3B8NA

Structure of fepe- bacterial polysaccharide co-polymerase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
266
structure length
241
Chain Sequence
WTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAFNLFIKKFQSVSLLEEYLRSSPYVMDQLDLHRAIVALSEKMKAVDDSLYTSWTLSFTAPTSEEAQTVLSGYIDYISALVVKESIENVRNKLEIKTQFEKEKLAQDRIKMKNQLDANIQRLNYSLDIANAAGIKKPVYDPDFSISLGADGIERKLEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNFTPFKYQLSPSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacterial polysaccharide co-polymerases share a common framework for control of polymer length
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
molecule keywords Ferric enterobactin (Enterochelin) transport
total genus 84
structure length 241
sequence length 266
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2007-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3b8nA02
3.30.1890.10 Alpha Beta 2-Layer Sandwich Bacterial polysaccharide co-polymerase-like FepE-like 3b8nA01
5HFLA 2MK3A 4ZM1A 1DLBA 3B8MA 1MOFA 1DF5A 3M99B 4N21A 3CYOA 2EZOA 3H01A 1JPXA 3K9AA 3P30A 4JPRA 4E29A 4FJCC 2OT5A 1Y4MA 1EBOA 3B8PA 5CMUA 2EZPA 2P6JA 1QR8A 4N23A 3MHSC 3B8NA 1Y66A 3B8OA 2X7RB 4JGSA 1F23A 3MHHC 4JF3A 2LP7A 1SZTA 2EBOA 1QBZA 1K33A 1MG1A 5HFMA 3B77A 1K34A 4FIPC 4ZM5A 3CP1A 4FK5C 3WFVA 5H9CA 4G2KA 5KA6A 1QR9A 1JQ0A 4E2CA 1DF4A 4E2HA 1ENVA 1I5XA 2M7WA 5CN0A 3GWOA 4E2LA 5KA5A 1QCEA 1I5YA
chains in the Genus database with same CATH superfamily
5B66Z 3E35A 4X66O 2XHBA 3SYQA 1AR5A 1IVSA 2KG7B 1URFA 2JEUA 1Q86W 3MD0A 5KHHA 2EIKC 1BE3H 4YIOA 2ZXWC 1YF2A 2UUBB 3JD1A 1IZ3A 2OWOA 2PZSA 1FAFA 4YJ2A 1ZTEA 4Z1VA 4DV0B 1NR1A 1HW7A 3R66A 2Q9LA 1US6A 5LP6B 1YCIA 4IIJB 4WFAV 3UO2A 1J5EB 4TQDA 3JAWA 4PI0A 1H2KA 3C90A 3DC5A 1VQMV 4LWSB 2AGAA 4H33A 1OCRC 1NS1A 1FXKC 2EILC 4MW8A 1WP8A 3B8MA 3CMEV 5LHHA 1K4CC 5CMUA 2A0LA 4DXWA 1GRJA 1U96A 5KUKA 1YIJV 2R9IA 2GV9A 5A2QN 1N33O 1P49A 2QM7A 2Z3YA 1AJNA 3UM7A 3RWRD 4JAVA 1M1KW 4X65B 3L73H 5JJNB 3ZEDA 1N34B 4LNUB 4P9OA 3STZC 4EEQA 1SESA 4XDKA 1BHAA 4AQYB 4JI1O 1VARA 4DUYB 5LA6B 2YI9A 5IY5C 4G28B 3K79A 3D3IA 1VQ9V 3JARB 4E2CA 3FYIB 5IE9A 2GUZA 1OCCB 3E8GA 1S3JA 5LXTA 2YC0A 1N34O 2Q7HA 4H0LB 5LMNB 4F6EA 5DN6G 3E22A 2A9HA 4C7UA 4L8JA 1DTOA 1KMIZ 2YUAA 3QTCA 1WLEA 5ITZB 4TT3G 4GKKO 2F95B 3HR0A 3QO8A 2KG7A 4LF8O 5JCOA 4HNAB 2X0LA 3DSQA 1Q90D 4JI2O 2UXDB 2HG5C 4BW9A 1VQPV 1BZKA 1QLEC 2RNBA 4FLTA 5LMUB 1NH2D 1GH6A 1S5LZ 3O9OA 3L71H 1K9MW 3QF7A 4R6ZA 3IAYA 5BR8O 2P6JA 4K8XA 3BFRA 1Q6IA 4CH6A 1K33A 2IJJA 4MTFA 1PPJH 4MW3A 4MVOA 3DTUB 4X89A 2HEPA 2QEXV 3DXRB 2RCVA 1NTKH 2ZDIA 1IDSA 2UXNA 1KC8W 1KD1W 3T1YO 2YIAA 4QIWF 4DRXB 4GKJO 3ABMC 5FNVB 4GX5A 3ZHTA 2Y0IA 1FFTB 1SQBH 2P22C 3F7VC 2LGWA 2WA4A 3OR6C 3A0RA 2ZIOA 4LWSA 2DWEC 1L1FA 2A06H 4PA9A 3K5NA 2A7WA 4QE9A 3RBZA 1QLNA 1O9GA 4PHZA 3CCQV 1TVKA 1RM1B 2L6LA 3K59A 2AHYA 4TUYB 4DR3O 3IC9A 1EZJA 5IT9N 1L8DA 5JVDA 2OTJV 4FM2A 1LUVA 1V54C 1KECA 1L0NH 3JD2A 4GZRB 5CA1B 3CSXA 1NBMG 2UXBB 2E5LB 4MVMA 1JR9A 5K1PA 2BCCH 3JD4A 5B3SC 2YDEA 3ETGA 1MG1A 4AILC 2PYJA 1R3KC 4JAUA 4O4HB 1AI4A 1RPOA 1SERA 3HPLC 2RJZA 1R73A 1EN6A 1XHXA 2IJIA 4TV9A 2N04A 1RFYA 5E79Z 4DYLA 2ZQMA 4LFCO 4B3TB 4DR4O 4OPHA 4CH5A 1IBMB 1P4RA 4PDVA 2UU9B 4AI8A 2IH3C 1SZTA 1F51A 3K03A 1AR1B 3TETA 3M8AA 2ZE5A 5BMVB 3DGEA 3HKDA 2YIBA 2Q69A 2GTSA 2IM9A 2JVDA 4DUYO 1UJWB 4WFEA 1I08A 1VMGA 5EC1C 4IT5A 3CWBH 2OIGA 5CBGA 3K0GA 5IYZB 4MSWC 2BSKB 4PDLA 2LGQA 4JTDB 3UT5A 2XASA 3CRAA 1I5YA 4QE7A 3Q4HB 1D2DA 2YEVA 4GKKB 1T5EA 3LDCA 5JVDB 3DC6A 3AG4B 3RYFB 3TK1A 2DMXA 2F43G 3AG2C 5LGUA 3E22B 3FB8C 4DR5O 1XREA 4MTGA 3HKBB 1YXBA 4J9ZB 5KAIZ 3KZIZ 3X2QC 4GT1A 1MZFA 2F4VB 2E76B 4X1YB 3AK2A 2EJ7A 3GWKC 3E8BA 4MTOA 4JI0B 1DK1A 1XI1A 5LP6C 1Y66A 4WBNB 2HLDG 5L3DA 3ZCCA 5CA0B 1EZVH 3APQA 4ZOLA 4DV0O 3ETEA 1YJ9V 1ZX3A 2WLIA 3EXAA 4LF7O 3OTOB 4O2BB 1K8AW 1M57B 5JCOC 2F23A 2E75B 2F4VO 4LF5B 4HZ3A 3AG3B 1KKCA 2P67A 4XDLA 4DV6B 3OMIB 1TA8A 2GTAA 5KA6A 3WB0A 2B5UA 1B04A 3OMNB 4LH7A 2JGDB 4E2LA 3CC2V 1PV0A 4O4LA 4FLZA 4FLWA 4Q20A 1OCRB 2CTQA 3HKEA 5L3GA 1Y4MA 3G67A 2LW7A 4BIZA 1W0KG 1Z5VA 2GHYA 2VQFB 4I50B 4MVQA 1AP5A 1R6KA 3D36A 5LP6A 3E8HA 3S3XA 2OCCB 4FMTA 3ABTA 4X9QA 3UCSC 1R1BA 1K73W 5J9PC 3SPCA 1RM1C 2JS5A 3RVZA 1EBOA 1EN4A 4JI5B 4B3MB 4LF7B 1YJWV 2WLJA 1TUBB 3C3TA 2O57A 2UUCB 1HNXO 1Y74B 1W59A 1KYOF 3ZHVA 5LOVA 3CRRA 2BTQB 4AHCA 1BL8A 2CAZC 3KKYA 2K1EA 3RVYA 1FJGO 4WCEV 4JGSA 3A2FA 1NJIW 2ZDIC 4DR4B 3SYCA 2FKXA 4NTYA 4ZM5A 4UVCA 1DGSA 2A3QA 3W7XA 4CC6A 1V54B 1Y6XA 2VQEO 5EIBC 2EZOA 2ZNJA 3CXCU 1BQZA 1GN3A 1QU7A 4KL1A 5K1XA 2YIBD 3OE7G 1LUWA 3CP1A 1JFFA 2AZ0A 5EBLC 3NXSA 3OW2U 3N2GB 4WFBV 1FXKB 2EILB 2IW5A 5CN0A 1JFFB 3QO7A 1SF9A 1WA8A 3CS5A 4IHJA 3CCVV 4LF9B 1OHHG 1OV9A 4ASUG 1PD3A 5KX5B 3OMAB 3TXSA 4U7NA 2NN4A 4I55A 2V4DA 3OAAG 4TOIA 4ZKIA 2CGOA 1SC5B 4I4TA 2Q5ZA 1IURA 3JATB 3CCUV 3SPIA 2QR4A 4JZGA 2RN9A 1G1XB 4O4JA 3D3QA 3U10A 1UPGA 3B09A 1R3IC 3RYHB 4B3SB 3OTOO 3ZRVA 5LXTB 5A9GA 3ZRWB 2Z0AA 3WU2Z 1QHTA 1Y74A 5EBMC 1DLBA 2AHZA 1AILA 3LDEA 4MVZA 3CCSV 4N23A 3R65A 3MHSC 5JH7A 4UCRA 4X1KA 4Q6GA 2R9RB 1F23A 3QNEA 1WAZA 4YJ3A 1BQ0A 4DO2A 3AG1C 4LF9O 2ZT9B 4I7ZB 2ZIMA 4LF5O 2EIJB 3G71V 1FXVA 4Z1MG 4JI0O 4E4EA 2KQXA 3ABKC 4MT8A 3L70H 5IY5B 3CX5F 4FM0A 1NH2B 3GB7C 4LFCB 3M7MX 2CGNA 4IL6Z 4GX1A 1K5QA 5LYJA 3BPZA 2F66C 3ASNB 4BIUA 3KCXA 2DOSA 2VWJA 4X66B 2N74A 4QGPA 3BAAA 2Y69C 3H1KH 3OGCC 2WLLB 4K35A 3OEEG 1K3EA 1P7GA 2QGNA 4NXMB 2FTKA 5FL7G 1KKDA 5L3CA 4RQEA 4DW0A 1F7YA 4RAIA 4UV8A 3SJAC 3JALA 3CRCA 3STLC 3K04A 3F7YC 2RDCA 4D6TH 3O65A 5BZBA 3JALB 1N32O 1GM7A 4JI3B 3FAVB 3K5MA 3ZJZA 1Q43A 3ML0A 3SR2C 3OUFA 2ZINA 1VQNV 5HFLA 2YXLA 4PELA 2PTMA 3H01A 3CCLV 4QPKA 4F6RA 5BY1A 2IJKA 1K4DC 2IU3A 3AG7A 2JGUA 4UCUA 1EN5A 3IC7A 3OTFA 4IHJB 1N32B 1VQ7V 5JWPA 4JPRA 3PN1A 4I9WA 2NLJC 1XOUA 2YEVB 5KMGB 4UB8Z 1N0NA 2YIDA 4BAYA 4IGGA 4IYIA 4JZ2A 4X1KB 1HP8A 3ZMUA 3T1HO 1IBLB 4DR3B 4WF9V 2OYQA 2WWWA 2DYRB 3CEIA 3AG3C 4O2BA 2WLKA 3ASOB 1AROP 1OCCC 4JV5B 5EC2C 4KXRA 5IYZA 5CBFA 1FJGB 1FXKA 1GAXA 3WG7B 3ABLC 3H9VA 3P32A 4PA6A 3TGUH 4CH4A 2XNDG 1M57C 3RYHA 3CD6V 4DV6O 2XTAA 4KHPB 3H1HH 2Z5UA 2Q0OC 4JYAO 4U3JA 2EBOA 4UFZA 3AEIA 2GUZB 2W6IG 2KSDA 4GYCB 2QTOA 4EFEA 4OPAA 1XHZA 1GMGA 2PYLA 4CS2A 3ZMZA 3P30A 1H2LA 4L87A 4UXNA 2R70A 2QDOA 4B3SO 2H3OA 4DV7O 2UXCO 2QM8A 2YI8A 5KUMA 5FPRA 1SRYA 4MTXA 1Y76B 2GBOA 1QCEA 4D7TA 2UUAO 1OCOC 1ZWIC 3HKDB 2QWNB 3SJCC 2JK5C 3J80N 3BY6A 5LGNA 2Q4PA 1B3QA 4R8CA 4J7JA 4RUEA 1IX9A 2HHHO 5JH7B 4DV2B 5HFMA 1AJQA 4NVPA 3U11A 3D36C 2JDIG 1JA8A 3ASNC 3CJHA 4JAAA 5GTIZ 3OFNG 4WFGA 4YJ3B 5CA0A 5H6QA 3JCZA 3BRCA 3MDSA 5IYBO 1MMMA 1H8HG 2EIKB 3LNNA 4BR6A 3B8NA 1CEZA 2X6CA 3ZHSA 1H38A 2QJ1A 1NKDA 2QWPB 3JAMN 3E86A 3RYCB 3AG4C 4UV9A 1WNSA 4MVUA 3VBBA 3ZRWA 4WFHA 4O4LB 4DV4B 2IJHA 4E2HA 2GSMB 2PGGA 2ZNIA 4QJFB 2WLLA 3FX7A 3UQ8A 1BS3A 5KHGA 1HNZO 5FNVA 2BTOA 1H2NA 4NXNB 4I5SA 4I55B 4ZI7B 4J7ZA 4YIPA 2QKCA 2CTRA 1VQ6V 2W0XA 2BOCC 4ZBMA 3UT5B 3OM3B 4JASA 1XEQA 2QTSA 3FKSG 4FK5C 2OCCC 3RN4A 1E1RG 2R9AA 3JAKB 1DF4A 1NTZH 1NU1H 2N05A 1HR0B 2X6AA 4X64O 1XL4A 4JYYA 5H6RA 4JYCA 1PKXA 4LF6O 4NXNO 4NTWA 1IBKB 2Q8VA 2WA3A 2F93B 2OIEA 4X1IA 3SJQC 3UO3A 1IBMO 1GK9A 3ZRXA 4AQYO 2ARHA 4OXSA 4YY3O 2UU9O 2BSKA 2B1GA 1K7DA 4O4IB 3K9AA 3ZHUA 4JI3O 2DW4A 3LNMB 1YTFB 2EULA 3T2MA 1VQOV 2VWKA 5GONA 2PY5A 3HKCB 3RT3C 3IFXA 1HNWB 1I0HA 1K5SA 4X1YA 1K34A 2VQFO 2Q7EA 2Y69B 3WFVA 5H9CA 1JQ0A 1F4NA 3L75H 3B40A 1M93A 1MZEA 4BW5A 4K0KO 5LOVB 2HKOA 1AP6A 2CUGA 1XILA 1SA0B 4E29A 1WN7A 1TUBA 5LMNO 5JQGA 1KUQA 5B1AB 5KX5A 1XL6A 4O2AB 5B1OA 2BE3A 2P90A 3CHXA 1HNWO 1FS0G 2IBZH 3X2QB 4GKJB 1YI2V 3G6BA 4RO2A 2ATKC 4FFKA 1RPRA 4ZHQB 1M4UA 3I56V 1JPXA 2EJRA 5DECA 3T1HB 1M90W 5CBHA 2DQ3A 4JTCB 4LCUC 1PL0A 2YSUB 2VQEB 2QKAA 3HKEB 3RGBA 3LSQA 4B3MO 2D2CB 3LSSA 5D5PA 4FM1A 4ABMA 4H37A 3FB6C 1NI8A 2PF4E 3JAWB 5J2TA 1JX9A 1NTMH 2DWDC 2WLHA 3SGIA 2JJ1G 1M56B 1ZL8B 3ZIAG 2DYRC 1THZA 2BOBC 1AI6A 2NR5A 2FYUH 3K57A 4EB6A 2JJ2G 2B1IA 3GWOA 4DR1B 1SQXH 2JS3A 1KP2A 3IGAC 1H8EG 1VIBA 2EINC 4A5UB 4LP8A 1YDXA 5H5NA 4B3RB 1MNGA 2FMLA 3N2KA 1E1QG 3MHHC 4PI2A 1QBZA 4DR6B 1LR1A 4DUZB 3F5WC 4CZZA 3SPJA 3ZMSA 1QR9A 1QLEB 3SYAA 2E5LO 3B2EE 3CPWU 2XAGA 1Z2GA 3K3WA 3P3PA 3JYCA 5B3SB 4DK0A 1NVPD 5GONB 4JI6B 3U0ZA 4O2AA 4FZ1A 5LMUO 3K9SA 1BSMA 2X7RB 3D8CA 2JIZG 4ZHQA 3BA9A 4IYHA 4DR6O 3VOUA 2AZ2A 1XBLA 4B3TO 3W7SA 3E2EA 3ASOC 3L9DA 4N21A 1CP9A 5AG2A 1NR7A 3JCUZ 4JI4O 1I94O 2EIMC 2QSAA 5LA6A 1SZXA 3ABMB 4DR1O 2K9PA 4TUYA 2FL4A 1GM9A 4LNUA 3ZN0A 1O9HA 2MW2B 3BABA 4QPJA 1VQ8V 3H1LH 5EK0A 3K06A 3B4SA 1XQ8A 3W7WA 4W4LA 2WLIB 4UCOA 4EKWA 1FD9A 4X1IB 1E79G 4ZOLB 3T4ZA 4FPPA 2NNUA 2LW1A 2LQTA 4I9QA 1J95A 3K5LA 4JI8O 2LP7A 4WBNA 3VQWA 2ZR3A 1ORQC 3JD0A 4DV7B 3SDLA 2UXCB 1GM8A 2LO1A 2Q73A 5BMVA 3ZHQA 1WB8A 2AXTZ 3RW0A 3T1YB 2R72A 3I55V 4DV1O 1ZAUA 1XNQB 2LFSA 3JARA 3N2KB 1SS3A 2A79B 4IIJA 5ITZA 1SQGA 5IYCO 2ZXWB 4K0KB 4DR5B 5B5EZ 1OZ0A 4U3FH 5C93A 4TWKA 1R3JC 3B77A 4TV9B 4HBNA 4JI8B 1EFRG 3T1CA 2DE0X 4R50A 2Q6AA 2BTQA 3K08A 4FLUA 1ZL8A 1FYJA 2QWRB 4NYKA 1RSOB 1XNQO 5H2FZ 1COWG 1BT8A 4LF8B 4DR2O 3A0BZ 3OGIB 1H2GA 2D3OW 4FIPC 3ZBHA 4JI7O 1B6QA 1XDCA 2W0FC 4JI1B 4LF4O 3W7UA 2DYSC 1F4MA 3BHPA 3SJBC 5BR8B 4O4HA 3CCRV 3UKMA 1XNRO 1KP3A 2F1MA 2B9ZA 2KB1A 3OT7A 4JF3A 3HB3B 3CCEV 1VQ5V 3JD3A 5IWAO 4DR2B 1KU9A 1SA0A 1Q82W 4MVRA 3AK3A 3ABKB 2ADPA 4X62B 4NR1A 3J7AU 3B8PA 4CS3A 1HNXB 1AB3A 4XDJA 1MOFA 1QVGU 4DW1A 2CDYA 1M56C 1MA1A 1Q3EA 5B1BC 5GW7A 2RQ6A 2XAJA 1RSOA 3QVNA 4GX2A 1VQ4V 5TISZ 5L3FA 4KFMA 5J2TB 2YS8A 2XT9A 1XMOO 4JI6O 1DF5A 4HNAA 4BIOA 1YZBA 1K92A 1R6TA 4FLYA 2H94A 1Q6UA 2XAFA 3HKCA 3H1JH 4LBEC 1JJ2U 4WFFA 4X20A 3ZMVA 1TUEB 4G2KA 4UVBA 3JAKA 3ZS8C 3RYCA 4MVSA 4G27B 1P7BA 2PUSA 2WLMA 2IU0A 1G6UA 4P2ZA 2UXBO 3ABLB 4DV5B 1LNQA 1XMQO 1WB7A 3THOA 5JQGB 4KP4A 1S76D 4D7SA 5IJ0B 1AR4A 2ZE6A 4DV2O 5IJ9B 2P5OA 5JJJB 2ZM6B 1ENVA 2EINB 4U7OA 1IXBA 1YSCA 2HJFC 2PI5A 2OT5A 2ZE8A 2CK3G 2UUAB 3B8OA 2XAQA 3ZMTA 1NT2B 4ZI7A 4RWUA 4EB6B 3A8TA 2P4VA 5KHJA 3CB2A 1I7FA 4LFBB 3AG1B 1G8MA 2QM4A 2FB5A 3OD4A 1VQLV 1BGYH 1SETA 4ICGA 1AI5A 2KKWA 3CCJV 1IBLO 2VRZA 2LJ2A 2E74B 1KBHA 2L35A 1Q8IA 4FZ0A 4KUMA 3LUTB 2WAMA 4DR7B 2Y4TA 3AG2B 2DN9A 2VS0A 3MAQA 3BVOA 2IH1C 1A32A 4LFBO 4X88A 1HR0O 4DV4O 2ZD9A 4J7KA 1Z5WA 1N0JA 4UCSA 1GN4A 3SPGA 3JATA 3OEHG 1YTFD 3BCCH 1VF6C 4PJ0Z 4YJ2B 5EZYA 2MK3A 1N8RW 1S72V 2GDSA 2UUCO 4U3JB 3JASA 4B7EA 4X65O 1S5HC 1FFXA 2EIMB 3E89A 4YHHB 1XNRB 1S77D 2XUMA 4B08A 1JOYA 3N2GA 5CB4B 5B1BB 3BA8A 5EIBD 5C8YA 1WJZA 3RFRA 4I4TB 2ODMA 4UCTA 3JSNA 5DEDA 3CYOA 2YICA 3EFFK 2E3CA 1ZSPA 4HAMA 1SQVH 2Y0PA 4LF4B 4CC5A 4O4JB 5LHGA 5EYPB 3DXRA 3ICXA 1ZUQA 2DJVA 2ZR2A 2Q67A 2X6BA 3G4SV 1PM9A 2HR3A 1XMOB 1N33B 1P84F 2ITCC 4GLXA 5L3EA 1PNLA 2ILMA 2QA4V 1H2MA 1VQKV 1VEWA 3CE2A 3PJSK 4NXMO 4HYOA 5IWAB 4Z2WA 4F4LA 3GVMA 4LFAB 1MSWD 4RUFA 2PI4A 3SYPA 1H2SB 2CTPA 1MSDA 1OJHA 1Y67A 3ZX6A 1Q6HA 5E1AC 5LBQA 3CC4V 4DV3O 1JMKC 5BXZA 1YVWA 5KMGA 1XMQB 4JV5O 4DV1B 1N4CA 4TV8B 1SQFA 1L0LH 1GN2A 1U97A 4CH3A 3P3NA 4R7CA 1AI7A 4JYAB 3FAVA 1X59A 1JVMA 2P06A 5KA5A 4PA7A 2UXXA 1PNKA 3N27A 1M5IA 1IBKO 4JYBA 4LR3A 2QKSA 4FLVA 1OCOB 5LYJB 4H44B 2ZM6O 1BMFG 1V55C 1HDJA 3KG2A 4F6RB 3RYIA 1K97A 3ETDA 4P30A 1WPBA 1PP9H 3G80A 3VQVA 4I0XA 3JASB 1NVPB 4LFAO 1YITV 3K0DA 1VF7A 5CB4A 2EIJC 1W0JG 1FPOA 4CS4A 3E8FA 5J2UB 3IJ4A 2HP8A 5JJEB 4ZIBA 4LF6B 4PA4A 1FFXB 5IDJA 1TAEA 2HVJC 1J5EO 3RYIB 3CXHF 1S5JA 3QG5A 1V9PA 4QNHB 4J42A 1TGOA 1MABG 1Y76A 5CA3A 1G4YB 2P7TC 1QQCA 1PNMA 3OUSA 3G6EV 4NKGB 3CJHB 1Q81W 4DUZO 1XUQA 4GX0A 4FJCC 2YXHA 5L3BA 3W7TA 1D5AA 1YEWA 3E83A 3ZRSA 3T4DA 4PDMA 2V1DA 1BHBA 1AJPA 3EVKA 2XOKG 5KHKA 2DYSB 2ETNA 1VP7A 1VF6A 4I50A 1SQPH 1R6NA 2M6YA 1W2BU 2Q68A 2Q7GA 1WP7A 4B7KA 2WLNA 4CBCA 4PA3A 5IYDO 3APOA 1Q5OA 3L74H 3FD9A 2RMKB 3CRQA 4YHHO 2M7WA 3FYEB 1RP3B 4DV5O 3L72H 3AK1A 2YXYA 4J10A 3K5OA 3LDDA 1N36B 4P9PA 4O4IA 4KHPO 1M9NA 1WA8B 4PD4F 5IJ9A 4B3RO 2LFRA 2Y48A 5LHIA 2CTWA 3C3SA 3CCMV 3WB1A 1JJOA 1V55B 5KHIA 1GTOA 4TSFG 2AW9A 1QR8A 3CRMA 2WPDG 4RQFA 1SQQH 4NTXA 2HJDA 1VF5B 5B1AC 3VQYA 2CH7A 1QNMA 3Q4HA 4OGQB 1N36O 2JRIA 3M99B 4J9YB 1PL4A 1NQTA 3RYFA 4TQFA 5FPOA 2EZPA 1UFIA 4X64B 3SPHA 5CA1A 2ZCEA 4X62O 2ADQB 3LSUA 4JI4B 5J2UA 5EBWC 2V7QG 3FB7C 1KQSU 3WG7C 2EX3A 1YHQV 2H8PC 2OTLV 4EFBA 4LC1A 2QWOB 3OR7C 3QO5A 1TVKB 1GKFA 5EYPA 3TXQA 1EM1A 4UB6Z 4NB5A 5DM6V 4H13B 1ROPA 4DV3B 4J11A 4OX9B 3TCUA 3J81N 4UVAA 5GTHZ 5EZYB 1SKVA 1D5NA 2ITDC 2DQ0A 4GUNA 1NZ6A 1I94B 4YXWG 4I0XB 3NR7A 5IJ0A 4FVMA 4ZM1A 1HWYA 4JI2B 2UXDO 1IXMA 1X4TA 5F2VO 3H1IH 2ZE7A 4K3AA 4UCVA 2QWQB 1KB9F 5LGTA 3VQXA 4FLXA 2OCHA 2JEXA 4XBFA 3CMAV 2XAHA 2ZKOA 2Q0AA 2JGDA 4BWAA 1CPYA 2QE7G 2C2AA 4PDRA 4DK1A 3WB2A 2WSSG 1CXZB 1OCZC 1ZLZA 4X8AA 1HNZB 1GN6A 1WPXA 4UUJC 1I5XA 2Y4UA 5KAFZ 5KLVH 2CH7B 4PV1B 4W4KA 4OX9O 1FXHA 3CC7V 2G38A 4JI5O 3SYOA 3JSLA 1AVMA 3A0HZ 5FLXN 4J41A 4TV8A 4MS2A 3ZHRA 2CE4A 3BEHA 2HVKC 5LL6Y 5B1NA 4J80A 1FKAO 3I5DA 4FFBA 2W6JG 2P4KA 1R3LC 4FFBB 3F5TA 5C8YB 1BCCH 3ZN1A 1QVFU 3S3WA 1B06A 3ABUA 2HHHB 3EHBB 1Q7YW 4DRXA 3FFQA 1S0VA 3KCYA 1OCZB 1JCHA 2UUBO 4JI7B 4YY3B 1YJNV 1GO3F 4GCZA 3K58A 4K8ZA 3TJTA 3ETQA 4JTAB 3FB5C 4DR7O 3HKBA 2HFEC 4LH6A 5D5QA 4X20B
chains in the Genus database with same CATH topology
2HKOA 2MK3A 1BL8A 1N8RW 1S72V 3E35A 3SYQA 4E29A 2K1EA 3RVYA 1S5HC 2EIMB 2JEUA 3E89A 4WCEV 1Q86W 3MD0A 4JGSA 5B1AB 2EIKC 1S77D 1NJIW 1XL6A 5B1OA 2ZDIC 2ZXWC 3SYCA 2P90A 1JOYA 1FS0G 4UVCA 4ZM5A 3JD1A 5B1BB 3X2QB 1YI2V 3W7XA 1V54B 1NR1A 4RO2A 2ATKC 1RPRA 3CYOA 3I56V 2EZOA 1JPXA 2EJRA 3CXCU 1M90W 5CBHA 4WFAV 2DQ3A 3EFFK 4JTCB 4HAMA 4LCUC 3OE7G 1PL0A 2YSUB 5LHGA 3LSQA 3CP1A 5EBLC 3LSSA 1VQMV 2ZR2A 3NXSA 3OW2U 2Q67A 2X6BA 3G4SV 2HR3A 4WFBV 1FXKB 1OCRC 2EILB 2IW5A 2ITCC 3FB6C 4H37A 4H33A 5CN0A 5L3EA 1PNLA 3QO7A 2QA4V 1FXKC 2EILC 1VQKV 1JX9A 4MW8A 3CMEV 3B8MA 3PJSK 5LHHA 3CCVV 4HYOA 1OHHG 1K4CC 5CMUA 2A0LA 2DWDC 4DXWA 4F4LA 4ASUG 1PD3A 2WLHA 5KUKA 2R9IA 1YIJV 1MSWD 2JJ1G 1M56B 3OMAB 4RUFA 2QM7A 2Z3YA 3ZIAG 4U7NA 1AJNA 3SYPA 3UM7A 2DYRC 2PI4A 3OAAG 4JAVA 4ZKIA 1THZA 1M1KW 5E1AC 2BOBC 5LBQA 1AI6A 3CC4V 4P9OA 2JJ2G 2B1IA 3GWOA 3CCUV 3STZC 1KP2A 3IGAC 1H8EG 1SESA 3SPIA 2EINC 4XDKA 1BHAA 4LP8A 1E1QG 5IY5C 3MHHC 1R3IC 1QBZA 4G28B 3K79A 3D3IA 1VQ9V 3F5WC 4CZZA 3ZRVA 3SPJA 3ZMSA 4E2CA 1QR9A 4R7CA 1QLEB 1AI7A 3ZRWB 3FYIB 3SYAA 1JVMA 5KA5A 3E8GA 1OCCB 2UXXA 1PNKA 4PA7A 1S3JA 3CPWU 5EBMC 2XAGA 1DLBA 2AHZA 3LDEA 4JYBA 3K3WA 2QKSA 4MVZA 1OCOB 5DN6G 3JYCA 5B3SB 3CCSV 1NVPD 2A9HA 4N23A 1BMFG 1DTOA 3R65A 3MHSC 1V55C 1WLEA 3KG2A 2R9RB 2X7RB 1K97A 3ETDA 4TT3G 1F23A 4P30A 3QNEA 2JIZG 3QO8A 1NVPB 4DO2A 3AG1C 2X0LA 2EIJB 3G71V 1FXVA 3VOUA 2HG5C 4Z1MG 1VQPV 1YITV 3K0DA 2EIJC 1QLEC 3W7SA 3E2EA 3ASOC 1W0JG 4N21A 1NH2D 1CP9A 3ABKC 1NR7A 3E8FA 2EIMC 1K9MW 4MT8A 5IY5B 4R6ZA 4PA4A 5IDJA 3ABMB 2P6JA 2HVJC 1NH2B 3GB7C 4GX1A 1K5QA 4QNHB 1K33A 2IJJA 3ASNB 4MTFA 4BIUA 5CA3A 1MABG 1GM9A 3ZN0A 1G4YB 4MW3A 4MVOA 4QPJA 1VQ8V 2P7TC 3DTUB 2Y69C 3OGCC 5EK0A 2WLLB 1PNMA 3K06A 3OUSA 3OEEG 1K3EA 3G6EV 3W7WA 1Q81W 4X89A 2FTKA 2QEXV 2WLIB 5FL7G 1KKDA 4EKWA 5L3CA 4GX0A 1E79G 4RQEA 2ZDIA 4FJCC 3T4ZA 4RAIA 4UV8A 4FPPA 5L3BA 3W7TA 2NNUA 2UXNA 1KC8W 1KD1W 3E83A 3STLC 3K04A 4QIWF 1J95A 3ABMC 4GX5A 3ZRSA 3F7YC 3T4DA 2LP7A 1FFTB 2ZR3A 4PDMA 5BZBA 1ORQC 3F7VC 1GM7A 2V1DA 3JD0A 3ML0A 3OR6C 3A0RA 1GM8A 3ZJZA 1BHBA 1AJPA 2DWEC 3OUFA 1L1FA 4PA9A 2XOKG 4QE9A 3RBZA 1VQNV 3RW0A 3I55V 5HFLA 2DYSB 1QLNA 4PELA 2LFSA 3H01A 1R6NA 3CCLV 1W2BU 2A79B 4QPKA 2Q68A 2IJKA 1K4DC 2IU3A 3CCQV 1RM1B 5IYCO 2AHYA 2WLNA 2ZXWB 4CBCA 4PA3A 5IYDO 1OZ0A 1EZJA 5C93A 4TWKA 1R3JC 2OTJV 3B77A 1EFRG 3IC7A 1V54C 3T1CA 1KECA 4R50A 2M7WA 2Q6AA 3JD2A 3K08A 1VQ7V 3FYEB 1NBMG 4JPRA 4MVMA 4I9WA 1COWG 2NLJC 2YEVB 3JD4A 5B3SC 3LDDA 4BAYA 1H2GA 3ZMUA 3ETGA 1MG1A 2D3OW 4FIPC 1R3KC 4WF9V 4JAUA 4P9PA 2WWWA 2DYRB 3AG3C 2WLKA 3ASOB 1M9NA 1AI4A 1AROP 1B6QA 1RPOA 3HPLC 1SERA 1OCCC 2W0FC 3W7UA 1R73A 2DYSC 2LFRA 2IJIA 2Y48A 5EC2C 5LHIA 5CBFA 1FXKA 1F4MA 3CCMV 3CCRV 3WG7B 3ABLC 3UKMA 1V55B 3P32A 4PA6A 2ZQMA 2XNDG 1KP3A 1GTOA 1M57C 3CD6V 4TSFG 1QR8A 1P4RA 4PDVA 2Z5UA 2KB1A 4JF3A 3HB3B 2IH3C 3CCEV 1SZTA 2EBOA 2WPDG 1F51A 4RQFA 1VQ5V 3JD3A 3K03A 1AR1B 3AEIA 3TETA 3DGEA 5B1AC 1Q82W 2W6IG 4MVRA 3ABKB 2QTOA 2Q69A 3B8PA 1GMGA 4XDJA 1UJWB 3M99B 1MOFA 3ZMZA 4J9YB 1QVGU 3P30A 1NQTA 4L87A 4UXNA 1M56C 4WFEA 2EZPA 3SPHA 5EC1C 5B1BC 2QM8A 5GW7A 5CBGA 2XAJA 5KUMA 3K0GA 4MSWC 4PDLA 2V7QG 4GX2A 5EBWC 1VQ4V 3FB7C 5L3FA 1KQSU 1SRYA 4KFMA 4MTXA 3WG7C 4JTDB 1QCEA 2XASA 1YHQV 1I5YA 2H8PC 4QE7A 2OTLV 1OCOC 1ZWIC 4LC1A 1DF5A 2JK5C 3BY6A 3OR7C 5LGNA 3QO5A 2YEVA 4R8CA 1GKFA 3LDCA 1K92A 4RUEA 3AG4B 2H94A 2XAFA 3TK1A 5DM6V 2F43G 3AG2C 4LBEC 1ROPA 5LGUA 5HFMA 1AJQA 3TCUA 3FB8C 1JJ2U 4WFFA 4UVAA 4MTGA 3ZMVA 2JDIG 1TUEB 4G2KA 4J9ZB 3ASNC 4UVBA 2ITDC 2DQ0A 3X2QC 3OFNG 4YXWG 4WFGA 4GT1A 4ZM1A 1HWYA 4G27B 1P7BA 4MVSA 3JCZA 5H6QA 2WLMA 5IYBO 2IU0A 1IXMA 1H8HG 3E8BA 2EIKB 4P2ZA 4MTOA 3ABLB 3B8NA 1Y66A 1LNQA 2HLDG 5L3DA 1CEZA 2X6CA 1H38A 4KP4A 1S76D 1NKDA 3ZCCA 3E86A 5LGTA 3AG4C 4UV9A 4MVUA 3VBBA 3ZRWA 4WFHA 2JEXA 3ETEA 1YJ9V 2WLIA 4XBFA 3CMAV 2IJHA 2XAHA 4E2HA 2GSMB 1ENVA 2EINB 4U7OA 1K8AW 1M57B 4QJFB 2WLLA 1CPYA 2QE7G 2C2AA 1YSCA 4PDRA 2HJFC 2PI5A 2OT5A 4I5SA 2CK3G 2WSSG 3B8OA 1VQ6V 1OCZC 4HZ3A 2XAQA 3AG3B 2P67A 4XDLA 3ZMTA 2BOCC 4X8AA 4ZBMA 3OM3B 4JASA 3OMIB 3FKSG 4FK5C 2OCCC 5KA6A 1E1RG 1WPXA 2B5UA 1DF4A 3AG1B 3OMNB 4UUJC 1I5XA 1G8MA 4E2LA 3CC2V 1FXHA 3CC7V 1VQLV 1SETA 4Q20A 1OCRB 2X6AA 3SYOA 1AI5A 3CCJV 1XL4A 5L3GA 1Y4MA 5H6RA 4BIZA 4JYCA 1PKXA 1W0KG 2GHYA 4MS2A 4MVQA 3BEHA 2HVKC 4KUMA 3LUTB 2WAMA 5B1NA 1R6KA 3D36A 3E8HA 3AG2B 2W6JG 3SJQC 1R3LC 1GK9A 2OCCB 3ZRXA 4FMTA 4OXSA 3ABTA 2IH1C 3ZN1A 1QVFU 2B1GA 3ABUA 1K7DA 5J9PC 4X88A 1K73W 3K9AA 3SPCA 1RM1C 3EHBB 2DW4A 3LNMB 3RVZA 1Q7YW 1EBOA 1YTFB 2ZD9A 1S0VA 3T2MA 1OCZB 1VQOV 1YJWV 2WLJA 1JCHA 3IFXA 1K5SA 3SPGA 1YJNV 1GO3F 1K34A 3OEHG 1YTFD 4GCZA 2Y69B 3WFVA 5H9CA 4JTAB 1JQ0A 1F4NA 3FB5C 2HFEC 4BW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HFL A;  2MK3 A;  4ZM1 A;  1DLB A;  3B8M A;  1MOF A;  1DF5 A;  3M99 B;  4N21 A;  3CYO A;  2EZO A;  3H01 A;  1JPX A;  3K9A A;  3P30 A;  4JPR A;  4E29 A;  4FJC C;  2OT5 A;  1Y4M A;  1EBO A;  3B8P A;  5CMU A;  2EZP A;  2P6J A;  1QR8 A;  4N23 A;  3MHS C;  3B8N A;  1Y66 A;  3B8O A;  2X7R B;  4JGS A;  1F23 A;  3MHH C;  4JF3 A;  2LP7 A;  1SZT A;  2EBO A;  1QBZ A;  1K33 A;  1MG1 A;  5HFM A;  3B77 A;  1K34 A;  4FIP C;  4ZM5 A;  3CP1 A;  4FK5 C;  3WFV A;  5H9C A;  4G2K A;  5KA6 A;  1QR9 A;  1JQ0 A;  4E2C A;  1DF4 A;  4E2H A;  1ENV A;  1I5X A;  2M7W A;  5CN0 A;  3GWO A;  4E2L A;  5KA5 A;  1QCE A;  1I5Y A; 
#chains in the Genus database with same CATH topology
 5B66 Z;  3E35 A;  4X66 O;  2XHB A;  3SYQ A;  1AR5 A;  1IVS A;  2KG7 B;  1URF A;  2JEU A;  1Q86 W;  3MD0 A;  5KHH A;  2EIK C;  1BE3 H;  4YIO A;  2ZXW C;  1YF2 A;  2UUB B;  3JD1 A;  1IZ3 A;  2OWO A;  2PZS A;  1FAF A;  4YJ2 A;  1ZTE A;  4Z1V A;  4DV0 B;  1NR1 A;  1HW7 A;  3R66 A;  2Q9L A;  1US6 A;  5LP6 B;  1YCI A;  4IIJ B;  4WFA V;  3UO2 A;  1J5E B;  4TQD A;  3JAW A;  4PI0 A;  1H2K A;  3C90 A;  3DC5 A;  1VQM V;  4LWS B;  2AGA A;  4H33 A;  1OCR C;  1NS1 A;  1FXK C;  2EIL C;  4MW8 A;  1WP8 A;  3B8M A;  3CME V;  5LHH A;  1K4C C;  5CMU A;  2A0L A;  4DXW A;  1GRJ A;  1U96 A;  5KUK A;  1YIJ V;  2R9I A;  2GV9 A;  5A2Q N;  1N33 O;  1P49 A;  2QM7 A;  2Z3Y A;  1AJN A;  3UM7 A;  3RWR D;  4JAV A;  1M1K W;  4X65 B;  3L73 H;  5JJN B;  3ZED A;  1N34 B;  4LNU B;  4P9O A;  3STZ C;  4EEQ A;  1SES A;  4XDK A;  1BHA A;  4AQY B;  4JI1 O;  1VAR A;  4DUY B;  5LA6 B;  2YI9 A;  5IY5 C;  4G28 B;  3K79 A;  3D3I A;  1VQ9 V;  3JAR B;  4E2C A;  3FYI B;  5IE9 A;  2GUZ A;  1OCC B;  3E8G A;  1S3J A;  5LXT A;  2YC0 A;  1N34 O;  2Q7H A;  4H0L B;  5LMN B;  4F6E A;  5DN6 G;  3E22 A;  2A9H A;  4C7U A;  4L8J A;  1DTO A;  1KMI Z;  2YUA A;  3QTC A;  1WLE A;  5ITZ B;  4TT3 G;  4GKK O;  2F95 B;  3HR0 A;  3QO8 A;  2KG7 A;  4LF8 O;  5JCO A;  4HNA B;  2X0L A;  3DSQ A;  1Q90 D;  4JI2 O;  2UXD B;  2HG5 C;  4BW9 A;  1VQP V;  1BZK A;  1QLE C;  2RNB A;  4FLT A;  5LMU B;  1NH2 D;  1GH6 A;  1S5L Z;  3O9O A;  3L71 H;  1K9M W;  3QF7 A;  4R6Z A;  3IAY A;  5BR8 O;  2P6J A;  4K8X A;  3BFR A;  1Q6I A;  4CH6 A;  1K33 A;  2IJJ A;  4MTF A;  1PPJ H;  4MW3 A;  4MVO A;  3DTU B;  4X89 A;  2HEP A;  2QEX V;  3DXR B;  2RCV A;  1NTK H;  2ZDI A;  1IDS A;  2UXN A;  1KC8 W;  1KD1 W;  3T1Y O;  2YIA A;  4QIW F;  4DRX B;  4GKJ O;  3ABM C;  5FNV B;  4GX5 A;  3ZHT A;  2Y0I A;  1FFT B;  1SQB H;  2P22 C;  3F7V C;  2LGW A;  2WA4 A;  3OR6 C;  3A0R A;  2ZIO A;  4LWS A;  2DWE C;  1L1F A;  2A06 H;  4PA9 A;  3K5N A;  2A7W A;  4QE9 A;  3RBZ A;  1QLN A;  1O9G A;  4PHZ A;  3CCQ V;  1TVK A;  1RM1 B;  2L6L A;  3K59 A;  2AHY A;  4TUY B;  4DR3 O;  3IC9 A;  1EZJ A;  5IT9 N;  1L8D A;  5JVD A;  2OTJ V;  4FM2 A;  1LUV A;  1V54 C;  1KEC A;  1L0N H;  3JD2 A;  4GZR B;  5CA1 B;  3CSX A;  1NBM G;  2UXB B;  2E5L B;  4MVM A;  1JR9 A;  5K1P A;  2BCC H;  3JD4 A;  5B3S C;  2YDE A;  3ETG A;  1MG1 A;  4AIL C;  2PYJ A;  1R3K C;  4JAU A;  4O4H B;  1AI4 A;  1RPO A;  1SER A;  3HPL C;  2RJZ A;  1R73 A;  1EN6 A;  1XHX A;  2IJI A;  4TV9 A;  2N04 A;  1RFY A;  5E79 Z;  4DYL A;  2ZQM A;  4LFC O;  4B3T B;  4DR4 O;  4OPH A;  4CH5 A;  1IBM B;  1P4R A;  4PDV A;  2UU9 B;  4AI8 A;  2IH3 C;  1SZT A;  1F51 A;  3K03 A;  1AR1 B;  3TET A;  3M8A A;  2ZE5 A;  5BMV B;  3DGE A;  3HKD A;  2YIB A;  2Q69 A;  2GTS A;  2IM9 A;  2JVD A;  4DUY O;  1UJW B;  4WFE A;  1I08 A;  1VMG A;  5EC1 C;  4IT5 A;  3CWB H;  2OIG A;  5CBG A;  3K0G A;  5IYZ B;  4MSW C;  2BSK B;  4PDL A;  2LGQ A;  4JTD B;  3UT5 A;  2XAS A;  3CRA A;  1I5Y A;  4QE7 A;  3Q4H B;  1D2D A;  2YEV A;  4GKK B;  1T5E A;  3LDC A;  5JVD B;  3DC6 A;  3AG4 B;  3RYF B;  3TK1 A;  2DMX A;  2F43 G;  3AG2 C;  5LGU A;  3E22 B;  3FB8 C;  4DR5 O;  1XRE A;  4MTG A;  3HKB B;  1YXB A;  4J9Z B;  5KAI Z;  3KZI Z;  3X2Q C;  4GT1 A;  1MZF A;  2F4V B;  2E76 B;  4X1Y B;  3AK2 A;  2EJ7 A;  3GWK C;  3E8B A;  4MTO A;  4JI0 B;  1DK1 A;  1XI1 A;  5LP6 C;  1Y66 A;  4WBN B;  2HLD G;  5L3D A;  3ZCC A;  5CA0 B;  1EZV H;  3APQ A;  4ZOL A;  4DV0 O;  3ETE A;  1YJ9 V;  1ZX3 A;  2WLI A;  3EXA A;  4LF7 O;  3OTO B;  4O2B B;  1K8A W;  1M57 B;  5JCO C;  2F23 A;  2E75 B;  2F4V O;  4LF5 B;  4HZ3 A;  3AG3 B;  1KKC A;  2P67 A;  4XDL A;  4DV6 B;  3OMI B;  1TA8 A;  2GTA A;  5KA6 A;  3WB0 A;  2B5U A;  1B04 A;  3OMN B;  4LH7 A;  2JGD B;  4E2L A;  3CC2 V;  1PV0 A;  4O4L A;  4FLZ A;  4FLW A;  4Q20 A;  1OCR B;  2CTQ A;  3HKE A;  5L3G A;  1Y4M A;  3G67 A;  2LW7 A;  4BIZ A;  1W0K G;  1Z5V A;  2GHY A;  2VQF B;  4I50 B;  4MVQ A;  1AP5 A;  1R6K A;  3D36 A;  5LP6 A;  3E8H A;  3S3X A;  2OCC B;  4FMT A;  3ABT A;  4X9Q A;  3UCS C;  1R1B A;  1K73 W;  5J9P C;  3SPC A;  1RM1 C;  2JS5 A;  3RVZ A;  1EBO A;  1EN4 A;  4JI5 B;  4B3M B;  4LF7 B;  1YJW V;  2WLJ A;  1TUB B;  3C3T A;  2O57 A;  2UUC B;  1HNX O;  1Y74 B;  1W59 A;  1KYO F;  3ZHV A;  5LOV A;  3CRR A;  2BTQ B;  4AHC A;  1BL8 A;  2CAZ C;  3KKY A;  2K1E A;  3RVY A;  1FJG O;  4WCE V;  4JGS A;  3A2F A;  1NJI W;  2ZDI C;  4DR4 B;  3SYC A;  2FKX A;  4NTY A;  4ZM5 A;  4UVC A;  1DGS A;  2A3Q A;  3W7X A;  4CC6 A;  1V54 B;  1Y6X A;  2VQE O;  5EIB C;  2EZO A;  2ZNJ A;  3CXC U;  1BQZ A;  1GN3 A;  1QU7 A;  4KL1 A;  5K1X A;  2YIB D;  3OE7 G;  1LUW A;  3CP1 A;  1JFF A;  2AZ0 A;  5EBL C;  3NXS A;  3OW2 U;  3N2G B;  4WFB V;  1FXK B;  2EIL B;  2IW5 A;  5CN0 A;  1JFF B;  3QO7 A;  1SF9 A;  1WA8 A;  3CS5 A;  4IHJ A;  3CCV V;  4LF9 B;  1OHH G;  1OV9 A;  4ASU G;  1PD3 A;  5KX5 B;  3OMA B;  3TXS A;  4U7N A;  2NN4 A;  4I55 A;  2V4D A;  3OAA G;  4TOI A;  4ZKI A;  2CGO A;  1SC5 B;  4I4T A;  2Q5Z A;  1IUR A;  3JAT B;  3CCU V;  3SPI A;  2QR4 A;  4JZG A;  2RN9 A;  1G1X B;  4O4J A;  3D3Q A;  3U10 A;  1UPG A;  3B09 A;  1R3I C;  3RYH B;  4B3S B;  3OTO O;  3ZRV A;  5LXT B;  5A9G A;  3ZRW B;  2Z0A A;  3WU2 Z;  1QHT A;  1Y74 A;  5EBM C;  1DLB A;  2AHZ A;  1AIL A;  3LDE A;  4MVZ A;  3CCS V;  4N23 A;  3R65 A;  3MHS C;  5JH7 A;  4UCR A;  4X1K A;  4Q6G A;  2R9R B;  1F23 A;  3QNE A;  1WAZ A;  4YJ3 A;  1BQ0 A;  4DO2 A;  3AG1 C;  4LF9 O;  2ZT9 B;  4I7Z B;  2ZIM A;  4LF5 O;  2EIJ B;  3G71 V;  1FXV A;  4Z1M G;  4JI0 O;  4E4E A;  2KQX A;  3ABK C;  4MT8 A;  3L70 H;  5IY5 B;  3CX5 F;  4FM0 A;  1NH2 B;  3GB7 C;  4LFC B;  3M7M X;  2CGN A;  4IL6 Z;  4GX1 A;  1K5Q A;  5LYJ A;  3BPZ A;  2F66 C;  3ASN B;  4BIU A;  3KCX A;  2DOS A;  2VWJ A;  4X66 B;  2N74 A;  4QGP A;  3BAA A;  2Y69 C;  3H1K H;  3OGC C;  2WLL B;  4K35 A;  3OEE G;  1K3E A;  1P7G A;  2QGN A;  4NXM B;  2FTK A;  5FL7 G;  1KKD A;  5L3C A;  4RQE A;  4DW0 A;  1F7Y A;  4RAI A;  4UV8 A;  3SJA C;  3JAL A;  3CRC A;  3STL C;  3K04 A;  3F7Y C;  2RDC A;  4D6T H;  3O65 A;  5BZB A;  3JAL B;  1N32 O;  1GM7 A;  4JI3 B;  3FAV B;  3K5M A;  3ZJZ A;  1Q43 A;  3ML0 A;  3SR2 C;  3OUF A;  2ZIN A;  1VQN V;  5HFL A;  2YXL A;  4PEL A;  2PTM A;  3H01 A;  3CCL V;  4QPK A;  4F6R A;  5BY1 A;  2IJK A;  1K4D C;  2IU3 A;  3AG7 A;  2JGU A;  4UCU A;  1EN5 A;  3IC7 A;  3OTF A;  4IHJ B;  1N32 B;  1VQ7 V;  5JWP A;  4JPR A;  3PN1 A;  4I9W A;  2NLJ C;  1XOU A;  2YEV B;  5KMG B;  4UB8 Z;  1N0N A;  2YID A;  4BAY A;  4IGG A;  4IYI A;  4JZ2 A;  4X1K B;  1HP8 A;  3ZMU A;  3T1H O;  1IBL B;  4DR3 B;  4WF9 V;  2OYQ A;  2WWW A;  2DYR B;  3CEI A;  3AG3 C;  4O2B A;  2WLK A;  3ASO B;  1ARO P;  1OCC C;  4JV5 B;  5EC2 C;  4KXR A;  5IYZ A;  5CBF A;  1FJG B;  1FXK A;  1GAX A;  3WG7 B;  3ABL C;  3H9V A;  3P32 A;  4PA6 A;  3TGU H;  4CH4 A;  2XND G;  1M57 C;  3RYH A;  3CD6 V;  4DV6 O;  2XTA A;  4KHP B;  3H1H H;  2Z5U A;  2Q0O C;  4JYA O;  4U3J A;  2EBO A;  4UFZ A;  3AEI A;  2GUZ B;  2W6I G;  2KSD A;  4GYC B;  2QTO A;  4EFE A;  4OPA A;  1XHZ A;  1GMG A;  2PYL A;  4CS2 A;  3ZMZ A;  3P30 A;  1H2L A;  4L87 A;  4UXN A;  2R70 A;  2QDO A;  4B3S O;  2H3O A;  4DV7 O;  2UXC O;  2QM8 A;  2YI8 A;  5KUM A;  5FPR A;  1SRY A;  4MTX A;  1Y76 B;  2GBO A;  1QCE A;  4D7T A;  2UUA O;  1OCO C;  1ZWI C;  3HKD B;  2QWN B;  3SJC C;  2JK5 C;  3J80 N;  3BY6 A;  5LGN A;  2Q4P A;  1B3Q A;  4R8C A;  4J7J A;  4RUE A;  1IX9 A;  2HHH O;  5JH7 B;  4DV2 B;  5HFM A;  1AJQ A;  4NVP A;  3U11 A;  3D36 C;  2JDI G;  1JA8 A;  3ASN C;  3CJH A;  4JAA A;  5GTI Z;  3OFN G;  4WFG A;  4YJ3 B;  5CA0 A;  5H6Q A;  3JCZ A;  3BRC A;  3MDS A;  5IYB O;  1MMM A;  1H8H G;  2EIK B;  3LNN A;  4BR6 A;  3B8N A;  1CEZ A;  2X6C A;  3ZHS A;  1H38 A;  2QJ1 A;  1NKD A;  2QWP B;  3JAM N;  3E86 A;  3RYC B;  3AG4 C;  4UV9 A;  1WNS A;  4MVU A;  3VBB A;  3ZRW A;  4WFH A;  4O4L B;  4DV4 B;  2IJH A;  4E2H A;  2GSM B;  2PGG A;  2ZNI A;  4QJF B;  2WLL A;  3FX7 A;  3UQ8 A;  1BS3 A;  5KHG A;  1HNZ O;  5FNV A;  2BTO A;  1H2N A;  4NXN B;  4I5S A;  4I55 B;  4ZI7 B;  4J7Z A;  4YIP A;  2QKC A;  2CTR A;  1VQ6 V;  2W0X A;  2BOC C;  4ZBM A;  3UT5 B;  3OM3 B;  4JAS A;  1XEQ A;  2QTS A;  3FKS G;  4FK5 C;  2OCC C;  3RN4 A;  1E1R G;  2R9A A;  3JAK B;  1DF4 A;  1NTZ H;  1NU1 H;  2N05 A;  1HR0 B;  2X6A A;  4X64 O;  1XL4 A;  4JYY A;  5H6R A;  4JYC A;  1PKX A;  4LF6 O;  4NXN O;  4NTW A;  1IBK B;  2Q8V A;  2WA3 A;  2F93 B;  2OIE A;  4X1I A;  3SJQ C;  3UO3 A;  1IBM O;  1GK9 A;  3ZRX A;  4AQY O;  2ARH A;  4OXS A;  4YY3 O;  2UU9 O;  2BSK A;  2B1G A;  1K7D A;  4O4I B;  3K9A A;  3ZHU A;  4JI3 O;  2DW4 A;  3LNM B;  1YTF B;  2EUL A;  3T2M A;  1VQO V;  2VWK A;  5GON A;  2PY5 A;  3HKC B;  3RT3 C;  3IFX A;  1HNW B;  1I0H A;  1K5S A;  4X1Y A;  1K34 A;  2VQF O;  2Q7E A;  2Y69 B;  3WFV A;  5H9C A;  1JQ0 A;  1F4N A;  3L75 H;  3B40 A;  1M93 A;  1MZE A;  4BW5 A;  4K0K O;  5LOV B;  2HKO A;  1AP6 A;  2CUG A;  1XIL A;  1SA0 B;  4E29 A;  1WN7 A;  1TUB A;  5LMN O;  5JQG A;  1KUQ A;  5B1A B;  5KX5 A;  1XL6 A;  4O2A B;  5B1O A;  2BE3 A;  2P90 A;  3CHX A;  1HNW O;  1FS0 G;  2IBZ H;  3X2Q B;  4GKJ B;  1YI2 V;  3G6B A;  4RO2 A;  2ATK C;  4FFK A;  1RPR A;  4ZHQ B;  1M4U A;  3I56 V;  1JPX A;  2EJR A;  5DEC A;  3T1H B;  1M90 W;  5CBH A;  2DQ3 A;  4JTC B;  4LCU C;  1PL0 A;  2YSU B;  2VQE B;  2QKA A;  3HKE B;  3RGB A;  3LSQ A;  4B3M O;  2D2C B;  3LSS A;  5D5P A;  4FM1 A;  4ABM A;  4H37 A;  3FB6 C;  1NI8 A;  2PF4 E;  3JAW B;  5J2T A;  1JX9 A;  1NTM H;  2DWD C;  2WLH A;  3SGI A;  2JJ1 G;  1M56 B;  1ZL8 B;  3ZIA G;  2DYR C;  1THZ A;  2BOB C;  1AI6 A;  2NR5 A;  2FYU H;  3K57 A;  4EB6 A;  2JJ2 G;  2B1I A;  3GWO A;  4DR1 B;  1SQX H;  2JS3 A;  1KP2 A;  3IGA C;  1H8E G;  1VIB A;  2EIN C;  4A5U B;  4LP8 A;  1YDX A;  5H5N A;  4B3R B;  1MNG A;  2FML A;  3N2K A;  1E1Q G;  3MHH C;  4PI2 A;  1QBZ A;  4DR6 B;  1LR1 A;  4DUZ B;  3F5W C;  4CZZ A;  3SPJ A;  3ZMS A;  1QR9 A;  1QLE B;  3SYA A;  2E5L O;  3B2E E;  3CPW U;  2XAG A;  1Z2G A;  3K3W A;  3P3P A;  3JYC A;  5B3S B;  4DK0 A;  1NVP D;  5GON B;  4JI6 B;  3U0Z A;  4O2A A;  4FZ1 A;  5LMU O;  3K9S A;  1BSM A;  2X7R B;  3D8C A;  2JIZ G;  4ZHQ A;  3BA9 A;  4IYH A;  4DR6 O;  3VOU A;  2AZ2 A;  1XBL A;  4B3T O;  3W7S A;  3E2E A;  3ASO C;  3L9D A;  4N21 A;  1CP9 A;  5AG2 A;  1NR7 A;  3JCU Z;  4JI4 O;  1I94 O;  2EIM C;  2QSA A;  5LA6 A;  1SZX A;  3ABM B;  4DR1 O;  2K9P A;  4TUY A;  2FL4 A;  1GM9 A;  4LNU A;  3ZN0 A;  1O9H A;  2MW2 B;  3BAB A;  4QPJ A;  1VQ8 V;  3H1L H;  5EK0 A;  3K06 A;  3B4S A;  1XQ8 A;  3W7W A;  4W4L A;  2WLI B;  4UCO A;  4EKW A;  1FD9 A;  4X1I B;  1E79 G;  4ZOL B;  3T4Z A;  4FPP A;  2NNU A;  2LW1 A;  2LQT A;  4I9Q A;  1J95 A;  3K5L A;  4JI8 O;  2LP7 A;  4WBN A;  3VQW A;  2ZR3 A;  1ORQ C;  3JD0 A;  4DV7 B;  3SDL A;  2UXC B;  1GM8 A;  2LO1 A;  2Q73 A;  5BMV A;  3ZHQ A;  1WB8 A;  2AXT Z;  3RW0 A;  3T1Y B;  2R72 A;  3I55 V;  4DV1 O;  1ZAU A;  1XNQ B;  2LFS A;  3JAR A;  3N2K B;  1SS3 A;  2A79 B;  4IIJ A;  5ITZ A;  1SQG A;  5IYC O;  2ZXW B;  4K0K B;  4DR5 B;  5B5E Z;  1OZ0 A;  4U3F H;  5C93 A;  4TWK A;  1R3J C;  3B77 A;  4TV9 B;  4HBN A;  4JI8 B;  1EFR G;  3T1C A;  2DE0 X;  4R50 A;  2Q6A A;  2BTQ A;  3K08 A;  4FLU A;  1ZL8 A;  1FYJ A;  2QWR B;  4NYK A;  1RSO B;  1XNQ O;  5H2F Z;  1COW G;  1BT8 A;  4LF8 B;  4DR2 O;  3A0B Z;  3OGI B;  1H2G A;  2D3O W;  4FIP C;  3ZBH A;  4JI7 O;  1B6Q A;  1XDC A;  2W0F C;  4JI1 B;  4LF4 O;  3W7U A;  2DYS C;  1F4M A;  3BHP A;  3SJB C;  5BR8 B;  4O4H A;  3CCR V;  3UKM A;  1XNR O;  1KP3 A;  2F1M A;  2B9Z A;  2KB1 A;  3OT7 A;  4JF3 A;  3HB3 B;  3CCE V;  1VQ5 V;  3JD3 A;  5IWA O;  4DR2 B;  1KU9 A;  1SA0 A;  1Q82 W;  4MVR A;  3AK3 A;  3ABK B;  2ADP A;  4X62 B;  4NR1 A;  3J7A U;  3B8P A;  4CS3 A;  1HNX B;  1AB3 A;  4XDJ A;  1MOF A;  1QVG U;  4DW1 A;  2CDY A;  1M56 C;  1MA1 A;  1Q3E A;  5B1B C;  5GW7 A;  2RQ6 A;  2XAJ A;  1RSO A;  3QVN A;  4GX2 A;  1VQ4 V;  5TIS Z;  5L3F A;  4KFM A;  5J2T B;  2YS8 A;  2XT9 A;  1XMO O;  4JI6 O;  1DF5 A;  4HNA A;  4BIO A;  1YZB A;  1K92 A;  1R6T A;  4FLY A;  2H94 A;  1Q6U A;  2XAF A;  3HKC A;  3H1J H;  4LBE C;  1JJ2 U;  4WFF A;  4X20 A;  3ZMV A;  1TUE B;  4G2K A;  4UVB A;  3JAK A;  3ZS8 C;  3RYC A;  4MVS A;  4G27 B;  1P7B A;  2PUS A;  2WLM A;  2IU0 A;  1G6U A;  4P2Z A;  2UXB O;  3ABL B;  4DV5 B;  1LNQ A;  1XMQ O;  1WB7 A;  3THO A;  5JQG B;  4KP4 A;  1S76 D;  4D7S A;  5IJ0 B;  1AR4 A;  2ZE6 A;  4DV2 O;  5IJ9 B;  2P5O A;  5JJJ B;  2ZM6 B;  1ENV A;  2EIN B;  4U7O A;  1IXB A;  1YSC A;  2HJF C;  2PI5 A;  2OT5 A;  2ZE8 A;  2CK3 G;  2UUA B;  3B8O A;  2XAQ A;  3ZMT A;  1NT2 B;  4ZI7 A;  4RWU A;  4EB6 B;  3A8T A;  2P4V A;  5KHJ A;  3CB2 A;  1I7F A;  4LFB B;  3AG1 B;  1G8M A;  2QM4 A;  2FB5 A;  3OD4 A;  1VQL V;  1BGY H;  1SET A;  4ICG A;  1AI5 A;  2KKW A;  3CCJ V;  1IBL O;  2VRZ A;  2LJ2 A;  2E74 B;  1KBH A;  2L35 A;  1Q8I A;  4FZ0 A;  4KUM A;  3LUT B;  2WAM A;  4DR7 B;  2Y4T A;  3AG2 B;  2DN9 A;  2VS0 A;  3MAQ A;  3BVO A;  2IH1 C;  1A32 A;  4LFB O;  4X88 A;  1HR0 O;  4DV4 O;  2ZD9 A;  4J7K A;  1Z5W A;  1N0J A;  4UCS A;  1GN4 A;  3SPG A;  3JAT A;  3OEH G;  1YTF D;  3BCC H;  1VF6 C;  4PJ0 Z;  4YJ2 B;  5EZY A;  2MK3 A;  1N8R W;  1S72 V;  2GDS A;  2UUC O;  4U3J B;  3JAS A;  4B7E A;  4X65 O;  1S5H C;  1FFX A;  2EIM B;  3E89 A;  4YHH B;  1XNR B;  1S77 D;  2XUM A;  4B08 A;  1JOY A;  3N2G A;  5CB4 B;  5B1B B;  3BA8 A;  5EIB D;  5C8Y A;  1WJZ A;  3RFR A;  4I4T B;  2ODM A;  4UCT A;  3JSN A;  5DED A;  3CYO A;  2YIC A;  3EFF K;  2E3C A;  1ZSP A;  4HAM A;  1SQV H;  2Y0P A;  4LF4 B;  4CC5 A;  4O4J B;  5LHG A;  5EYP B;  3DXR A;  3ICX A;  1ZUQ A;  2DJV A;  2ZR2 A;  2Q67 A;  2X6B A;  3G4S V;  1PM9 A;  2HR3 A;  1XMO B;  1N33 B;  1P84 F;  2ITC C;  4GLX A;  5L3E A;  1PNL A;  2ILM A;  2QA4 V;  1H2M A;  1VQK V;  1VEW A;  3CE2 A;  3PJS K;  4NXM O;  4HYO A;  5IWA B;  4Z2W A;  4F4L A;  3GVM A;  4LFA B;  1MSW D;  4RUF A;  2PI4 A;  3SYP A;  1H2S B;  2CTP A;  1MSD A;  1OJH A;  1Y67 A;  3ZX6 A;  1Q6H A;  5E1A C;  5LBQ A;  3CC4 V;  4DV3 O;  1JMK C;  5BXZ A;  1YVW A;  5KMG A;  1XMQ B;  4JV5 O;  4DV1 B;  1N4C A;  4TV8 B;  1SQF A;  1L0L H;  1GN2 A;  1U97 A;  4CH3 A;  3P3N A;  4R7C A;  1AI7 A;  4JYA B;  3FAV A;  1X59 A;  1JVM A;  2P06 A;  5KA5 A;  4PA7 A;  2UXX A;  1PNK A;  3N27 A;  1M5I A;  1IBK O;  4JYB A;  4LR3 A;  2QKS A;  4FLV A;  1OCO B;  5LYJ B;  4H44 B;  2ZM6 O;  1BMF G;  1V55 C;  1HDJ A;  3KG2 A;  4F6R B;  3RYI A;  1K97 A;  3ETD A;  4P30 A;  1WPB A;  1PP9 H;  3G80 A;  3VQV A;  4I0X A;  3JAS B;  1NVP B;  4LFA O;  1YIT V;  3K0D A;  1VF7 A;  5CB4 A;  2EIJ C;  1W0J G;  1FPO A;  4CS4 A;  3E8F A;  5J2U B;  3IJ4 A;  2HP8 A;  5JJE B;  4ZIB A;  4LF6 B;  4PA4 A;  1FFX B;  5IDJ A;  1TAE A;  2HVJ C;  1J5E O;  3RYI B;  3CXH F;  1S5J A;  3QG5 A;  1V9P A;  4QNH B;  4J42 A;  1TGO A;  1MAB G;  1Y76 A;  5CA3 A;  1G4Y B;  2P7T C;  1QQC A;  1PNM A;  3OUS A;  3G6E V;  4NKG B;  3CJH B;  1Q81 W;  4DUZ O;  1XUQ A;  4GX0 A;  4FJC C;  2YXH A;  5L3B A;  3W7T A;  1D5A A;  1YEW A;  3E83 A;  3ZRS A;  3T4D A;  4PDM A;  2V1D A;  1BHB A;  1AJP A;  3EVK A;  2XOK G;  5KHK A;  2DYS B;  2ETN A;  1VP7 A;  1VF6 A;  4I50 A;  1SQP H;  1R6N A;  2M6Y A;  1W2B U;  2Q68 A;  2Q7G A;  1WP7 A;  4B7K A;  2WLN A;  4CBC A;  4PA3 A;  5IYD O;  3APO A;  1Q5O A;  3L74 H;  3FD9 A;  2RMK B;  3CRQ A;  4YHH O;  2M7W A;  3FYE B;  1RP3 B;  4DV5 O;  3L72 H;  3AK1 A;  2YXY A;  4J10 A;  3K5O A;  3LDD A;  1N36 B;  4P9P A;  4O4I A;  4KHP O;  1M9N A;  1WA8 B;  4PD4 F;  5IJ9 A;  4B3R O;  2LFR A;  2Y48 A;  5LHI A;  2CTW A;  3C3S A;  3CCM V;  3WB1 A;  1JJO A;  1V55 B;  5KHI A;  1GTO A;  4TSF G;  2AW9 A;  1QR8 A;  3CRM A;  2WPD G;  4RQF A;  1SQQ H;  4NTX A;  2HJD A;  1VF5 B;  5B1A C;  3VQY A;  2CH7 A;  1QNM A;  3Q4H A;  4OGQ B;  1N36 O;  2JRI A;  3M99 B;  4J9Y B;  1PL4 A;  1NQT A;  3RYF A;  4TQF A;  5FPO A;  2EZP A;  1UFI A;  4X64 B;  3SPH A;  5CA1 A;  2ZCE A;  4X62 O;  2ADQ B;  3LSU A;  4JI4 B;  5J2U A;  5EBW C;  2V7Q G;  3FB7 C;  1KQS U;  3WG7 C;  2EX3 A;  1YHQ V;  2H8P C;  2OTL V;  4EFB A;  4LC1 A;  2QWO B;  3OR7 C;  3QO5 A;  1TVK B;  1GKF A;  5EYP A;  3TXQ A;  1EM1 A;  4UB6 Z;  4NB5 A;  5DM6 V;  4H13 B;  1ROP A;  4DV3 B;  4J11 A;  4OX9 B;  3TCU A;  3J81 N;  4UVA A;  5GTH Z;  5EZY B;  1SKV A;  1D5N A;  2ITD C;  2DQ0 A;  4GUN A;  1NZ6 A;  1I94 B;  4YXW G;  4I0X B;  3NR7 A;  5IJ0 A;  4FVM A;  4ZM1 A;  1HWY A;  4JI2 B;  2UXD O;  1IXM A;  1X4T A;  5F2V O;  3H1I H;  2ZE7 A;  4K3A A;  4UCV A;  2QWQ B;  1KB9 F;  5LGT A;  3VQX A;  4FLX A;  2OCH A;  2JEX A;  4XBF A;  3CMA V;  2XAH A;  2ZKO A;  2Q0A A;  2JGD A;  4BWA A;  1CPY A;  2QE7 G;  2C2A A;  4PDR A;  4DK1 A;  3WB2 A;  2WSS G;  1CXZ B;  1OCZ C;  1ZLZ A;  4X8A A;  1HNZ B;  1GN6 A;  1WPX A;  4UUJ C;  1I5X A;  2Y4U A;  5KAF Z;  5KLV H;  2CH7 B;  4PV1 B;  4W4K A;  4OX9 O;  1FXH A;  3CC7 V;  2G38 A;  4JI5 O;  3SYO A;  3JSL A;  1AVM A;  3A0H Z;  5FLX N;  4J41 A;  4TV8 A;  4MS2 A;  3ZHR A;  2CE4 A;  3BEH A;  2HVK C;  5LL6 Y;  5B1N A;  4J80 A;  1FKA O;  3I5D A;  4FFB A;  2W6J G;  2P4K A;  1R3L C;  4FFB B;  3F5T A;  5C8Y B;  1BCC H;  3ZN1 A;  1QVF U;  3S3W A;  1B06 A;  3ABU A;  2HHH B;  3EHB B;  1Q7Y W;  4DRX A;  3FFQ A;  1S0V A;  3KCY A;  1OCZ B;  1JCH A;  2UUB O;  4JI7 B;  4YY3 B;  1YJN V;  1GO3 F;  4GCZ A;  3K58 A;  4K8Z A;  3TJT A;  3ETQ A;  4JTA B;  3FB5 C;  4DR7 O;  3HKB A;  2HFE C;  4LH6 A;  5D5Q A;  4X20 B; 
#chains in the Genus database with same CATH homology
 2HKO A;  2MK3 A;  1BL8 A;  1N8R W;  1S72 V;  3E35 A;  3SYQ A;  4E29 A;  2K1E A;  3RVY A;  1S5H C;  2EIM B;  2JEU A;  3E89 A;  4WCE V;  1Q86 W;  3MD0 A;  4JGS A;  5B1A B;  2EIK C;  1S77 D;  1NJI W;  1XL6 A;  5B1O A;  2ZDI C;  2ZXW C;  3SYC A;  2P90 A;  1JOY A;  1FS0 G;  4UVC A;  4ZM5 A;  3JD1 A;  5B1B B;  3X2Q B;  1YI2 V;  3W7X A;  1V54 B;  1NR1 A;  4RO2 A;  2ATK C;  1RPR A;  3CYO A;  3I56 V;  2EZO A;  1JPX A;  2EJR A;  3CXC U;  1M90 W;  5CBH A;  4WFA V;  2DQ3 A;  3EFF K;  4JTC B;  4HAM A;  4LCU C;  3OE7 G;  1PL0 A;  2YSU B;  5LHG A;  3LSQ A;  3CP1 A;  5EBL C;  3LSS A;  1VQM V;  2ZR2 A;  3NXS A;  3OW2 U;  2Q67 A;  2X6B A;  3G4S V;  2HR3 A;  4WFB V;  1FXK B;  1OCR C;  2EIL B;  2IW5 A;  2ITC C;  3FB6 C;  4H37 A;  4H33 A;  5CN0 A;  5L3E A;  1PNL A;  3QO7 A;  2QA4 V;  1FXK C;  2EIL C;  1VQK V;  1JX9 A;  4MW8 A;  3CME V;  3B8M A;  3PJS K;  5LHH A;  3CCV V;  4HYO A;  1OHH G;  1K4C C;  5CMU A;  2A0L A;  2DWD C;  4DXW A;  4F4L A;  4ASU G;  1PD3 A;  2WLH A;  5KUK A;  2R9I A;  1YIJ V;  1MSW D;  2JJ1 G;  1M56 B;  3OMA B;  4RUF A;  2QM7 A;  2Z3Y A;  3ZIA G;  4U7N A;  1AJN A;  3SYP A;  3UM7 A;  2DYR C;  2PI4 A;  3OAA G;  4JAV A;  4ZKI A;  1THZ A;  1M1K W;  5E1A C;  2BOB C;  5LBQ A;  1AI6 A;  3CC4 V;  4P9O A;  2JJ2 G;  2B1I A;  3GWO A;  3CCU V;  3STZ C;  1KP2 A;  3IGA C;  1H8E G;  1SES A;  3SPI A;  2EIN C;  4XDK A;  1BHA A;  4LP8 A;  1E1Q G;  5IY5 C;  3MHH C;  1R3I C;  1QBZ A;  4G28 B;  3K79 A;  3D3I A;  1VQ9 V;  3F5W C;  4CZZ A;  3ZRV A;  3SPJ A;  3ZMS A;  4E2C A;  1QR9 A;  4R7C A;  1QLE B;  1AI7 A;  3ZRW B;  3FYI B;  3SYA A;  1JVM A;  5KA5 A;  3E8G A;  1OCC B;  2UXX A;  1PNK A;  4PA7 A;  1S3J A;  3CPW U;  5EBM C;  2XAG A;  1DLB A;  2AHZ A;  3LDE A;  4JYB A;  3K3W A;  2QKS A;  4MVZ A;  1OCO B;  5DN6 G;  3JYC A;  5B3S B;  3CCS V;  1NVP D;  2A9H A;  4N23 A;  1BMF G;  1DTO A;  3R65 A;  3MHS C;  1V55 C;  1WLE A;  3KG2 A;  2R9R B;  2X7R B;  1K97 A;  3ETD A;  4TT3 G;  1F23 A;  4P30 A;  3QNE A;  2JIZ G;  3QO8 A;  1NVP B;  4DO2 A;  3AG1 C;  2X0L A;  2EIJ B;  3G71 V;  1FXV A;  3VOU A;  2HG5 C;  4Z1M G;  1VQP V;  1YIT V;  3K0D A;  2EIJ C;  1QLE C;  3W7S A;  3E2E A;  3ASO C;  1W0J G;  4N21 A;  1NH2 D;  1CP9 A;  3ABK C;  1NR7 A;  3E8F A;  2EIM C;  1K9M W;  4MT8 A;  5IY5 B;  4R6Z A;  4PA4 A;  5IDJ A;  3ABM B;  2P6J A;  2HVJ C;  1NH2 B;  3GB7 C;  4GX1 A;  1K5Q A;  4QNH B;  1K33 A;  2IJJ A;  3ASN B;  4MTF A;  4BIU A;  5CA3 A;  1MAB G;  1GM9 A;  3ZN0 A;  1G4Y B;  4MW3 A;  4MVO A;  4QPJ A;  1VQ8 V;  2P7T C;  3DTU B;  2Y69 C;  3OGC C;  5EK0 A;  2WLL B;  1PNM A;  3K06 A;  3OUS A;  3OEE G;  1K3E A;  3G6E V;  3W7W A;  1Q81 W;  4X89 A;  2FTK A;  2QEX V;  2WLI B;  5FL7 G;  1KKD A;  4EKW A;  5L3C A;  4GX0 A;  1E79 G;  4RQE A;  2ZDI A;  4FJC C;  3T4Z A;  4RAI A;  4UV8 A;  4FPP A;  5L3B A;  3W7T A;  2NNU A;  2UXN A;  1KC8 W;  1KD1 W;  3E83 A;  3STL C;  3K04 A;  4QIW F;  1J95 A;  3ABM C;  4GX5 A;  3ZRS A;  3F7Y C;  3T4D A;  2LP7 A;  1FFT B;  2ZR3 A;  4PDM A;  5BZB A;  1ORQ C;  3F7V C;  1GM7 A;  2V1D A;  3JD0 A;  3ML0 A;  3OR6 C;  3A0R A;  1GM8 A;  3ZJZ A;  1BHB A;  1AJP A;  2DWE C;  3OUF A;  1L1F A;  4PA9 A;  2XOK G;  4QE9 A;  3RBZ A;  1VQN V;  3RW0 A;  3I55 V;  5HFL A;  2DYS B;  1QLN A;  4PEL A;  2LFS A;  3H01 A;  1R6N A;  3CCL V;  1W2B U;  2A79 B;  4QPK A;  2Q68 A;  2IJK A;  1K4D C;  2IU3 A;  3CCQ V;  1RM1 B;  5IYC O;  2AHY A;  2WLN A;  2ZXW B;  4CBC A;  4PA3 A;  5IYD O;  1OZ0 A;  1EZJ A;  5C93 A;  4TWK A;  1R3J C;  2OTJ V;  3B77 A;  1EFR G;  3IC7 A;  1V54 C;  3T1C A;  1KEC A;  4R50 A;  2M7W A;  2Q6A A;  3JD2 A;  3K08 A;  1VQ7 V;  3FYE B;  1NBM G;  4JPR A;  4MVM A;  4I9W A;  1COW G;  2NLJ C;  2YEV B;  3JD4 A;  5B3S C;  3LDD A;  4BAY A;  1H2G A;  3ZMU A;  3ETG A;  1MG1 A;  2D3O W;  4FIP C;  1R3K C;  4WF9 V;  4JAU A;  4P9P A;  2WWW A;  2DYR B;  3AG3 C;  2WLK A;  3ASO B;  1M9N A;  1AI4 A;  1ARO P;  1B6Q A;  1RPO A;  3HPL C;  1SER A;  1OCC C;  2W0F C;  3W7U A;  1R73 A;  2DYS C;  2LFR A;  2IJI A;  2Y48 A;  5EC2 C;  5LHI A;  5CBF A;  1FXK A;  1F4M A;  3CCM V;  3CCR V;  3WG7 B;  3ABL C;  3UKM A;  1V55 B;  3P32 A;  4PA6 A;  2ZQM A;  2XND G;  1KP3 A;  1GTO A;  1M57 C;  3CD6 V;  4TSF G;  1QR8 A;  1P4R A;  4PDV A;  2Z5U A;  2KB1 A;  4JF3 A;  3HB3 B;  2IH3 C;  3CCE V;  1SZT A;  2EBO A;  2WPD G;  1F51 A;  4RQF A;  1VQ5 V;  3JD3 A;  3K03 A;  1AR1 B;  3AEI A;  3TET A;  3DGE A;  5B1A C;  1Q82 W;  2W6I G;  4MVR A;  3ABK B;  2QTO A;  2Q69 A;  3B8P A;  1GMG A;  4XDJ A;  1UJW B;  3M99 B;  1MOF A;  3ZMZ A;  4J9Y B;  1QVG U;  3P30 A;  1NQT A;  4L87 A;  4UXN A;  1M56 C;  4WFE A;  2EZP A;  3SPH A;  5EC1 C;  5B1B C;  2QM8 A;  5GW7 A;  5CBG A;  2XAJ A;  5KUM A;  3K0G A;  4MSW C;  4PDL A;  2V7Q G;  4GX2 A;  5EBW C;  1VQ4 V;  3FB7 C;  5L3F A;  1KQS U;  1SRY A;  4KFM A;  4MTX A;  3WG7 C;  4JTD B;  1QCE A;  2XAS A;  1YHQ V;  1I5Y A;  2H8P C;  4QE7 A;  2OTL V;  1OCO C;  1ZWI C;  4LC1 A;  1DF5 A;  2JK5 C;  3BY6 A;  3OR7 C;  5LGN A;  3QO5 A;  2YEV A;  4R8C A;  1GKF A;  3LDC A;  1K92 A;  4RUE A;  3AG4 B;  2H94 A;  2XAF A;  3TK1 A;  5DM6 V;  2F43 G;  3AG2 C;  4LBE C;  1ROP A;  5LGU A;  5HFM A;  1AJQ A;  3TCU A;  3FB8 C;  1JJ2 U;  4WFF A;  4UVA A;  4MTG A;  3ZMV A;  2JDI G;  1TUE B;  4G2K A;  4J9Z B;  3ASN C;  4UVB A;  2ITD C;  2DQ0 A;  3X2Q C;  3OFN G;  4YXW G;  4WFG A;  4GT1 A;  4ZM1 A;  1HWY A;  4G27 B;  1P7B A;  4MVS A;  3JCZ A;  5H6Q A;  2WLM A;  5IYB O;  2IU0 A;  1IXM A;  1H8H G;  3E8B A;  2EIK B;  4P2Z A;  4MTO A;  3ABL B;  3B8N A;  1Y66 A;  1LNQ A;  2HLD G;  5L3D A;  1CEZ A;  2X6C A;  1H38 A;  4KP4 A;  1S76 D;  1NKD A;  3ZCC A;  3E86 A;  5LGT A;  3AG4 C;  4UV9 A;  4MVU A;  3VBB A;  3ZRW A;  4WFH A;  2JEX A;  3ETE A;  1YJ9 V;  2WLI A;  4XBF A;  3CMA V;  2IJH A;  2XAH A;  4E2H A;  2GSM B;  1ENV A;  2EIN B;  4U7O A;  1K8A W;  1M57 B;  4QJF B;  2WLL A;  1CPY A;  2QE7 G;  2C2A A;  1YSC A;  4PDR A;  2HJF C;  2PI5 A;  2OT5 A;  4I5S A;  2CK3 G;  2WSS G;  3B8O A;  1VQ6 V;  1OCZ C;  4HZ3 A;  2XAQ A;  3AG3 B;  2P67 A;  4XDL A;  3ZMT A;  2BOC C;  4X8A A;  4ZBM A;  3OM3 B;  4JAS A;  3OMI B;  3FKS G;  4FK5 C;  2OCC C;  5KA6 A;  1E1R G;  1WPX A;  2B5U A;  1DF4 A;  3AG1 B;  3OMN B;  4UUJ C;  1I5X A;  1G8M A;  4E2L A;  3CC2 V;  1FXH A;  3CC7 V;  1VQL V;  1SET A;  4Q20 A;  1OCR B;  2X6A A;  3SYO A;  1AI5 A;  3CCJ V;  1XL4 A;  5L3G A;  1Y4M A;  5H6R A;  4BIZ A;  4JYC A;  1PKX A;  1W0K G;  2GHY A;  4MS2 A;  4MVQ A;  3BEH A;  2HVK C;  4KUM A;  3LUT B;  2WAM A;  5B1N A;  1R6K A;  3D36 A;  3E8H A;  3AG2 B;  2W6J G;  3SJQ C;  1R3L C;  1GK9 A;  2OCC B;  3ZRX A;  4FMT A;  4OXS A;  3ABT A;  2IH1 C;  3ZN1 A;  1QVF U;  2B1G A;  3ABU A;  1K7D A;  5J9P C;  4X88 A;  1K73 W;  3K9A A;  3SPC A;  1RM1 C;  3EHB B;  2DW4 A;  3LNM B;  3RVZ A;  1Q7Y W;  1EBO A;  1YTF B;  2ZD9 A;  1S0V A;  3T2M A;  1OCZ B;  1VQO V;  1YJW V;  2WLJ A;  1JCH A;  3IFX A;  1K5S A;  3SPG A;  1YJN V;  1GO3 F;  1K34 A;  3OEH G;  1YTF D;  4GCZ A;  2Y69 B;  3WFV A;  5H9C A;  4JTA B;  1JQ0 A;  1F4N A;  3FB5 C;  2HFE C;  4BW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...