIB D;  3H1K H;  3OTO B;  1SA0 B;  3CC2 V;  5GON B;  3R66 A;  4X89 A;  1N4C A;  5IYZ B;  2M7W A;  1KMI Z;  2IM9 A;  4PDL A;  4ZHQ B;  2F66 C;  2CH7 A;  4FM1 A;  3K5L A;  3ZX6 A;  2DE0 X;  4H33 A;  4LFB B;  3BHP A;  1SER A;  3UM7 A;  4DV6 B;  2EBO A;  3OGC C;  3ML0 A;  1Y74 B;  3SPH A;  3JAR B;  1CXZ B;  4WFG A;  1GN6 A;  2HVK C;  4KL1 A;  4MVS A;  1QR8 A;  3VQY A;  1H8E G;  5EYP B;  4B3T O;  5JCO A;  4RQF A;  1PKX A;  2G38 A;  1W2B U;  3HKD B;  5B1A C;  2CTQ A;  3GWO A;  2ZE8 A;  5BZB A;  4PV1 B;  1TVK A;  2ZIN A;  4NKG B;  1W0K G;  1I08 A;  3AG4 C;  1IBM O;  2F23 A;  2QWQ B;  4HNA B;  1SQP H;  3TGU H;  2Q6A A;  3IFX A;  5JVD A;  1H38 A;  2XAH A;  3CC7 V;  1OZ0 A;  3NR7 A;  2QEX V;  2GUZ A;  2LP7 A;  4J9Y B;  5KAF Z;  4E4E A;  2UXC B;  3CP1 A;  1H2N A;  4K0K O;  1JJ2 U;  1FPO A;  2Y0I A;  5B66 Z;  3K03 A;  2ZQM A;  4HBN A;  4QPJ A;  3E35 A;  4LF6 O;  4E2L A;  4DV1 B;  4ZOL B;  1SC5 B;  3TET A;  1VEW A;  1Q86 W;  4DR7 O;  4O4I B;  4X65 O;  1R1B A;  3D8C A;  1N36 B;  4CZZ A;  4JPR A;  4O2A A;  4OGQ B;  4JTA B;  5HFM A;  4JI8 O;  4JI3 O;  5EIB C;  1QVF U;  2QKA A;  3DTU B;  1M93 A;  4MSW C;  3OEH G;  4CH3 A;  5JQG A;  3OAA G;  3QO5 A;  5E1A C;  2LFS A;  1XMO O;  1VF7 A;  1VQ8 V;  1FXK B;  3ZN1 A;  2FB5 A;  3JD3 A;  2P6J A;  1N33 O;  4NXM O;  1J95 A;  5IYC O;  4UV9 A;  3ABM C;  1OCR B;  5C8Y B;  1V55 B;  4JI4 B;  2WPD G;  4ASU G;  3ABT A;  3MHH C;  1QBZ A;  5IT9 N;  2DWE C;  2VRZ A;  3K79 A;  1HNZ B;  1QHT A;  2VQF O;  4I4T B;  2JGD A;  1Q81 W;  1FAF A;  4WFH A;  2JGU A;  4D7S A;  4JI7 O;  3AK2 A;  3HB3 B;  4FLZ A;  1M56 B;  2WA3 A;  4LH7 A;  4Z1V A;  2JJ2 G;  5H6Q A;  1N0J A;  4AIL C;  2UU9 B;  1VF6 A;  2LJ2 A;  1HWY A;  5E79 Z;  2EX3 A;  5KHK A;  1NH2 B;  3ABL B;  1Y4M A;  1M4U A;  4UUJ C;  3WU2 Z;  5L3B A;  1DF5 A;  2WLI B;  3W7T A;  2R9I A;  2EIM B;  2OTJ V;  3X2Q C;  1K92 A;  2L6L A;  2WSS G;  4DR2 B;  2YC0 A;  2A79 B;  1XL6 A;  2H3O A;  1JCH A;  4BWA A;  2A06 H;  2VS0 A;  3KCX A;  3SJC C;  2CGN A;  1AI7 A;  1JMK C;  2ZR2 A;  1M1K W;  4LF5 B;  2P90 A;  4X20 A;  2HFE C;  3JCZ A;  3H01 A;  3ASO B;  1E79 G;  1SES A;  1GK9 A;  1R3I C;  1R3J C;  1AI5 A;  1LNQ A;  4TV8 A;  5IYB O;  3CWB H;  1GRJ A;  2GTS A;  3ASN C;  2WLN A;  4W4L A;  3L9D A;  4MW8 A;  2X6C A;  1PV0 A;  5LHG A;  2W6J G;  2YIA A;  3LDC A;  4H44 B;  2GTA A;  2DMX A;  3JAS B;  4JZG A;  4N23 A;  2QGN A;  4PJ0 Z;  2D3O W;  5TIS Z;  1UPG A;  5H6R A;  5JJE B;  2OIG A;  2BOB C;  3CXH F;  3RYI B;  5LHI A;  4OPH A;  4J11 A;  3AK3 A;  4GKK B;  2ZD9 A;  3OE7 G;  1JFF B;  1SQV H;  2PYL A;  3VQW A;  5LXT B;  1AJN A;  4CH4 A;  4FM0 A;  2ZE7 A;  2JEX A;  1I7F A;  1Y6X A;  3W7X A;  2Y69 B;  4GCZ A;  1N32 O;  1WPB A;  4UXN A;  3F7Y C;  1I5X A;  4WFA V;  3CB2 A;  4JTD B;  1HW7 A;  3G80 A;  4QE7 A;  3JAL A;  4B3S B;  3RYF B;  4FFB B;  1BHA A;  3K59 A;  3G67 A;  1XRE A;  3JD4 A;  3SJQ C;  1E1R G;  5LGT A;  2WAM A;  1NH2 D;  1AB3 A;  2ZIM A;  3ETE A;  5K1P A;  4D7T A;  4I9W A;  5J9P C;  3RGB A;  3CCJ V;  4I50 A;  4DR4 O;  1S76 D;  4CS2 A;  4JAA A;  4FLV A;  3BAA A;  5L3F A;  3QO7 A;  1R6T A;  4K0K B;  1OV9 A;  3P3N A;  2P06 A;  1V54 B;  4X64 O;  2PF4 E;  2KG7 A;  4EKW A;  5JJN B;  1FXV A;  2ARH A;  3T1Y B;  3IAY A;  2RJZ A;  3OFN G;  2E5L B;  4DV7 B;  4JI8 B;  3RYC B;  4O4L B;  4PA9 A;  1IBL O;  2HJD A;  3SJA C;  3UO2 A;  4EFE A;  2QA4 V;  1FXK C;  4RQE A;  2ZE6 A;  1ZUQ A;  3L72 H;  1XMO B;  1NJI W;  1K3E A;  4B7E A;  5KLV H;  1OCR C;  1V55 C;  4MVQ A;  5KA6 A;  5IYD O;  5J2T B;  4Z1M G;  2F95 B;  4NR1 A;  1Q7Y W;  1TUB B;  3OMI B;  2P4V A;  1YXB A;  1RP3 B;  1RFY A;  1Q6U A;  1YTF B;  1M56 C;  3GWK C;  2GDS A;  4U3F H;  2JS5 A;  1VQN V;  1HDJ A;  3K5O A;  1U96 A;  3LNM B;  1TA8 A;  4L87 A;  2X6B A;  5CBF A;  3SDL A;  3ABL C;  5LOV A;  3ZMZ A;  1QNM A;  2B1I A;  2F1M A;  4DR5 B;  2YUA A;  3CCL V;  1YVW A;  3A8T A;  3CYO A;  4YJ3 B;  1SET A;  3CMA V;  2B1G A;  3PN1 A;  4GZR B;  1FD9 A;  3AG3 B;  5GTH Z;  2EIM C;  3JD0 A;  2EIK C;  1H8H G;  1PPJ H;  1YDX A;  5KX5 B;  2UUA B;  4I5S A;  5EZY A;  3H1I H;  4FFK A;  5BMV B;  3A2F A;  4F4L A;  1HNX B;  2QJ1 A;  4X62 O;  2Q0O C;  4KHP O;  1IUR A;  1XNQ O;  1VQ4 V;  4JYC A;  4I55 A;  2GV9 A;  3B8M A;  1XBL A;  4TUY B;  1SA0 A;  5GON A;  5CA1 A;  5IYZ A;  3ASO C;  1LUV A;  3FB6 C;  2W0F C;  3CCQ V;  4X66 B;  2PY5 A;  3CCV V;  4ZHQ A;  3TJT A;  3WB2 A;  3JCU Z;  1BGY H;  3CCU V;  5LYJ A;  2YXL A;  4R7C A;  4GKJ O;  1GMG A;  2E74 B;  2LW1 A;  2BOC C;  2ZT9 B;  1XMQ B;  5IDJ A;  1JVM A;  3FYE B;  3HKB B;  3SR2 C;  2C2A A;  1MSD A;  4WBN B;  4DR1 B;  1R73 A;  4PA3 A;  4OX9 O;  3HR0 A;  1Y74 A;  3OM3 B;  1J5E B;  4GX0 A;  3JAR A;  4J7Z A;  2W6I G;  5BR8 B;  5KHJ A;  4BW5 A;  3LUT B;  5EYP A;  2YID A;  1TGO A;  4CC6 A;  3SYC A;  4IGG A;  3LSS A;  4J42 A;  1SF9 A;  1NTZ H;  1EN5 A;  5CA3 A;  2RNB A;  1KP2 A;  2PUS A;  4K8Z A;  4I7Z B;  3HKD A;  1DF4 A;  4FZ1 A;  2Y48 A;  3ZHU A;  1YJW V;  4ICG A;  1FFT B;  2EZO A;  4L8J A;  4BAY A;  1K5Q A;  4HNA A;  1BQZ A;  1URF A;  4DRX B;  4GLX A;  1RSO B;  4KFM A;  2DYR C;  3ZJZ A;  3KCY A;  4LNU B;  2HKO A;  3L75 H;  4DK0 A;  1R6K A;  1Z5V A;  1P7G A;  4FK5 C;  3ABU A;  5D5P A;  3FYI B;  2O57 A;  5ITZ A;  1WB7 A;  2VQE O;  2OWO A;  2Q67 A;  4LFC B;  3CC4 V;  1Q5O A;  1YTF D;  3OUF A;  4DV3 B;  3K0D A;  3C90 A;  3I55 V;  3MD0 A;  1FXH A;  2BTO A;  4ZOL A;  5IWA B;  2XOK G;  5J2U B;  4UCR A;  5KUM A;  4JI0 B;  4DW1 A;  3ZMV A;  2N05 A;  3CE2 A;  5FNV B;  1XOU A;  1P84 F;  3RWR D;  4AQY B;  1VF5 B;  4NXN B;  2Q4P A;  4LFA B;  3ZHQ A;  4IHJ B;  5LMU B;  1VQM V;  2RCV A;  1M5I A;  3K0G A;  2RMK B;  4QE9 A;  1K73 W;  3E86 A;  1JA8 A;  4UFZ A;  1UJW B;  4JI5 B;  3SGI A;  3B8P A;  1VQK V;  5LP6 B;  4DR6 B;  1NS1 A;  2WWW A;  1V54 C;  5C8Y A;  3JAT B;  1OCZ B;  4Q20 A;  3K5M A;  4JYA O;  3JYC A;  2R72 A;  2V1D A;  1YSC A;  5B1B B;  1YJ9 V;  4NTY A;  2UUB O;  4AI8 A;  2YXY A;  4LP8 A;  4I4T A;  3QO8 A;  4N21 A;  3EFF K;  3JAW B;  1YI2 V;  1K97 A;  2AHZ A;  2K9P A;  1PL4 A;  5CBG A;  1HP8 A;  1XEQ A;  3OEE G;  3CHX A;  2QTS A;  1AR1 B;  1EZJ A;  1NTK H;  2XHB A;  1KQS U;  1KKD A;  4W4K A;  1FS0 G;  3BA9 A;  4OXS A;  4XDL A;  2QWP B;  2UXB B;  4Q6G A;  2GBO A;  2WLI A;  1YZB A;  3BCC H;  3E8H A;  2LGQ A;  2P5O A;  3UT5 B;  4EB6 B;  4P30 A;  1AR5 A;  1EM1 A;  1S72 V;  1XNR O;  1NBM G;  3ZMS A;  2X0L A;  2ZNJ A;  1W59 A;  1COW G;  1Q8I A;  4MVZ A;  1P4R A;  4YY3 O;  1H2L A;  1ZAU A;  3B8N A;  1AIL A;  4PHZ A;  4DV2 B;  5DM6 V;  5KA5 A;  1WN7 A;  2K1E A;  3AG3 C;  4B3R O;  1AP6 A;  3K5N A;  2CDY A;  4FLU A;  3WFV A;  4R8C A;  3UKM A;  1S3J A;  2QM8 A;  2ZDI C;  3CPW U;  1YJN V;  4FM2 A;  4YXW G;  3SYA A;  1EZV H;  5H9C A;  4RUF A;  1L1F A;  4X62 B;  3CJH B;  1SQX H;  1WNS A;  1KU9 A;  3JAS A;  2H8P C;  3G4S V;  2Q7H A;  2ZCE A;  4UCS A;  2E75 B;  2AHY A;  5CMU A;  3T1H O;  1GM7 A;  2OTL V;  3HKE B;  4DV5 O;  2BTQ B;  4JI2 O;  5C93 A;  2CE4 A;  2FKX A;  3E2E A;  2YI8 A;  5EK0 A;  3K3W A;  4B7K A;  5H5N A;  4CS3 A;  1JFF A;  2H94 A;  3MHS C;  4JI1 B;  4I9Q A;  4FIP C;  1F4M A;  5EBM C;  2QWO B;  3E89 A;  4NTW A;  3ETQ A;  5JWP A;  3QF7 A;  2QWR B;  1I5Y A;  4DV0 O;  4TV9 B;  4UB6 Z;  4HAM A;  5D5Q A;  2NNU A;  2JJ1 G;  5EC1 C;  5CA0 A;  4B08 A;  1UFI A;  4FFB A;  1W0J G;  3ZIA G;  2P4K A;  1ARO P;  3T1C A;  3U10 A;  4IYI A;  3H1H H;  1BSM A;  2M6Y A;  1GN4 A;  1N8R W;  2NLJ C;  1QVG U;  1BT8 A;  1MZF A;  3J81 N;  4DUY O;  1KEC A;  5F2V O;  3S3W A;  3CRA A;  5A9G A;  1AJQ A;  1SKV A;  2EIK B;  3JAK B;  2UXN A;  5LA6 B;  3B4S A;  3HKC B;  5LGN A;  3SPG A;  2QR4 A;  4LF9 O;  4U3J B;  3SPJ A;  3VQX A;  3BEH A;  1ZTE A;  1B06 A;  1DK1 A;  3OR7 C;  4U7O A;  1US6 A;  1WP8 A;  1H2S B;  2ATK C;  2ZR3 A;  3FKS G;  3SYP A;  4O4L A;  3ZS8 C;  1KKC A;  3E83 A;  4PDR A;  2EIL C;  2UXD O;  3D36 C;  5LMN O;  2F4V B;  2MK3 A;  4YHH B;  2HVJ C;  4PDV A;  1JOY A;  1QLN A;  4B3M O;  5LP6 C;  4DW0 A;  2DYS C;  4LF4 B;  1N34 B;  1OCZ C;  2UUC B;  4WFB V;  3F5W C;  4E2H A;  4GT1 A;  4X1I B;  1TUE B;  2ZNI A;  5B1B C;  3RBZ A;  4FLY A;  5J2T A;  1IDS A;  4O2B A;  4DV4 O;  2GUZ B;  2WA4 A;  3W7U A;  1IZ3 A;  3K04 A;  2IJJ A;  1VIB A;  1TUB A;  3ZRS A;  2IH1 C;  4H0L B;  5K1X A;  3A0R A;  2YI9 A;  2Z3Y A;  4GX2 A;  1WP7 A;  2LFR A;  3B40 A;  3QG5 A;  1VQO V;  3K9S A;  1PNL A;  3WG7 B;  4O4H A;  3BVO A;  3CS5 A;  3ETD A;  2ZM6 O;  1VQ6 V;  1SZX A;  1I94 O;  2CAZ C;  4AHC A;  1F7Y A;  4LF7 O;  2Q5Z A;  4YIP A;  4YJ3 A;  3ZRW B;  2DYR B;  5IY5 B;  5JQG B;  5KX5 A;  1CP9 A;  3P30 A;  2OIE A;  5BMV A;  3PJS K;  3SYO A;  4B3T B;  1YEW A;  2W0X A;  3JAM N;  2ADQ B;  2DN9 A;  2HR3 A;  4NB5 A;  3W7W A;  2KSD A;  1FFX B;  1BL8 A;  2ILM A;  4JAS A;  3TXQ A;  4UB8 Z;  4TUY A;  3SYQ A;  3E22 B;  3TCU A;  4MTF A;  1BMF G;  5KHH A;  5IJ0 B;  1Z5W A;  1L8D A;  4G27 B;  1IBM B;  2JGD B;  2QM4 A;  1EBO A;  4JI6 O;  3DC5 A;  5LHH A;  3FAV B;  1NTM H;  3APQ A;  3THO A;  3K9A A;  5JH7 B;  2X6A A;  1O9H A;  4YJ2 B;  3HKB A;  4X9Q A;  4WBN A;  1VQ7 V;  4JTC B;  4X1Y B;  4JAU A;  4LF6 B;  4HZ3 A;  3OUS A;  4LF8 O;  2L35 A;  2BSK B;  1B04 A;  1KUQ A;  3I56 V;  4DR7 B;  4X65 B;  4LCU C;  2JEU A;  2ITD C;  4HYO A;  4CBC A;  3BAB A;  4R50 A;  5HFL A;  4DR3 O;  2ZXW B;  4JI3 B;  2HLD G;  1MAB G;  5L3E A;  3L73 H;  5KUK A;  3WB0 A;  4NYK A;  3DC6 A;  2KKW A;  3F7V C;  4WFF A;  4XDK A;  4UVA A;  1QLE B;  1N33 B;  4NXM B;  3BPZ A;  3CEI A;  4X20 B;  5LBQ A;  2QDO A;  4PA7 A;  3JSL A;  3L74 H;  4TV8 B;  2EIJ B;  1NR1 A;  5GW7 A;  2GHY A;  1YIT V;  4ZI7 B;  4BIU A;  4NTX A;  2JVD A;  2XUM A;  2VQF B;  4DV0 B;  3CCM V;  4JI7 B;  1PNM A;  4PI0 A;  5J2U A;  3VOU A;  3KG2 A;  3ZBH A;  4F6E A;  2XAG A;  3B09 A;  3D3I A;  3P32 A;  2YDE A;  5FNV A;  4NVP A;  5FPR A;  1V9P A;  2FYU H;  4IHJ A;  3FB5 C;  3SPC A;  3FB8 C;  1Q82 W;  3MAQ A;  1X4T A;  1WLE A;  1NI8 A;  5IE9 A;  3E8B A;  5LP6 A;  2LO1 A;  1KD1 W;  4MTX A;  1GO3 F;  3S3X A;  4IL6 Z;  1PL0 A;  4DUZ O;  4LF9 B;  3JAT A;  1DGS A;  1HR0 O;  2LQT A;  4H13 B;  1WA8 A;  4QPK A;  4E2C A;  1Y76 B;  4K35 A;  3ZHV A;  5BY1 A;  3EHB B;  3JAW A;  3T2M A;  1M57 B;  2FTK A;  3OD4 A;  4J7J A;  4DK1 A;  3JSN A;  1ZL8 B;  3TK1 A;  2OT5 A;  4DV1 O;  1XUQ A;  1N36 O;  2EIN C;  1GH6 A;  1JR9 A;  1BE3 H;  3AG1 B;  4RUE A;  3U11 A;  1P49 A;  4FJC C;  5LGU A;  1YF2 A;  4BW9 A;  3AG2 C;  2V4D A;  4ZBM A;  1K33 A;  3ZHS A;  1JX9 A;  1DTO A;  3UT5 A;  4EB6 A;  4JI4 O;  3WG7 C;  5KMG B;  4X1K B;  1OCO B;  2X7R B;  1GM8 A;  4J10 A;  3RW0 A;  4LC1 A;  1HNZ O;  4FVM A;  1D5A A;  4PA6 A;  3DXR B;  4JZ2 A;  1I94 B;  1ZX3 A;  3GB7 C;  5IY5 C;  1G6U A;  1I0H A;  2CUG A;  3E8F A;  3OMA B;  3CRC A;  3HPL C;  4BIZ A;  2CGO A;  3BRC A;  2UU9 O;  1N32 B;  4J7K A;  2CTP A;  1Q6H A;  3ZMU A;  4MVU A;  2ZKO A;  1NKD A;  4FLT A;  3CJH A;  2QKS A;  1XI1 A;  2DW4 A;  2XT9 A;  4O4I A;  3T4D A;  2WLH A;  1K4C C;  3HKE A;  3K06 A;  3TXS A;  2NR5 A;  3N2G B;  2BTQ A;  1JPX A;  4RWU A;  4DR2 O;  2ZIO A;  2XAQ A;  3QNE A;  4F6R B;  2E3C A;  2CK3 G;  2EIL B;  2HHH O;  3VBB A;  4DR4 B;  1VF6 C;  1FXK A;  4LF5 O;  5GTI Z;  1MOF A;  1VQL V;  5LOV B;  4WCE V;  2F93 B;  4MVO A;  2AW9 A;  2DYS B;  4UCV A;  2DOS A;  3G6E V;  3BA8 A;  4X64 B;  4QJF B;  1IVS A;  1AJP A;  1OCC B;  2RQ6 A;  3LSQ A;  2EJR A;  4JF3 A;  3LNN A;  2JDI G;  4TV9 A;  1FYJ A;  2ZXW C;  1FJG O;  4FPP A;  2RDC A;  3FFQ A;  1B6Q A;  2OYQ A;  3ZCC A;  3Q4H B;  3ETG A;  1VQP V;  2KQX A;  2WLL B;  3N2K B;  1AI4 A;  1IBL B;  2AZ0 A;  4FLW A;  4E29 A;  1PM9 A;  4GUN A;  1AP5 A;  2A9H A;  3FX7 A;  1MA1 A;  1QLE C;  1ZLZ A;  2RN9 A;  1Q6I A;  5CA1 B;  3OTF A;  4GKK O;  1EFR G;  1AVM A;  3CRM A;  2EIJ C;  2FML A;  4P9O A;  5LYJ B;  2XAS A;  3JAK A;  5LA6 A;  4JV5 O;  3HKC A;  2AGA A;  4JYB A;  4U3J A;  1F23 A;  3O9O A;  1XQ8 A;  2PYJ A;  3AK1 A;  2PTM A;  2WLM A;  4BIO A;  1MNG A;  3B8O A;  4ZKI A;  2QKC A;  1K34 A;  4ZIB A;  4FZ0 A;  3IJ4 A;  3M7M X;  2HEP A;  4B3S O;  5IJ9 B;  4PD4 F;  3K08 A;  2DJV A;  5EC2 C;  4IIJ B;  3CME V;  1SS3 A;  1X59 A;  2HJF C;  2YEV B;  3DSQ A;  5CB4 B;  4XDJ A;  1NU1 H;  3DGE A;  4KXR A;  1R6N A;  3WB1 A; 
#chains in the Genus database with same CATH homology
 1OCZ C;  1V55 C;  5B3S C;  3B77 A;  4MVQ A;  2IU3 A;  5KA6 A;  4WFB V;  3F5W C;  3OW2 U;  4E2H A;  4GT1 A;  2P7T C;  2Y69 C;  1TUE B;  3CXC U;  5B1B C;  1SZT A;  3RBZ A;  5IYD O;  5B1N A;  4Z1M G;  3STZ C;  1G8M A;  3W7U A;  1NVP B;  1S0V A;  3K04 A;  2IJJ A;  1Q7Y W;  1M57 C;  1OHH G;  4FMT A;  3OMI B;  2IH1 C;  3ZRS A;  3A0R A;  2Z3Y A;  1G4Y B;  4GX2 A;  1M56 C;  4MTG A;  1YTF B;  2LFR A;  3X2Q B;  4JAV A;  1THZ A;  1MG1 A;  4DXW A;  3CCE V;  3OR6 C;  1VQO V;  1PNL A;  3WG7 B;  1VQN V;  3ETD A;  1P7B A;  3LNM B;  1VQ6 V;  2PI4 A;  4L87 A;  2X6B A;  4MT8 A;  5CBF A;  4LBE C;  3AG1 C;  3ABL C;  1IXM A;  1K5S A;  3ZMZ A;  2B1I A;  5EBW C;  3CCL V;  1WPX A;  3ZRW A;  3CYO A;  3ZRW B;  2DYR B;  1SET A;  3CMA V;  2IH3 C;  1R3L C;  1DLB A;  2B1G A;  4GX5 A;  5IY5 B;  1S77 D;  3AG3 B;  4UVB A;  2GSM B;  2EIM C;  3JD0 A;  2EIK C;  3STL C;  3CCS V;  1H8H G;  1CP9 A;  5L3D A;  4I5S A;  3P30 A;  1QR9 A;  3ABK C;  2YSU B;  4UVC A;  3ASN B;  1M90 W;  1YHQ V;  3PJS K;  3FB7 C;  3SYO A;  2UXX A;  4F4L A;  3BY6 A;  4JGS A;  1RM1 B;  1ORQ C;  1ROP A;  1VQ4 V;  4ZM5 A;  2HR3 A;  2JIZ G;  4JYC A;  1OCO C;  3W7W A;  3B8M A;  4MVM A;  1BL8 A;  4TWK A;  4JAS A;  3SYQ A;  3TCU A;  4MTF A;  1BMF G;  5L3C A;  2Q69 A;  3CC2 V;  4G27 B;  4UV8 A;  4X89 A;  4ZM1 A;  3ASO C;  2M7W A;  4PDM A;  1EBO A;  3FB6 C;  2W0F C;  3CCQ V;  5LHH A;  3CCV V;  4PDL A;  4KUM A;  3IGA C;  4DO2 A;  3CCU V;  3SPI A;  4PA4 A;  4R7C A;  3K9A A;  4H33 A;  1GMG A;  2X6A A;  2BOC C;  5IDJ A;  1JVM A;  3FYE B;  1SER A;  2IJH A;  2C2A A;  3UM7 A;  2EBO A;  4MTO A;  3OGC C;  1R73 A;  1K4D C;  2DQ3 A;  3ML0 A;  4JTC B;  4PA3 A;  5CN0 A;  3OM3 B;  1VQ7 V;  4JAU A;  4GX0 A;  3SPH A;  4HZ3 A;  2W6I G;  2WLK A;  4H37 A;  3OUS A;  4BW5 A;  4WFG A;  3LUT B;  2HVK C;  4MVS A;  4RAI A;  3I56 V;  1QR8 A;  1H8E G;  4LCU C;  2JEU A;  3SYC A;  2EZP A;  3LSS A;  2ITD C;  4HYO A;  4CBC A;  4R50 A;  5HFL A;  2ZXW B;  5CA3 A;  4RQF A;  2HLD G;  1KP2 A;  1PKX A;  1MAB G;  5L3E A;  1W2B U;  1DF4 A;  5B1A C;  3GWO A;  5BZB A;  5KUK A;  4QIW F;  2Y48 A;  1YJW V;  3F7V C;  1FFT B;  1W0K G;  2EZO A;  4WFF A;  4XDK A;  4BAY A;  3AG4 C;  2EIN B;  1K5Q A;  4UVA A;  1QLE B;  1GTO A;  2Q6A A;  3IFX A;  3OMN B;  1H38 A;  4KFM A;  2DYR C;  2XAH A;  3ZJZ A;  5LBQ A;  4PA7 A;  2HKO A;  3CC7 V;  1OZ0 A;  2QEX V;  1R6K A;  1OCC C;  3G71 V;  1NVP D;  2EIJ B;  4FK5 C;  3ABU A;  2LP7 A;  3FYI B;  1NR1 A;  4MVR A;  3CCR V;  5GW7 A;  2GHY A;  3AG2 B;  4J9Y B;  1YIT V;  2Q67 A;  3CC4 V;  3CP1 A;  4BIU A;  1YTF D;  1JJ2 U;  1NQT A;  3OUF A;  2IJK A;  3K0D A;  3K03 A;  2ZQM A;  3CCM V;  3I55 V;  4QPJ A;  3AEI A;  3E35 A;  3MD0 A;  1FXH A;  1PNM A;  4E2L A;  3VOU A;  2XOK G;  3TET A;  3KG2 A;  5KUM A;  1Q86 W;  2XAG A;  3RVZ A;  3ZMV A;  3D3I A;  3P32 A;  4CZZ A;  4JPR A;  2F43 G;  4JTA B;  5HFM A;  2Z5U A;  1QVF U;  3DTU B;  4MSW C;  3T4Z A;  3OEH G;  1VQM V;  3FB5 C;  3K0G A;  3SPC A;  3FB8 C;  3OAA G;  2QE7 G;  3QO5 A;  4QE9 A;  5E1A C;  1Q82 W;  2LFS A;  1GM9 A;  1K73 W;  3E86 A;  1WLE A;  2IW5 A;  1VQ8 V;  1JQ0 A;  1FXK B;  2ZDI A;  3ZN1 A;  1UJW B;  3JD3 A;  3E8B A;  1PNK A;  2P6J A;  3B8P A;  1J95 A;  5IYC O;  1VQK V;  1KD1 W;  1S5H C;  1GO3 F;  2WWW A;  4MTX A;  4UV9 A;  1PL0 A;  1V54 C;  3ABM C;  2OCC B;  1OCR B;  1OCZ B;  1V55 B;  3JD1 A;  2WPD G;  4Q20 A;  5B3S B;  4ASU G;  3ABT A;  3MHH C;  3R65 A;  1BHB A;  4QPK A;  3JYC A;  1QBZ A;  2V1D A;  1YSC A;  1Y66 A;  2DWE C;  5B1B B;  1YJ9 V;  1KC8 W;  4E2C A;  3K79 A;  4LP8 A;  4X8A A;  3EHB B;  3QO8 A;  1Q81 W;  4N21 A;  3EFF K;  4WFH A;  3T2M A;  1M57 B;  1YI2 V;  1K97 A;  2AHZ A;  2FTK A;  3HB3 B;  5CBG A;  3TK1 A;  2OT5 A;  1M56 B;  3IC7 A;  2JK5 C;  3ZRV A;  2JJ2 G;  1KP3 A;  5H6Q A;  3OEE G;  1AR1 B;  1F51 A;  2EIN C;  1HWY A;  1EZJ A;  3AG1 B;  2DQ0 A;  4RUE A;  1NH2 B;  3ABL B;  1Y4M A;  1KQS U;  1KKD A;  4FJC C;  4UUJ C;  1FS0 G;  4OXS A;  4XDL A;  5LGU A;  5L3B A;  1DF5 A;  3M99 B;  2WLI A;  3AG2 C;  2WLI B;  3W7T A;  2R9I A;  4ZBM A;  2EIM B;  1K33 A;  2OTJ V;  1NR7 A;  3E8H A;  1JX9 A;  1DTO A;  3X2Q C;  1K92 A;  2ITC C;  2WLJ A;  4P30 A;  1F4N A;  2XND G;  1S72 V;  3WG7 C;  2WSS G;  1VQ9 V;  1NBM G;  3ZMS A;  2A79 B;  1XL6 A;  2X0L A;  1COW G;  1JCH A;  1OCO B;  2X7R B;  4MVZ A;  1P4R A;  5FL7 G;  1GM8 A;  3RW0 A;  4LC1 A;  3B8N A;  1AI7 A;  4PA6 A;  2ZR2 A;  2QM7 A;  1M1K W;  2P90 A;  2Q68 A;  4P2Z A;  3NXS A;  3ZMT A;  2HFE C;  2QTO A;  3JCZ A;  3H01 A;  5DM6 V;  3GB7 C;  3ASO B;  5KA5 A;  5IY5 C;  1E79 G;  1SES A;  1GK9 A;  1R3I C;  2K1E A;  3AG3 C;  1R3J C;  3E8F A;  3OMA B;  1AI5 A;  1LNQ A;  1PD3 A;  3HPL C;  5IYB O;  4BIZ A;  3WFV A;  4R8C A;  3UKM A;  2R9R B;  1S3J A;  3ASN C;  2QM8 A;  2ZDI C;  3CPW U;  1YJN V;  4YXW G;  3SYA A;  2WLN A;  4MW8 A;  2X6C A;  5H9C A;  1H2G A;  3ZMU A;  1RM1 C;  5LHG A;  4MVU A;  2W6J G;  4RUF A;  5B1O A;  3E8G A;  1L1F A;  3LDC A;  1NKD A;  2QKS A;  1ENV A;  2DWD C;  4MS2 A;  2DW4 A;  2H8P C;  3T4D A;  3G4S V;  2WLH A;  4N23 A;  2D3O W;  2AHY A;  5H6R A;  4J9Z B;  5CMU A;  1GM7 A;  1K4C C;  1VQ5 V;  3K06 A;  2OTL V;  1QCE A;  2BOB C;  4TT3 G;  4XBF A;  1JPX A;  5LHI A;  4GX1 A;  1XL4 A;  1K9M W;  5C93 A;  2PI5 A;  2XAQ A;  3QNE A;  3E2E A;  2ZD9 A;  2CK3 G;  5EK0 A;  3K3W A;  5EBL C;  2EIL B;  3D36 A;  4U7N A;  5B1A B;  3VBB A;  2HG5 C;  4KP4 A;  1FXK A;  3OE7 G;  4X88 A;  2H94 A;  3MHS C;  4TSF G;  1MOF A;  1AJN A;  1VQL V;  3AG4 B;  4QNH B;  1K7D A;  4WCE V;  4MVO A;  2DYS B;  4FIP C;  1F4M A;  3JD2 A;  2JEX A;  5EBM C;  4WFE A;  2B5U A;  4PEL A;  3W7X A;  3G6E V;  4WF9 V;  3E89 A;  2Y69 B;  4QJF B;  1AJP A;  4GCZ A;  1OCC B;  1SRY A;  3LSQ A;  2EJR A;  4UXN A;  4JF3 A;  3F7Y C;  1I5Y A;  1M9N A;  2JDI G;  3ZN0 A;  1I5X A;  4WFA V;  2ZXW C;  4FPP A;  4JTD B;  4HAM A;  2NNU A;  1B6Q A;  2JJ1 G;  3ZCC A;  4QE7 A;  3ETG A;  2IJI A;  2XAF A;  1VQP V;  5EC1 C;  2WLL A;  2WLL B;  1W0J G;  3ZIA G;  1BHA A;  1AI4 A;  1ARO P;  3T1C A;  3JD4 A;  1E1Q G;  4E29 A;  3RVY A;  5DN6 G;  3SJQ C;  1AI6 A;  1E1R G;  1GKF A;  2A9H A;  5LGT A;  2WAM A;  1NH2 D;  1QLE C;  2P67 A;  1N8R W;  1RPO A;  2NLJ C;  1QVG U;  3ETE A;  1KEC A;  4RO2 A;  1EFR G;  4I9W A;  2A0L A;  2EIJ C;  5J9P C;  2XAJ A;  3CCJ V;  4R6Z A;  4P9O A;  1S76 D;  1AJQ A;  1ZWI C;  2EIK B;  2XAS A;  2UXN A;  1CEZ A;  5LGN A;  3SPG A;  3ABK B;  4JYB A;  5L3F A;  1F23 A;  3LDE A;  3QO7 A;  2KB1 A;  4G2K A;  3SPJ A;  2V7Q G;  1V54 B;  1CPY A;  3ABM B;  2WLM A;  3BEH A;  1RPR A;  3B8O A;  4ZKI A;  4EKW A;  5L3G A;  1FXV A;  1K34 A;  3OR7 C;  4U7O A;  2IU0 A;  2ATK C;  3OFN G;  3CD6 V;  2ZR3 A;  3FKS G;  3SYP A;  1YIJ V;  3ZRX A;  3E83 A;  4PA9 A;  3K08 A;  4PDR A;  1R3K C;  4G28 B;  5EC2 C;  2EIL C;  3W7S A;  3CME V;  2MK3 A;  1MSW D;  2YEV A;  4P9P A;  2QA4 V;  2HVJ C;  2HJF C;  2YEV B;  1FXK C;  3LDD A;  4PDV A;  4RQE A;  1JOY A;  1QLN A;  1NJI W;  4XDJ A;  1K3E A;  5CBH A;  2DYS C;  3DGE A;  1K8A W;  4MW3 A;  1R6N A;  2OCC C;  1OCR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...