3B94A

Crystal structure of human gitrl
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
120
structure length
102
Chain Sequence
EPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAFEVRLYKNKDMIQTLTNKQNVGGTYELHVGDTIDLIFNLKNNTYWGIILLANPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor ligand superfamily member 18
publication title Crystal structure of human GITRL
rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 15
structure length 102
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3b94A00
2TUNA 1ALYA 5KWRA 2Z5WA 4RSUA 2RE9A 2JG9C 2JG9B 3B94A 2KA3A 1U5ZA 3ALQA 4KG8A 2JG8B 4DOUA 5KC6A 4OULA 4E4SA 5CIRA 4TSVA 2TNFA 3FC0A 2X29A 1KXGA 1TNRA 1JH5A 1OSGA 3K51A 3MI8A 2RJLA 1O91A 4DB5A 1S55A 3WD5A 2HEVF 1RJ8A 1KD7A 3TWIA 2AZ5A 4QPYA 3URFA 1A8MA 5HBAA 4N90A 4F3JA 1WCKA 4HT1T 2JG8C 1DU3D 2OIIA 2Q1MA 5L19A 4QQ2A 3IT8A 3AB0A 3ME2A 4E4DX 3B93A 1I9RA 5KC5A 4D7YA 4MXVA 4MSVA 4QQPA 5L36A 2QE3A 2WNVA 3B9IA 4KGQA 1XU2A 2R32A 4QQOA 4QQLA 2WNUA 3QBQA 4G3YC 4TWTA 4NN0A 2WNVC 2WNVB 3QD6A 2ZPXA 3K48A 1DG6A 3TYJA 1PK6A 2WNUC 2WNUB 2HEYF 2R30A 1IQAA 4J6GA 4MXWA 4QQHA 1C3HA 2RJKA 1JTZX 1XU1A 1TNFA 1U5XA 3LKJA 2E7AA 1GR3A 4KGGA 1OQDA 4EN0A 4OUMA 1PK6C 1PK6B 2Q8OA 5BNQA 3L9JT 2O0OA 1C28A 2HEWF 1OQEA 3V56A 1U5YA 2R6QA 1RJ7A 2ZJCA 4MXWB 4OUSA 1D4VB 2QDNA 2JG9A 4G4FA 4GIQA 1D2QA 1D0GA 5TSWA 2JG8A
chains in the Genus database with same CATH superfamily
3LZZA 4YM1A 4AVCA 2Z5WA 2W87A 4MOAA 3PVEA 1DCSA 1R091 2NPIA 5CU1A 4QDRA 4NPRA 2VM9A 4YZ1A 3ES1A 3W20A 4ZS3A 4B4QA 4UYBA 3AP6A 1ENXA 2YG0A 5FZOB 2UWAA 4YVSC 5DUXA 5ERLA 2WR9A 1DDLA 4EN9B 4PIZA 3ATGA 2HWD2 2ADDA 2WT1A 5JAXA 2X29A 4YM2A 3HR9A 3CMGA 3AFGA 4RS5A 2GH8A 1CAWA 1RUJ2 3WX5A 3E1F1 5BNOA 1B35A 4Q2FA 1R1A1 2HWD1 3POIA 2EXHA 3E5XA 4Y33A 4C90A 4I30A 2K2SA 1BKZA 4WZCA 4O9GA 2ETEA 2GMMA 3BU7A 2W52A 3DYPA 3ACHA 3CO2A 4CP2A 2D40A 1GUIA 5LBEA 3E5QA 4OZOA 3JBG1 4XAAA 1J1LA 2PXJA 2QQIA 4AEDB 2VTXJ 3H1WA 1RHI3 3K3NA 2BFUL 3HN3A 2WIIB 3CJIB 3B9CA 4P9YA 5IVVA 1RUG3 5FFOC 1JU4A 4M00A 3MF9A 5FK8A 3P6BA 2IXLA 4CEYB 1UPIA 4Q4X3 3LSEA 2HYKA 2BFUS 3M3EA 1AVBA 4M3CE 1JUHA 1NA1C 5ANNA 1VBE3 3VBFA 3ZFGA 1HN1A 4E2GA 3Q8EA 1QXRA 2G4IA 2PA7A 5EWSA 5C8WA 1CZSA 2BDRA 2C1FA 1W9YA 1VAKA 3ENRA 4XAEA 3WW4A 5HCHA 4CTEA 2CGOA 4V2VA 4OMDA 3ZLIA 2GNDA 2EALA 1SCRA 2R32A 2Z2SB 3VDBA 3HQUA 3ZYPA 4JCKA 1V6LA 5DPNA 1SBDA 2PLV3 3MYXA 3VZLA 5JSOA 1GKBA 4LHNA 5A3OA 4MGYE 1NZIA 1AL23 1HJFA 2W46A 4B29A 4AAXA 3SC7X 1JZ4A 1W6NA 1GWLA 1H8TB 2W1SA 4LPLA 2ZX3A 5FZBA 4KL1A 4YW4A 3KVBA 3LB9A 2E26A 4ISRA 4AVSA 4CCEA 5J96B 3DPRB 3VDDA 3TN93 1VMJA 4Q0VA 5GZEA 4COYA 1F5JA 2OS2A 2KXLA 5FIXA 4RQPA 3WHUA 2HWC2 1GWMA 2WC2A 2WJSA 1QXPA 4JQRA 5LRSA 2O0OA 3DYMA 2YROA 5B4NA 2R49A 5CFDB 2KM2A 4QPIA 2QQKA 4A41A 5J36A 1X82A 5EYXA 4M0HA 4AG4A 4Q4Y3 1MS8A 1IPKA 3GJBA 4MGIE 1SBEA 2PELA 3O5SA 1FMD1 2L9LA 3NQHA 3V0AA 4YFWA 2Q0AA 1MPXA 3T2PA 1POV1 2RMU1 4TXWA 2NMNA 4MGQA 1ND3A 5H9SA 3LPGA 1BMV2 3IPVB 1LOEA 4HSJA 3SMHA 4YNIA 2BP6A 2PYTA 4YARA 1AYM1 4RSUA 4W8JA 2FDJA 1LGCA 3WZ1A 4AVBA 5A3NA 1QDOA 4AHWA 5IVCA 5GLUA 3JQXA 4WVMB 1O5UA 1QOSA 3C7FA 5LBCA 3KHCA 2DBNA 1XJAA 3Q8BA 1VBA3 1TEIA 4PHZA 3M7AA 3KV6A 4RR3B 3UGGA 4CE8A 5ACA1 1W2OA 1CAUA 4FFHA 5DZGA 4P9XA 3VBSC 4DXRA 3I2JA 3T1LA 2DF7A 1BEV1 1KXGA 4PIYA 1R082 4FXGB 4CUBA 3AVSA 3CF6E 1K12A 1O91A 4YGDA 2XMLA 1N1YA 1S55A 3WD5A 4ZU7A 1LECA 2W39A 2EF6A 3I59B 2J42A 4LEJA 1COV3 4FP2A 1QJX2 1K5MB 4NMIA 3W58A 1VBC3 5LY1A 1DGLA 5HBAA 2XKPA 1W3XA 4RL7A 1LU1A 3KV4A 3PL0A 2RDRA 1J3QA 2ZEYA 4MHUA 2XBO1 5HCBA 1GNYA 1S4CA 3WNNA 2Q1MA 2B39A 5K4LA 2XPJA 5FP9A 3X29B 5M0TA 2CNAA 1DQ5A 1EPZA 3FFQA 1ULOA 1SLCA 1Y9MA 3TNPB 2IXIA 4HK8A 4S2HA 3ME2A 2XQXA 3ILRA 1VE0A 5DZFA 3VD9A 5KC5A 1CZTA 2VU9A 2ZGNA 4NRPA 4P5YA 3O1SA 3PVNA 3O12A 1RUI2 5DN2A 1L3JA 5A32B 1W6PA 4OZXA 3SXWA 4XE9A 3U1XA 4MSVA 5JMCA 4UW6A 3OUJA 1DGWA 1TMF3 2DYCA 3B9IA 4CDQB 1CGPA 1POV0 5JUVA 4LOTA 5GJ6A 3IBMA 3FBMA 1EAH3 2LTNA 4CSWA 4DRVA 5CISA 4Z92B 2EIDA 1UIJA 2W9XA 4HL0A 1TZOA 1ZZCA 1ZZBA 4H7LA 1GBGA 2JDHA 5FYSA 4QHBA 3SNMA 2VQ0A 2XJRA 4JGZC 5EXOA 3PJYA 3VN4A 4META 5CNAA 4RHV2 4JKLA 1W8HA 5ANQA 1WA4A 3RGBA 1PGW1 1NQJA 2DVFA 5CEHA 3DKWA 3I2GA 4GXLA 4MVTA 4HKOA 4Q0UA 5A6YA 2P3YA 2D6NA 3LKJA 1U5XA 4XHXA 4PLOA 5IVBA 2YDEA 3LFMA 3KQRA 2JX9A 2GALA 2QCSB 1GP5A 3LPFA 3WV6A 1PNFA 1A34A 1BK0A 1ZZ8A 3OYWB 2HEWF 5GZFA 4YZ5A 3ZN5A 4K20A 4BM8A 1OKQA 1C1LA 4F8AA 1V00A 3UGHA 1IOAA 3S7EA 1PZ8A 2C5DA 3WOGA 1NYWA 2UYAA 4FPEA 1UYYA 1YFUA 1ZZ7A 4GB32 3VBOC 4N43B 1NG0A 2H0BA 5C8CB 4YLZA 1BK1A 2R16A 5A1LA 2Y6KA 4ZXKA 1PIV3 2YBSA 3ZYGA 1JZ5A 1WKYA 4LTAA 4BQYA 3EXUA 1GOFA 1VBB3 2A3YA 4OI4A 4YGCA 5LK5A 5JXGA 1T6GC 2PFWA 5A33A 3GBFA 5LASA 3CIHA 4C0BA 4XF9A 1QWRA 2YMZA 2PMWB 5A7WA 3IWZA 1U5ZA 1RITA 5JCTA 3S7IA 2VOVA 3AXDA 4QB6A 5HV4A 2MEV2 2WUHA 2PAEA 2E33A 4FPOB 4LHKA 3RG0A 2YBPA 4WZFA 3T2OA 5CFCC 3O1TA 1O3RA 1J1TA 3PLQA 5C6CA 4ASKA 1ZBA3 3UT0A 1DYPA 3CZJA 3U37A 4GALA 1V9U3 4YW1A 3RWKX 1PZ9A 2MEV1 3AFKA 3GNEA 2VNVA 3NNGA 4DS0A 4ZPIA 4XBNA 2O8QA 1AR93 2ZHLA 4OI2A 4KG0A 2VZTA 2YGLA 1RVF1 4W4ZA 3ZM8A 4LKFA 3THPA 3I3DA 2LALA 3IN9A 3VKOA 3ES4A 3C3VA 4B4PA 1HV1A 5T55A 2Y0OA 2GZWA 3KS7A 3NMBA 3C7HA 3TAYA 1I5ZA 1OOPA 4AE2A 1PO11 1MS4A 2FD8A 2Q30A 5FBJA 2GMPA 5F9TA 2W68A 3RS6A 2VCBA 3RYPA 4ES8A 4BA6A 2RR13 4D7TA 1TME3 4FPGA 2AREA 4Z2WA 1JODA 5FZ1A 1KFUL 2VD7A 4PF5A 2WO3A 3Q9OA 4BCUA 3M8LA 5F3CA 3OD0A 5LCWL 4LK7A 1OH4A 4NOTA 5KXEA 3IM0A 3BOWA 3N9LA 2VUAA 1IS5A 3OD4A 4TZDA 3NWKA 1ZYBA 3SKJE 2W94A 3WP4A 3BUCA 1LHUA 2XVLA 2OQ7A 3NJVA 3FMGA 1O4TA 2VW2A 4JGYC 2V4AA 4GWIA 4NWWA 2XVGA 3WUCA 2YBKA 1HQWA 5FZEA 3ZXDA 1S0IA 2Z42A 2P5BA 4EV0A 2XB6C 5J7MA 1D4M2 3LOBA 4NVPA 1BBT1 3L2YA 3N3HA 1A3KA 3AVRA 4Q5OA 1CX1A 1JN2P 3HMYA 4Z07A 3ZYBA 1OD3A 1OVSA 1PMIA 4Q29A 5DZEA 4LBQB 1D4M1 4CUCA 2Z69A 4TWTA 1DIWA 4GMP0 3U07A 4NN0A 3GF6A 5F5CA 1BHGA 1WW7A 1AR63 2F4PA 2PHRA 4XACA 1DZQA 1RUE2 2UURA 4DO0A 2D97A 5D8AA 2JEMA 3O1OA 1UCXA 1ASJ2 1RUF2 1XB9A 2QQJA 2LM3A 2RS52 4WVZA 3T0BA 3ZXAC 1YQ6A 4C91A 4O7XA 3VKLA 3VBHC 1NCQA 2C6SA 3EBRA 3KMHA 4GKXA 5JWPA 5LW9A 2WZR2 1ASJ1 4XJWA 4GH4B 5FY8A 3CLPA 4C0HA 2BU9A 2GSYA 3GCWA 4UF0A 5FY7A 3VBFC 3KGLA 3WQBA 5BNQA 4CXYA 2K9ZA 4BYYA 4SLIA 3SEEA 4BXFA 3FZ3A 1DP0A 4LBQD 3HEIA 1UL9A 1MZFA 3SHRA 2PN5A 2ZAAA 2J1VA 4HZFA 1ODNA 2ARXA 1MS1A 2AGSA 2XOMA 4RD7A 3FN9A 4BPZA 1JYIA 2ZX1A 3LSDA 2YYOA 4Q26A 5JLVA 1RHI1 5D2AA 4CPBD 5FJHA 4CYDA 3W21A 4OYUA 2B9VA 4BB3A 5FOBB 2W1WA 1RUG1 4YW2A 1S0FA 3VV1A 4YVSA 4X8PA 1X9TA 5FP7A 4NIIA 1KFXL 1XNCA 3JU9A 4QX3A 3WDYA 5BNNA 1HIXA 2VZOA 4HMZA 4Q4X1 1RUC3 1W99A 1ZRRA 3AKSA 5JI7A 2QKDA 4AQ6A 1H30A 1YYNA 1OUSA 3ZFFC 1KRIA 4O65A 1UY1A 2ZAHA 1UF2C 2VMIA 2IFWA 3MUY1 3UGFA 3VDCA 4AGGA 2OX0A 1C57A 4UAPA 4QPWA 5KHJA 1WCDJ 1Q3EA 3SKVA 1MZ6A 4N7UA 4Y4YA 1ND2A 2VCMA 4IQPA 3NNMA 3EMRA 5FYVA 4LE4A 3AP9A 4XFFA 1E5HA 4BHPA 1V6IA 1GICA 2RDSA 5DAWA 3ZVXA 1U0AA 1JYVA 2DDUA 4WVVA 1SLIA 4LOSA 3GBGA 5AC92 2X5IB 2UYBA 3IDCB 1UIKA 1Y7BA 5F7UA 5IATA 1AL21 3QACA 2W0XA 2EAAA 4IUGA 3MICA 5D21A 3HQRA 4YFZA 5LATA 2Y33A 4PI0A 4CCNA 1LCLA 4LBLA 2BVVA 3I4IA 2VVDA 3S0MA 4AI0A 2RS13 1NA1A 4HT1T 1S0BA 4M4RA 1OLMA 1SCSA 2Q8CA 5GM0A 4IE4A 3TN91 1TE1B 1CVNA 1XE7A 4MV2A 5GLTA 1YIFA 2OZJA 3B5LB 2O14A 3AX4A 3HNMA 5IW0A 1JHJA 4CP1A 1V6NA 1W2AX 5A6ZA 5IYYA 3VB9A 2YPJA 1D7PM 2VZVA 1LOCA 5I8TA 2CGNA 2PHWA 3OEAA 4LUKA 4ORFA 1UMHA 3S5AA 3BKZA 4HK9A 2D3PA 2P3KA 4Q4Y1 3BU0A 4FFFA 1PO22 2RM23 4EN6B 1C8M3 4KGQA 5DXDA 1KS5A 3Q8FA 2A6XA 5BNPC 3U75A 4BWOA 1DHKB 1QXJA 1ULCA 1ODMA 1FOD3 4QU2A 2XONA 4FPKA 4WM7A 1VAVA 3K48A 3ZIXA 5CKNA 3T2QA 5GALA 4HG6B 4JHZA 4XTPA 5GLVA 4NWVA 1WD3A 1MZ5A 4Q0SA 5J48A 3P5BA 1HRI2 1VBA1 2WO2A 4X6RB 5FZ4A 1KGYA 4JHTA 3MBWA 1REFA 3SCGA 2Q1ZB 5JZGB 4QX2A 3GZTB 1MEC2 5C70A 4UW4A 1OUXA 1HRI1 1LENA 3DXTA 3PIJA 4W6YA 4XFBA 1SDWA 1UY0A 1OQDA 3VZMA 4R4XA 1UAIA 3ZYRA 2WKKA 3L9JT 4HPKB 2CDPA 4LKDA 2B5HA 4CCDA 4KU8A 3OGVA 1VMHA 2NQYA 1COV1 1GQGA 5L9VA 3O1VA 2ZJCA 4B7EA 1VBC1 4CXWA 2R062 1GFF2 2XHNA 4LBMA 2HWF3 2ARCA 4JV4A 4L0PA 4IV3A 3VL9A 2DWRA 4KWJA 5TSWA 1ACCA 4XBLA 2VVEA 1LOFC 1FPN2 3H3LA 1V70A 1CPNA 3D6EA 2VNOA 3JQWA 4YZ4A 5J09A 1PVC2 4OHWA 1NAEA 4AFBA 4DEQA 1DZRA 2BQPA 5F2WA 4K9SA 3OPZA 4KH9A 1GP6A 3VBSA 3VZKA 1FPN1 3ZDSA 5K8SA 3PUIA 4M3CF 5EJZB 4K6BA 4HKWA 3ZSKA 5DDJ3 4KG8A 4BK5A 2VZPA 3CHXA 4XEZA 5A7QA 5I8YA 2ET7A 4CP9A 2YGMA 3OOXA 5L7OB 1KQRA 1O3QA 4M01A 4R8HA 1Q8OA 1QJU3 2FZ1A 4XDPA 5FXZA 2D7FA 1QMJA 2DFCA 4TSVA 4AFMA 5CA6A 3TEYA 4N53C 2JD4A 2H6BA 5JVVA 1RTVA 2C9KA 2CU5A 4EWAA 1EAH1 1TNRA 1YEWA 3LCPA 3ZSMA 1HRV2 4EJRA 3MIBA 3AMQA 3ITQA 3BTZA 2RHPA 3RI9A 4E8CA 2ZABA 3WG3A 2EXJA 2WS92 2WN3A 1MS5A 1H9WA 3ZDVA 1XBFA 2BNOA 2JD9A 4BXSV 4NHYA 1FNYA 2PHUA 2WINB 4KBZA 3BGAA 5FYBA 5EZWA 1OXCA 4CA9A 1H1MA 4JKMA 4HKLA 3FL7A 5B2GB 2QZ3A 5LK7B 1H8VA 3J7HA 4BIFA 3USUB 1Q43A 3PTRB 3DEMA 1ZBE3 4Q4V2 1LB2A 2ZHKA 4N9IA 3K4DA 4XFHA 4E4DX 1QQP2 1C8NA 2Y60A 5FZHA 3FHAA 3I7DA 5CG9A 3VUOA 1D2SA 2XH6A 4UI9L 1IKQA 1OKOA 3PURA 4XCAA 1MACA 1PX4A 4IL7A 3PNAA 1XXNA 4N7IA 4NHKA 1NCRB 3MIHA 5BPXA 2E53A 2R043 1XNKA 3P3NA 4YW6A 4JKKA 5IK4A 2GP5A 4JQTA 2BEOA 1N47A 4JGZA 2DCTA 1GYKA 4PDWB 2WWJA 4M3CB 1PIV1 3APBA 4KWKA 5FREA 1VLNA 4LJHA 5F3IA 2ZEZA 1VBB1 4BU2A 5K0UC 5JPMB 2WAOA 4NHXA 5H9RA 2VBBA 5KHIA 2QQNA 2PAMA 1OHFA 1QJY2 3S57A 1DQ4A 4QWNA 3ZXLA 2WNVB 2Y64A 1YI7A 5FXVA 3RVHA 4A44A 1OOPC 5IVEA 1E57A 2WQZC 3JB8A 4MHRA 3O1PA 4C1WA 1QHDA 4GMP3 2P17A 1ZBA1 3OBZA 4JTNA 5SV8A 1W2TA 2YFZA 3T09A 4QQHA 1V9U1 1CAVA 3ILFA 1J3PA 1EUTA 4QX1A 5D1IA 1AR91 5FUIA 4ITCA 3B00A 3UJQA 1UMIA 1VRH3 2GN3A 2B8MA 3OB8A 4KGGA 2GAUA 2ID4A 1PK6B 2Q8OA 1ONAA 1ENSA 4R9DA 4YVWC 4BMEA 4XTMA 5FUPA 2R6QA 4MXWB 1J84A 2R0HA 4DZGA 4YGBA 4NRQA 1Y3TA 5FYTA 2AH2A 5FQ0B 1OMIA 2RR11 1TME1 2FDHA 4I3GA 1D0GA 3I8TA 2JG8A 5DAXA 5F5QA 4CDWB 1ULGA 4V1PA 4FQ4A 3UJOA 2DVDA 5A3LA 3ZO0B 2WYFA 1ALYA 4IE6A 4MYEA 4IERA 4AEJA 4OQ8A 3N9MA 1SG3A 5A70A 2WQ4A 3M3IA 3NV4A 3GZAA 1VAMA 4NJ4A 5BY5A 2D6LX 2RS32 3VBRB 2X10A 3N35A 2NLRA 4XF1A 1OFNA 2FMYA 3WY6A 2DUQA 4QKFA 1GV9A 5D8AC 4PI2A 3PU3A 2BOIA 4OULA 3ZFEC 4PBPA 1DQ2A 1SMVA 4RFRB 5DUWA 1HB4A 1PX3A 2B45X 2JDZA 2FQPA 2Y0IA 2WFF2 4NRMA 3POEA 4B1LA 1MQTB 2JJ6A 1LGBA 3IIIA 3KF3A 1ZZ9A 4K8FA 4NUBA 4Y5Z0 3RRDA 3WF0A 1BVP1 2VCAA 4WM8B 3AKTA 1WW6A 2ZKNA 3FBYA 3HJRA 3N9OA 4CEWB 2IFRA 1R092 3CL1A 4UBHA 5FP8A 4DB5A 1O3SA 1LHVA 3J7NA 4OFGA 5JOYA 3FHIB 2VNRA 1H4GA 1AR61 2DCZA 1JUIA 1A8MA 4COWA 4MGTA 1RUH3 5FXXA 3S6PA 4QDSA 4F3JA 2NN8A 3LFIA 1NKGA 4CCKA 2AACA 1WCKA 5FLJA 1OC1A 4JGYA 4BDVB 3JB4C 5E1RA 2HH9A 5FP3A 4U2AA 1SFPA 3I2HA 2VE1A 2BRTA 2KD7A 2XUMA 3IT8A 1N3OA 1W04A 1W6MB 4LE3A 5L73A 4NO4A 1R1A2 5BNNC 1WMFA 2VBDA 1MS3A 1EV13 3EQEA 4IV1C 4UBGA 5AFEA 5IK8A 3IB3A 2E31A 3I49A 3POJA 4RA0A 4YPJA 1W8WA 3KZ4C 5JR2A 1ND2C 2R1DA 3JBG2 5FY9A 2E9QA 4P9GA 2YXSA 3N9PA 4A7KA 3C2UA 4A3ZA 1VIWB 2K0GA 4IESA 5T5JA 3R4DB 5FPUA 1W9SA 3POWA 4MGKE 3C7EA 5T52A 4Y1XA 4BQWA 2MNGA 4HBNA 4COUA 2PQQA 4Q4W3 1RUC1 3ST7A 3VBHA 3OTFA 3WNMA 3F95A 5C4WC 2QJVA 4P9LA 2A3WA 1UZVA 2ENRA 1W39A 4FPYA 3HT1A 4EQVA 5FYIA 3WR0A 3ZOIA 3WP6A 4QDQA 1KITA 1EPWA 2JDKA 2VXRA 1LKNA 3LF7A 5A7NA 2XL7A 4P9JA 3CEWA 4Y20B 4YSFA 3V0BB 1ZM1A 1GR3A 2HWB3 2G9GA 4FQZA 1XC6A 4QPGB 4V2WA 3AZYA 1AR73 1WW5A 4XOGA 2R073 3T4VA 5FMOL 2I45A 5ABJC 3RYRA 3U4SA 5FYYA 1UY4A 4LIUA 1H6YA 3HNBM 1X7NA 2WZEA 1N1SA 1RUD3 2YC0A 3HWJA 5CBLA 3NO8A 2RS11 4LLOA 3O0XA 1G7YA 3ZFFA 5FMOS 4MH0E 4XDQA 1FI2A 3PUQA 5APAA 4XVHA 1J3RA 5FO9B 1CD3G 1H1AA 1JMUB 3H8UA 5C3RA 3AYEA 3HNYM 2CWMA 3ZPYA 4W65A 1YXWA 3AJYA 1Z7S3 4L92A 4WM7C 2WNEA 2AC1A 3MIDA 5CKMA 2ZEXA 1S0DA 3OUHA 1H0BA 4UW5A 4XHBA 3LDRA 4KMQA 1JOJA 1LEDA 1JU3A 2WLQA 4PBOA 4CRQA 1FMD2 1UZZA 1C8M1 1W6QA 2D93A 2RMU2 3BVCA 1KJLA 4CDUB 2D6KA 3AM2A 1BVVA 1SHWB 1S0EA 4HOOA 4S2FA 1AR83 1AYN3 3AK0A 1AYM2 1FOD1 4FSJA 4XXPA 2WT0A 3VLBB 3NKGA 1ZRFA 2TEPA 3VD3A 2D98A 1VR3A 4BQ1A 2OPWA 3BTAA 3O1UA 1WLDA 3SQOA 1UYPA 3DXUA 3NAPA 1STMA 2P6CA 3PJQA 5FZ3A 1MS0A 2A5ZA 1FNZA 4GKYA 4IV3C 5JR7B 4XFAA 4JZRA 5ACA2 1R1ZA 2R0FA 2GU9A 3B3QE 4IE7A 5HXVA 1OLME 5FYUA 3ZMOA 4AEDC 1AX0A 4Q8KA 5K7PA 2CGPA 1F5FA 1BEV2 1NXD1 2VH9A 3CJIC 3KD4A 1QKQA 3N4MA 1AX1A 1SLAA 1UOJA 4DY3A 3WSOA 3K77A 3LOIA 1W8UA 2J1TA 3J8F3 4CEYC 2BTVC 1JZ2A 5FO8B 1N1TA 4LO5B 2FDKA 1U5IA 5C33A 3HIFA 5BNPA 2ZGOA 4IEUA 5LA9A 3MEPA 3T0DA 3BOPA 2DTYA 3FWEA 2HWF1 2ZMNA 4HANA 5GZDA 2XBO2 3ZYJB 4RGAA 5JOZA 1W9FA 1QNYA 3WLUA 3UKNA 2SBAA 3OGGA 4LK6A 3WP3A 2Y6FA 3DYOA 1IS6A 2HWE2 2ZGUA 2QTWB 5DAQA 4Z82A 4CDXB 1G6NA 3AKPA 5KR7A 3OY8B 2FDIA 1RXFA 1W3VA 4XUQA 2VOWA 2WT2A 1H2NA 1OF3A 3Q8AA 3WDWA 2HWE1 3FUQA 2CHHA 2ZPXA 1HW5A 4QB1A 5FY4A 1HDKA 3BPSA 2QBXA 3VBOB 1H8TC 4W50A 1CIWA 3TEZA 3GXUA 2WNUB 4Q1RA 3ZKUA 1UOFA 4M0NA 4E9KA 1H4HA 3T4HB 2WQ8A 2XWJB 2FDGA 5H9QA 3CBNA 1I6XA 3DKQA 1AZDA 3ZYHA 4AWDA 1UOBA 4AI9A 2FHRA 4CCCA 1CZVA 1SPPA 4E4ZA 1LOGA 4UFKA 3A4UA 1BCXA 1KDKA 1YIPA 1J83A 2JE7A 3NNLA 2LS6A 1LOFA 4P08A 4KWLA 4QD2A 3KLSA 2WL1A 4CU7A 4GWJA 1RC6A 3QH6A 1GQHA 3AL6A 5FLHA 4A6SA 1G9CA 4Y22B 3H3UA 1F35A 1PGW2 2IXJA 2G19A 3BODA 3UL2A 1IQDC 4Y3OA 4Z1VA 3ZYIB 3V64A 4JAAA 1UU5A 1ZBE1 4XETA 4IE0A 3I3BA 3I3MA 4XJ9A 1VBD3 3NW4A 5IFTA 1CX4A 1GZ9A 4URTA 4Q8LA 4XJZA 4N53A 1Y9QA 2JG9B 1NE6A 4QU1A 3ZN4A 1PHMA 3EYPA 2UWCA 3MIEA 5C9AB 1CIYA 1BJQA 5JIUA 5CIRA 2R041 3WQ1A 1WCUA 4EWEA 3DECA 1GNZA 2E7TA 2BWCA 2O1QA 3VBUA 3LA3A 1QH6A 3SH5A 1GLHA 5FTTC 4XJ8A 3MI8A 1GNHA 2IZWA 4P5HA 2VCCA 2KR2A 5A3UA 2VZ3A 1UU4A 2VW0A 1K5MC 2HLEA 1WMEA 4OHYA 4GAZA 2A6VA 1UWWA 3SEPA 2OYZA 5FYHA 3OUIA 1O6UA 4GMP1 4RS5B 1GZWA 1CAWB 5BNOB 5C3OA 2JG8C 4BMBA 1B35B 2OIIA 3HVDA 5A7PA 2P37A 5F1RA 4D0QA 2XHKA 4R52A 4XPVA 3FJSA 1RVF2 3N9NA 4COZA 1LOAA 2JE8A 1REEA 3AMHA 3WDXA 5FPZA 4OHVA 2G9FA 5JI9A 3U0ZA 2IVJA 2IVIB 5FJKA 1PO12 1RMU2 1W03A 5K0UA 1WCSA 4CCLA 2LUWA 5E6HA 2B7YA 2WN2A 5FMDA 5FYCA 5EJ1B 1QOTA 1ZREA 1WLWA 3LAGA 3A7QA 2CSGA 4FAGA 4QHOA 2VUCA 2ATFA 1NX9A 1RMU1 3VBFB 3NNFA 1MS9A 2ARAA 4XDOA 4LBKA 3ZFGB 5LEJA 5FWEA 4G3YC 2WO1A 4BH9A 4HONA 2G1MA 3AP7A 1Q56A 1CWPA 4IEXA 4CU8A 4AW7A 1HKDA 1WBLA 2CDOA 3M3OA 4OVEA 2YUEA 5I93A 4AI1A 1QU0A 1RIRA 1QJFA 2OA2A 1DG6A 1YLLA 4A7ZA 3I2OA 2X05A 2FCUA 4B1MA 3BN6A 1UN1A 2R30A 4OHZA 4YVWA 4BJ0A 1BBT2 3AZZA 3PUSA 3WVJA 5FMBA 4ASMB 1TNFA 1N3PA 3QOPA 4GD4A 3IZOA 4XMIA 2E7AA 1VALA 1W6NB 3M1HA 3MIGA 1AX2A 3NL1A 4I01A 4LA3A 4OLLA 5G05L 3GDBA 4OUMA 3KB5A 5FUNA 2LROA 2ZA9A 1WGPA 4CCOA 5LA1A 5F5IA 3BIEA 3ELNA 4YG6A 3ZPOA 2VJXA 3VDDB 4LO6B 2B9UA 2HJIA 2WRAA 1AUYA 1RUH1 1YFYA 4QKDA 1PM7A 5FV3A 2Q1FA 3ZN6A 5CAZA 3OJBA 4YW3A 4XUPA 3JD73 4N43C 5IWFA 1PGL1 4RQPB 3LDKA 5C8CC 1HXS3 1I3HA 3PVOA 1OH3A 2F17A 3ZFEA 1AF9A 2QQWA 1LRHA 3KSCA 2GNBA 2EA7A 1UQXA 3MV11 5FY0A 5KWRA 2XLGA 2D44A 4GQ7A 1M4WA 4QPIB 5CZKA 4LKSA 1F4HA 5E88A 4Z2AA 1SLBA 1US3A 2Q4SA 5CYYA 4D8MA 1FV3A 4AFDA 3VZNA 1LU2A 2A71A 1CESA 1W0NA 2WABA 3V0AB 1DGRA 1W8OA 3KT4A 4I3PA 1WMXA 1QNWA 1ND3B 1ZNPA 2XJSA 3Q8CA 1YJKA 4IEZA 1UXZA 2BJSA 4ZU4A 1RHI2 4J1XA 1G9DA 2FDFA 3IIAA 4XJAA 1YFWA 5IK5A 1RUG2 1PNGA 5A3WA 3RZZA 2N7GA 5FZMA 1VRBA 5FAXA 1TVGA 3E5UA 4H7MA 4Q4X2 3K51A 3MFAA 2VMDA 4Q4W1 4X6QB 2EVXA 4AI8A 1VBE2 2F4LA 3ETQA 1KD7A 3WNOA 1CAXA 1CQ9A 2XR4A 3OBRA 1FAYA 5BV6A 1CAUB 5JOXA 1O59A 1IG0A 2OW4A 4XILA 3MGUA 1VPHA 5T5PA 3ACFA 3AMNA 1B09A 1VBE1 1W0OA 4YGEA 3KQ4B 4IV1A 1VJ2A 3WXPA 2ZACA 4BOWA 5LA2A 5BUVA 2QQUA 3FUOA 3AC0A 2JDMA 2HWD3 2UU8A 1T2XA 3GM8A 1VB4A 3N7LA 2PLV2 3SISA 3LIGA 3EO6A 3MF6A 4ZZ5A 4A3XA 3C7OA 2HWB1 4KBBA 3PDQA 1RUJ3 1AL22 3PTYA 1XOYA 1YUDA 1AR71 4D7YA 5F37A 2R071 4EZ4A 5KBFA 2P3IA 2PLV1 1ZRIA 3WQ0A 1I5PA 1DQ1A 2ZBJA 4AQSA 3OG2A 4MUVA 5L36A 4XUNA 3O0VA 4K40A 1JZ8A 4H55A 5C4WA 3ACIA 4B7KA 3TN92 4F7ZA 2FCTA 3VD5A 4JRLA 2D6PA 3OGSA 1V6OA 2Y6JA 1Y43B 3BCWA 3I54A 1W6PB 2JIGA 4FOVA 2BBVA 2YY1A 1IHMA 1X9PA 3VZJA 1Z7S1 4QX0A 5EYYA 2ET1A 1K5JA 2GDFA 4TN7A 1PGSA 1YQ5A 4LIVA 3NAPC 4D3WA 3MV01 3R0RA 4A2UA 1S0CA 3NNJA 4Q4Y2 4RGKA 5FZ7A 1JYCA 4PLMA 2W47A 3ILNA 4Y4RA 2AEZA 2GH2A 2EICA 3J9SA 4TLFA 5ABJA 5IK7A 3V65A 4CU6A 2RDNA 3OPWA 4FOYA 2RJKA 1RL3A 3D0SA 4Y1YA 2RV9A 1OQ1A 2JWPA 4D69A 5F2SA 4LO7A 1AR81 2H0VA 5A6XA 4XC9A 4S2DA 2ZGMA 4LBOA 4XW3A 4K1ZA 5KXCA 1OLRA 1WD4A 1FATA 3RZJA 2NMOA 3U78A 5KXDA 1XYOA 4RN5A 4RFT0 5FZIA 3ECQA 4FPFA 4FT8A 4OUSA 1RB8G 2PHTA 1VBA2 4QX5A 3T2TA 4G4FA 3VKNA 4MADA 1QH7A 4P02B 3IDBB 2VZQA 1HB1A 5FY1A 3WDVA 4RGGA 4PJYA 5FZOA 4YZ3A 1IPJA 5KHHA 3MLLA 2QZ2A 2JICA 4QXCA 1Y4WA 3J8F1 5EV7A 1JZ7A 5L9BA 1DF0A 2D43A 2HWC3 2CL2A 1COV2 2A1XA 2VXJA 3PIGA 3RI8A 5A6QA 4DY5A 4ATEA 1VBC2 1LOBA 1POQA 2Y34A 3ALQA 5FYZA 3RQ0A 2W1QA 3ACGA 4CZSA 4K3UA 4AFCA 5IVJA 4IW3A 4OUEA 3ZSJA 5DQ0A 2NYYA 1KDMA 5A33B 2ORXA 3UNPA 2BGPA 2P4EA 5LA0A 1O4YA 5A7WB 2ZGQA 2H6CA 1QGLA 1SLLA 1OSGA 4QM8A 4LT5A 2V72A 1ULEA 2X5IC 2XWBB 4BQ2A 4AEDA 3WW3A 1IGOA 4XZPA 4I02A 3CJIA 1RJ8A 4ZS2A 4QPYA 1Q8PA 3ZSEA 3DV8A 1H2MA 1V6KA 2DCJA 1TMF2 1ZA7A 4CEYA 3ZXEA 1V0AA 4P9WA 4D6RA 2W2IA 2UY9A 3K3OA 2FCVA 4PQ9A 4OCTA 1DU3D 5T50A 3RJ2X 3JUUA 2ZX2A 2ERFA 1EAH2 2UY8A 5EP9A 1TMF1 2SLIA 2QQVA 2DU0A 3KV5A 4JX0A 3SITA 1O8SA 1QDCA 1R083 5E89A 2G9ZA 5GLWA 1OOPB 3WNXA 3JCIA 4M4PA 5GLZA 4QHZA 1M06G 1L7QA 1O3TA 4I2OA 2ZXQA 3LA7A 3D0JA 3FLPA 2W92A 1FXZA 1QJX3 4QQPA 1S2BA 4LUMA 4YW7A 4NIAA 2HBTA 3J26N 2HKXA 4H3WA 3PMEA 3WCSA 1UD1A 5FKCA 4Y5TA 4EN7B 1O4ZA 4UOJA 2A6YA 3VBUC 1H8TA 2W95A 1SBFA 3W5NA 3N7JA 2OXBA 3VHRA 3WF1A 3LEIA 5IVYA 3R6SA 4BZ4A 3H1MA 3MZHA 3LIHA 3DPRA 1PZ7A 5HPOA 1RUI3 4A42A 1WZXA 1G9BA 4HVOA 3H1YA 3LGRA 3W9AA 4BLIA 2I2SA 3TYJA 4DQAA 1NY71 2HEYF 1VB2A 2VMHA 4LMFA 4B4RA 1W05A 1JHNA 5CFDA 5FZDA 2GMEA 3CKHA 1IPSA 1YO8A 1DLCA 1PIV2 2VOKA 1JTZX 1BQPA 3FE5A 3FFZA 4FPLA 4XF4A 3JXSA 1APNA 1VBB2 2IC1A 1HB2A 4PLNA 1JZ3A 1W6OB 4JDNA 5T3NA 2WZPP 3QLQA 3MLKA 5D8AB 3LD8A 2VNGA 1C28A 3MDPA 4KWUA 5I0SA 5LY2A 1UMZA 2K46A 3IPVA 1RJ7A 4JVAA 3WDUA 2VMEA 4A4AA 1NCQB 2DCKA 4XQ4A 3L2HA 1ZBA2 4XJUA 2QDNA 4HETA 4RHV3 1JYXA 3T1MA 4WVMA 1V9U2 2CTVA 4GIQA 1D2QA 2WWUA 4UF0B 4XABA 1AR92 3ZIWA 1X8MA 2VTFA 3OF1A 3N7MA 1RUNA 2JIJA 4RR3A 3ZKYA 3EB7A 3OBAA 2ILMA 4F83A 4FPCA 1DQ0A 2KA3A 1XYNA 3VD7A 1PMJX 1YQCA 5CVRA 4LKEA 5LRRA 4DOUA 2BGCA 5L7OC 5FYMA 3D5OA 3EJKA 2RR12 4AYUA 1TME2 4Y1UA 4YVSB 1OFSA 2BBAA 3I59A 4GB33 2ZMKA 3A21A 1HX6A 1K5MA 2ZGTA 3I97A 5BNNB 1HLCA 3LA2A 3ON7A 4XMAA 1SQ4A 1LGNA 2QDRA 2IXKA 3P3PA 5DAPA 3N9QA 5FO7B 3VKMA 4CDXA 4COVA 1JOBA 1L7LA 1LTEA 4HN1A 1O7FA 2GP3A 2P1BA 2PHLA 4AHZA 1MR5A 1ND2B 1HQLA 1S0JA 2AZ5A 2ZMLA 4UT5A 4ASLA 1HV0A 1C5IA 1RGSA 2R1BA 1W8FA 3BPZA 3TBDA 2MEV3 5CG8A 2WLPA 1UX7A 4ONUA 1MZEA 3AKRA 1XNDA 3I3EA 3RMXA 5A32A 4YRDA 1AJKA 4CCJA 2DV9A 3D4KA 2VGDA 3UK9A 5IFPA 5JSPA 5CADA 2MHFA 3T3YA 1S0GA 2BV4A 2WAAA 1N3QA 4CDQA 3B93A 2XKOA 1I9RA 1KJRA 3HD8B 3ACLA 4YZ2A 2GNTA 4IGQA 5F6LB 3ZXKA 4OI0A 1NA1B 1AR62 2A70A 2ZOEB 5FPXA 3PU8A 3RWNA 2OUHA 3IKWA 4N9HA 5K9YA 3ZXFA 4MLOA 1NCRC 1OF4A 4GJYA 3HAGA 3R05A 3BTYA 3CNAA 2FMDA 4LA2A 3JD71 4DRRA 3KWVA 2B42B 4ZONA 1YRZA 4FXKB 1LODA 4QKBA 1QY4A 4PDWC 1XQNA 3ASIA 5FR3A 1JYTA 2C24A 4RYDA 3RZGA 1XNTA 5DUUA 2UWBA 3MIFA 1F4AA 3R4SA 4AQ2A 4HLTA 1LHWA 3ZR5A 2VQAA 2WNVC 1H2LA 1HJGA 2XQRA 4LO4B 4XBQA 2VBPA 4AVTA 1NLSA 1GZTA 1UKRA 4YM0A 2JDPA 3OYWA 4JTOA 3G6JB 5G04L 1IQAA 1D4M3 1UOGA 2PHXA 3I3QA 4WM7B 3H7YA 2XDVA 3I2FA 3ROUA 1ZVFA 2VY0A 2NP0A 1WW4A 2IXCA 2O8OA 4N43A 1RUC2 4FFIA 3ZMNA 2VUDA 4XYXA 1PK6C 5C7GA 5C8CA 4AVVA 4BLJA 4CP0A 3BTXA 3E6CC 3HOBA 1OQEA 4EE2A 1OD5A 3H42B 3T08A 4DIQA 1RUE3 2VMGA 2JB4A 3GZEA 4AI3A 1N1VA 5EIYB 2I74A 2ZGSA 3RMYA 4AHYA 1ASJ3 1OA4A 1RUF3 2V4VA 3AXEA 2RS53 4QXKA 1E5IA 4R9AA 3ZSLA 5C71A 4LBNA 4CDWC 3ZX7A 3BALA 3S5QA 3E6BA 5EJ3A 4CVUA 5FZFA 1BXHA 1DFQA 4D7SA 2WZR3 2HBUA 5EFUA 2P2KA 1R64A 1RUJ1 3P1IA 3R4UA 2BWAA 2ZTNA 2VQTA 1W06A 2X8KA 2ARBA 2IUWA 3FLTA 4P14A 4IV3B 5FPVA 3VBRC 2I07B 1YCIA 1YQ2A 1BZWA 1C4RA 3SLIA 3T30A 2NZ9A 4LXLA 1WUVA 4A7YA 2RS12 1J59A 3NSTA 3HT2A 4XXAA 3SCHA 4P9IA 3MW3A 1C1FA 1MQTC 3NJXA 2DVGA 2XJTA 4UFHA 1W2NA 2D3RA 3VBSB 2B4KA 2JB8A 4WM8C 4BE3A 4E2SA 1OPOA 5F8PA 3KT7A 4UXAA 4PIXA 4D6SA 4CEWC 2XXZA 3LEKA 4ZXEA 2A6ZA 4Z8BA 4CP9B 1HQNA 4LO8A 3A22A 5E16A 3TEWA 1GMMA 3N7KA 3E6DA 3E97A 2E51A 2Y6HA 2RM22 2VMFA 1C8M2 4P00B 3LEGA 3UETA 1WCQA 2BGOA 4DMIA 3G7DA 3W59A 3GCXA 2QUOA 5FMCA 4L9BA 4J25A 5JXJA 4QQ2A 2YFUA 1H6XA 4W6WA 1A6CA 3NJZA 1DGWX 1FOD2 2RM21 2V09A 2WDBA 3K4AA 3OGRA 4MGSA 5AC93 5I91A 3WDTA 1ZX5A 4Y1ZA 3CU7A 1XE8A 4YG0A 4W6XA 4QX7A 2J22A 4MXVA 5FZ9A 2R7EB 1ULPA 3B69A 3AYDA 4L99A 4QGLA 2DU1A 3WNKA 4LBQA 4AEMA 1LULA 1QIQA 1SEFA 3MFCA 1NLQA 4QQLA 1F2NA 3HN1A 5FPAA 2WSUA 3H3ZA 5DABA 3WP5A 4WVWA 4QQOA 4JDMA 1W9WA 3DL3A 1QJEA 2YB7A 4CPBA 5FDBA 4NROA 3RNSA 3PHMA 2GC0A 3I2KA 2HWC1 4E8DA 3K2OA 4DPNA 4FO9A 4NR1A 5EPAA 1JZ6A 1DQ6A 1NOVA 4JGZB 4PF1A 2OPKA 3AL5A 4FP3A 4GH4A 1X33A 4HXCA 2HWF2 2ZX4A 4YYOA 5FKBA 4ZY9A 3TNQA 3NVCA 2AR6A 1OLQA 5FZLA 5LWBA 1PO23 1QJZA 2A73B 1GSLA 4CU9A 1OPMA 1RUOA 1DLLA 1UYZA 1K3IA 2XL9A 4XZUG 1BMV1 2A75A 4BQ3A 4QPGC 5DG1A 5FZ0A 3F2ZA 5T5OA 5C5TA 4H2AA 3LQCA 4D94A 4LHSA 5DDJ2 4AL9A 1GU3A 5A7OA 1UW8A 1CAVB 2E7QA 1QJU2 1W8TA 4QB2A 4ATFA 3HQXA 2WA4A 3QH7A 3VKFC 1HRI3 2Q5TA 1MVEA 4BK4A 5DDJ1 1UKGA 5DMYA 1AL0G 4GWNA 1ZRCA 1LESA 4O61A 1PM4A 1QOOA 1QJU1 1YNAA 5FK7A 4LORA 1JXNA 1MEC3 1R081 5A3PA 1BLZA 4YG3A 4AF9A 3VD4A 2VG9A 3D82A 3DPRC 1GP4A 2XJQA 2W3JA 4FPHA 4XF0A 4HN0A 1AHSA 1Q8QA 1QJX1 2JG8B 2X5IA 2XJUA 4UWDA 5KC6A 1H1IA 1LEMA 2OT7A 2R063 3DN7A 5CFCB 1LJ7A 4Q27A 3WNLA 3U11A 2JKBA 5CFDC 1WLCA 1C5HA 4FVVA 2JENA 4FPJA 3USSA 4FBFA 3ETPA 4LLFA 1ZBE2 4WV8A 4XURA 2PQSA 4E4HA 4FI9A 4CDUC 4D6QA 1FPN3 1JH5A 2EXIA 1HN0A 3LE0A 3GGLA 3M4FA 3WNPA 1QF3A 4S2GA 1PVC3 5AFBA 1WMDA 2QVSB 3PUAA 4KI5M 4BQ4A 3TEXA 1RUI1 2XVKA 3A23A 4E27A 2YC2A 4FCAA 4KU7A 1DYOA 1SDDB 2WSVA 4URAA 2YV8A 2R042 1ZZ6A 3NKTA 3POBA 2EIBA 2BERA 3CDZB 4JDOA 5C5UA 4J1WA 1DGRN 1UZWA 3KCCA 4RR3C 5JDBA 3RZHA 1HRV3 5F6KA 1SZBA 2GN7A 4SBVA 5J1XA 2JXAA 1LHOA 3VHOA 1A8DA 2WS93 4JGYB 1DYKA 3JZVA 4IGOA 4PQQA 4XQDA 1PMHX 4XQWA 3ZXGA 3THTA 5GZCA 2CAUA 1IS3A 3INAA 1LNSA 4CXXA 1OURA 3EHKA 5IUQA 5IAXA 4RHV1 1SFNA 4XF3A 2CV6A 2ZEWA 1JS9A 2ES3A 2ZGRA 4Q4V3 5CB7A 2OVUA 1F15A 1VRH2 4C8DA 4CDXC 3VHNA 4QM9A 3GBWA 2XUEA 3RZKA 1QQP3 4O9EA 5AVPA 5FRAA 5JZGA 3WW2A 1XE0A 3QD6A 1URXA 4ISQA 4LNVA 1VRH1 2J1SA 4NPMA 3NV2A 3CZUA 1EUUA 2PTMA 4UW3A 4B3NA 4GZ9A 1E5SA 3AYCA 2C26A 2YU2A 4Y5SA 2ZGLA 4HPKA 2WNUC 3ZR6A 4PCRA 5A80A 5BYNA 4FFGA 1OVPA 3UKVA 2FZ2A 1UNBA 4GB31 2P3JA 4I09A 4NE9A 4JRAA 3IAPA 3M3QA 1FYUA 3VBHB 3WG2A 4IETA 4C1XA 2VMCA 3UESA 4CDQC 3J7LA 5JXHA 2EXKA 2P34A 4NAOA 4IEWA 1VP6A 3DGTA 1QJY3 2BNMA 3ZYFA 3LEMA 4ZKTB 3S30A 3V56A 2XG3A 2VPVA 3I2DA 4IEOA 5A3MA 3UYJA 1NUKA 3GALA 3POFA 1D4VB 5C3SA 3VDAA 4EWDA 5FCCA 4EN8B 5JPNB 3WW1A 1GOHA 2VECA 2ZZQA 4PT6A 2D3SA 4I0AA 3T0AA 5L7OA 3K46A 2TUNA 1J58A 3H9AA 4AOCA 4BQ5A 2D5HA 1DBNA 1LAJA 5FP4A 5F3EA 2BZDA 2JG9C 1JOPA 1AJOA 3ZFFB 4INDA 2YHJA 3C7GA 4QX8A 4BISA 4DINB 5C9AC 1RUH2 3UV9A 1W9TA 4AXOA 3RZMA 4K8RB 4E4SA 1TQ5A 3ZXJA 1PGL2 5I0DA 3H0OA 3QCWA 2AENA 3TRSB 3FC0A 4QXBA 5FPBA 3WT3A 2XLFA 2YC4A 5EHDA 5LBBA 2CYFA 5JOWA 3A0NA 4DXSA 2C0ZA 4K21A 2Z4FA 3KGZA 2V5YA 2J7MA 1EV12 2RJLA 2XLAA 2VULA 2YPDA 3MO4A 3USUA 1WA6X 1SFYA 1L7RA 2WA3A 3FX3A 4K1YA 2RS33 4H14A 1EY2A 1F9KA 2E32A 2OUJA 3CQOA 1W6QB 1Y9GA 2QNKA 2D6MA 2ZHMA 3RSJA 1EV11 1UU6A 2VZSA 4QKNA 2A7AA 4MG2A 3RYKA 2VQUA 4DNYA 4RS5C 1NE4A 4LULA 5BNOC 5IVFA 2WFF3 2E6VA 1B35C 1CR7A 5JMOA 5F3GA 1BYHA 1X8EA 1G8WA 1NLRA 3POSA 4AAPA 1NCRA 3H7JA 5LZ6A 5EQUA 4Q4W2 3I2IA 1W6OA 3K4ZA 1CONA 3NAPB 1R093 5B4XA 2BNNA 5LBFA 1YC61 4PDWA 4M3CA 3AYAA 5IAVA 4XFIA 5FZ8A 1W2UA 3N36A 4YWAA 1RUE1 3IMNA 2RVAA 2GC3A 5I0UA 1HB3A 1WLTA 2VVFA 2Y26A 1A78A 1RYYA 2CAVA 2QE3A 1RUF1 2WNVA 3KV9A 4R9BA 3IAQA 2RS51 4QGNA 2GC2A 1XU2A 3KCXA 4X8NA 3OBTA 4Y1VA 4Q0QA 3ZFGC 5BNPB 4ZU5A 1OBNA 1S2EA 2HWB2 2MPFA 2ORZA 2WZR1 5LB6A 2YU1A 3QBQA 2Q8DA 1AR72 4QAWA 3B02A 1R1A3 2R072 2F6BA 1F31A 3O1RA 5I8SA 3LWCA 4MZUA 2VZRA 4K7JA 1IG3A 2BPA2 2BW8A 1RUD2 3MW4A 2D6OX 3D8CA 5FZAA 2PHDA 4XFCA 1PK6A 2XGXA 3WINE 5IT6A 2OZ6A 3WCRA 3JBG3 4ZHNA 3H8OA 3PVBB 4Q0PA 4QT6A 1UPSA 2AEYA 3AKQA 4GWMA 1ENQA 3DCQA 4GA9A 4J6GA 4MXWA 4XIOA 1Q8SA 1C3HA 1RUD1 1IZ3A 2WO7A 2DUPA 3GHMA 4L8QA 3MUZ1 2WYSA 4LQRA 5A7SA 1CJDA 1KS4A 5FQ0A 1NZCA 3AP5A 1Z7S2 3B7MA 4DUVA 3NV1A 1W8NA 3GYDA 3LDBA 4CDWA 3J4UH 4BQXA 2GC1A 3AJZA 2RG4A 1U5YA 2VL4A 3VDDC 3WEZA 4U36A 1WWYA 5KHGA 4I0BA 5A1AA 5I0RA 5KXBA 4TYSA 1V6JA 1U12A 3AZXA 4CUGA 3AZWA 2DBIA 3VBRA 1UY3A 3HBKA 1SPPB 4QXHA 2CWSA 4RQPC 2ZZJA 3J7MA 4AR2A 4B8EA 3RZLA 4AEKA 2QQPA 5HCFA 1NT0A 4AGRA 1AR82 1AYN2 4QPIC 4XCBA 3THDA 3WHTA 1O5LA 3B01A 4G9SB 5AC91 2A6WA 1MQTA 2W5FA 3MW2A 2RE9A 1H9PA 1EYBA 4DXTA 4WM8A 4GH4C 1UO9A 2GNMA 1AYN1 1FT9A 4CEWA 2RJ2A 1K42A 2ZGKA 1ZRDA 2JE9A 4KNCA 1ND3C 3KHBA 3WG1A 4ZZ8A 3H8XA 1UZ0A 1F8VA 5BXXA 2TNFA 4MO3M 4XIKA 4R9CA 5FBZA 4AI2A 1ULFA 4N53B 5FLIA 2LRPA 4LR4A 1S1AA 4AVAA 3J8F2 5C3PA 1CN1A 5DG2A 1RXGA 1MVQA 3MHZA 3VGIA 1I1EA 1XPWA 5AVAA 3FHQA 3TWIA 4NIHA 2JDYA 3AZVA 1UZYA 2OQ6A 4FOQA 1W6MA 3VBUB 2VC9A 4EYUA 4L11A 1S2KA 2IXHA 3WQ7A 2QQMA 3THCA 2VO5A 1FMD3 1PO21 4GJZA 3VL8A 4ET7A 5L19A 1POV3 2LW8A 1ZA4A 2RMU3 3ORJA 3WF3A 1X50A 1CJPA 3TB0A 1AXKA 1NXMA 5GKAC 1AYM3 1UY2A 1OA3A 3RPQA 1GWKA 1GZWB 3DF0A 4FTSA 2V73A 3RDIA 2DUOA 4OHXA 3D3AA 2Y8KA 4IEYA 5IHRA 4TLGA 4DEVA 4IEQA 2Y38A 3MLJA 1K45A 5ACA3 4Y24A 1CPMA 3POYA 5KHKA 2DVAA 1GZCA 1E5RA 1BEV3 4A45A 3KF5A 1FX5A 1RINA 2WNOA 1MEC1 3SCFA 1W8ZA 5FZCA 5K0UB 1UYXA 2VTXA 1ST8A 3IDEA 1G9FA 4NPLA 1VMFA 2VZUA 1QEXA 4L2NA 4Y20A 5SV5A 2W91A 3V0BA 5I0TA 5JSRA 2R061 1W90A 2VUJA 4QPGA 3H50A 2ZS6B 3NRUA 4ARYA 4AQTA 1OA2A 1PVXA 2BUKA 2QQLA 2XBO3 1V6MA 1IKPA 2QFEA 3HPNA 4HVRA 3RJRA 4FTEA 2C9AA 5JXIA 2XJPA 1ULDA 1SLTA 3IDAA 4IXLA 2EIEA 1VBD2 2HWE3 3W5MA 1TG7A 2P6HA 4QGMA 5FY5A 5C3QA 1NQDA 4L97A 1YI9A 4YW5A 1PVC1 3U4XA 2ZKLA 1Q5OA 2VOXA 4EN0A 4IEVA 2FBEA 3U14A 4YVWB 3VZOA 5F32A 5FWJA 1VBD1 3OEBA 1NY72 3POGA 4AGVA 3M70A 3OCPA 1YHFA 3OSDA 1IS4A 2BYVE 2DVBA 2W08A 5ISLA 1H2KA 2WZ8A 4HVQA 4UFMA 4DXZA 4HSLA 4IEPA 4AZZA 2JKXA 4YM3A 4NHMA 5FXWA 5FPLA 5J98B 1HRV1 4QMAA 2JDUA 5JZGC 1XRUA 4OMCA 3ZN6B 1JBCA 2DTWA 2Z79A 2OKXA 4XUTA 1US2A 4CDUA 3B94A 2TBVA 1GOGA 2WS91 1X36A 1XYPA 2XJVA 1P8JA 3BYWA 2VR4A 3DUIA 3OPTA 2X53S 3SH3A 2J1RA 4UFLA 3ZFEB 5HCAA 3AP4A 4CUAA 2Y6GA 4BIOA 4OI1A 3GZUC 1OI6A 5FZ6A 4EROA 3WF4A 2W1UA 4DFSA 3ABZA 5FZKA 2PHFA 3C8XA 2AUYA 4Q4V1 1ENRA 3TOJA 4AFAA 5GZGA 5DAVA 4CCMA 1GANA 1QQP1 2NM1A 2VOTA 3U10A 4GULA 5A1FA 1UXXX 2HEVF 2IWGB 2WFPA 3O7OA 3O14A 2ZX0A 3URFA 1Q8VA 3WG4A 5IJRA 2QQOA 4IDZA 1GQPA 1UX6A 4N90A 4OQ9A 3BB6A 2J1AA 2D5FA 1XNBA 2J1EA 3M3CA 5E8AA 1XSQA 1T6BX 2WWSA 3UKTA 1D0HA 2A3XA 2DURA 4DUWA 1CAXB 1JYWA 5J37A 1REDA 1KEXA 4AK3A 1AXZA 2JECA 3AB0A 5A3TA 3A0KA 4UFJA 3BI3A 3NV3A 4UFIA 1QJY1 1EP0A 4IV1B 5F5AA 3WF2A 4AHXA 1Z78A 4KQ7A 3OY8A 1XNAA 5LEKA 2ZGPA 3KVAA 3VHPA 3CJXA 2RDQA 2DFBA 1FV2A 2DCYA 3VBOA 3O1MA 5HV0A 4NIDA 3SH4A 4Y26A 1JI6A 4I0WB 4FTBA 2Y6LA 3PUHA 2WNUA 3NJYA 2ZCWA 3O0WA 3AMMA 1RVF3 3OGJA 4NAMA 5CKQA 3PMSA 5DUVA 4IGPA 4R4ZA 4WBBA 1YQ8A 2BVBA 4TTGA 3RFRA 3BIWE 2Q8EA 4FOWA 3MPPG 5C4WB 3FLRA 3MPBA 4Q1PA 4HFSA 1G86A 4JC1A 5H9PA 3M2MA 2HYXA 1PO13 1RMU3 5J3UA 3GHNA 5F39A 4NIGA 5L9RA 5CFCA 1LHNA 1JW6A 2V5DA 3JD72 2EAKA 3AMPA 1OT5A 1HXS2 4MX3A 4ES9A 4XUOA 2J1UA 4ARXA 4LITA 1XU1A 1Z0HA 2EIGA 4NHLA 5HI0A 2WBKA 2JDNA 2PAKA 4LBJA 4Y22A 1SACA 1O8PA 2BOJA 1YFXA 5T5LA 1HXS1 2ADEA 2JDAA 2ZHNA 1YJLA 3WUDA 2VAUA 1YWKA 3KM5A 1LR5A 1G9AA 2CY6A 3K75B 4FAHA 5ABJB 1W0PA 2E63A 3KCYA 2RS31 4EZHA 2VZ1A 2B46X 4LHLA 1NCQC 4MGZE 5FZGA 5FOJB 1WBFA 1XSRA 3HBZA 4XFGA 2X09A 3H8RA 1JYNA 1AXYA 3IMMA 4IE5A 4DUXA 2JG9A 2YZ4A 3GJAA 4A6OA 4E2QA 1W28A 2WFF1 2VW1A 1DZTA 1BBT3 2AYHA 2C4XA 3KT1A 4N8MA 5T54A 5C9AA 5HXMA 5JIAA
chains in the Genus database with same CATH topology
3LZZA 4YM1A 4AVCA 2Z5WA 3PVEA 1R091 2NPIA 5CU1A 4NPRA 4YZ1A 3ES1A 4B4QA 3AP6A 1ENXA 2UWAA 4YVSC 5DUXA 1DDLA 4EN9B 4PIZA 3ATGA 2HWD2 2WT1A 5JAXA 2X29A 4YM2A 3HR9A 3AFGA 4RS5A 2GH8A 1CAWA 1RUJ2 3WX5A 5BNOA 1B35A 4Q2FA 1R1A1 2HWD1 2EXHA 3E5XA 4C90A 4I30A 2K2SA 1BKZA 4WZCA 4O9GA 2ETEA 2GMMA 3BU7A 2W52A 4CP2A 3CO2A 2D40A 3E5QA 3JBG1 1J1LA 4AEDB 3H1WA 1RHI3 2BFUL 2WIIB 3CJIB 3B9CA 4P9YA 1RUG3 5FFOC 4M00A 3MF9A 2IXLA 4CEYB 1UPIA 4Q4X3 3LSEA 2HYKA 2BFUS 3M3EA 1AVBA 4M3CE 1JUHA 1NA1C 3VBFA 1VBE3 3ZFGA 4E2GA 1QXRA 2G4IA 2PA7A 5EWSA 5C8WA 2C1FA 1VAKA 3ENRA 3WW4A 4CTEA 2CGOA 2GNDA 2EALA 1SCRA 2R32A 2Z2SB 3ZYPA 4JCKA 1V6LA 1SBDA 2PLV3 3MYXA 3VZLA 5JSOA 1GKBA 4LHNA 4MGYE 1AL23 4B29A 1W6NA 1H8TB 2ZX3A 4KL1A 4YW4A 3LB9A 4ISRA 4AVSA 5J96B 3DPRB 3VDDA 3TN93 4Q0VA 5GZEA 4COYA 1F5JA 2KXLA 4RQPA 3WHUA 2HWC2 2WC2A 2WJSA 4JQRA 1QXPA 5LRSA 2O0OA 2YROA 2R49A 5CFDB 2KM2A 4QPIA 5J36A 1X82A 5EYXA 4M0HA 4AG4A 4Q4Y3 1MS8A 1IPKA 4MGIE 1SBEA 2PELA 3O5SA 1FMD1 3V0AA 4YFWA 2Q0AA 1POV1 2RMU1 2NMNA 1ND3A 5H9SA 1BMV2 3IPVB 1LOEA 4HSJA 3SMHA 4YNIA 2PYTA 4YARA 1AYM1 4RSUA 1LGCA 3WZ1A 4AVBA 1QDOA 4AHWA 5GLUA 3JQXA 4WVMB 1O5UA 1QOSA 1VBA3 1TEIA 3M7AA 5ACA1 4RR3B 1CAUA 5DZGA 4P9XA 3VBSC 3T1LA 2DF7A 1BEV1 1KXGA 4PIYA 1R082 4FXGB 3CF6E 1O91A 4YGDA 4ZU7A 1N1YA 1S55A 3WD5A 1LECA 2W39A 2EF6A 3I59B 4LEJA 1COV3 4FP2A 1QJX2 1K5MB 3W58A 1VBC3 1DGLA 5HBAA 2XKPA 4RL7A 1LU1A 1J3QA 2XBO1 5HCBA 2Q1MA 2B39A 2XPJA 3X29B 2CNAA 1DQ5A 1EPZA 3FFQA 3TNPB 1SLCA 2IXIA 4HK8A 4S2HA 3ME2A 3ILRA 5DZFA 5KC5A 2ZGNA 2VU9A 3PVNA 3O12A 1RUI2 1L3JA 5A32B 1W6PA 4OZXA 3SXWA 4XE9A 5JMCA 4MSVA 4UW6A 1DGWA 1TMF3 2DYCA 3B9IA 4CDQB 1CGPA 1POV0 5GJ6A 3IBMA 3FBMA 1EAH3 2LTNA 4DRVA 4Z92B 1UIJA 4HL0A 1ZZCA 1ZZBA 4H7LA 1GBGA 4QHBA 3SNMA 2VQ0A 2XJRA 4JGZC 5EXOA 3PJYA 3VN4A 4META 5CNAA 4RHV2 1WA4A 1PGW1 1NQJA 2DVFA 3DKWA 4GXLA 4MVTA 4HKOA 4Q0UA 2D6NA 3LKJA 1U5XA 4XHXA 4PLOA 2YDEA 3KQRA 2JX9A 2GALA 2QCSB 3WV6A 1PNFA 1ZZ8A 3OYWB 2HEWF 5GZFA 4YZ5A 3ZN5A 4K20A 4BM8A 1OKQA 1C1LA 4F8AA 1V00A 1IOAA 3S7EA 1PZ8A 2C5DA 3WOGA 1NYWA 2UYAA 4FPEA 1YFUA 1ZZ7A 4GB32 3VBOC 4N43B 1NG0A 2H0BA 5C8CB 4YLZA 1BK1A 2R16A 4ZXKA 1PIV3 3ZYGA 4LTAA 3EXUA 1VBB3 2A3YA 4OI4A 4YGCA 5LK5A 1T6GC 2PFWA 5A33A 3GBFA 4C0BA 4XF9A 1QWRA 2YMZA 3IWZA 1U5ZA 1RITA 5JCTA 3S7IA 2VOVA 3AXDA 2MEV2 4LHKA 2PAEA 3RG0A 4FPOB 5CFCC 1O3RA 4WZFA 1J1TA 3PLQA 5C6CA 1ZBA3 1DYPA 4GALA 1V9U3 4YW1A 1PZ9A 2MEV1 3AFKA 3GNEA 4DS0A 4XBNA 2O8QA 1AR93 2ZHLA 4OI2A 4KG0A 2YGLA 1RVF1 3THPA 2LALA 3IN9A 3VKOA 3ES4A 3C3VA 4B4PA 1HV1A 5T55A 2Y0OA 2GZWA 3KS7A 3TAYA 1I5ZA 1OOPA 4AE2A 1PO11 1MS4A 2Q30A 2GMPA 5F9TA 2W68A 3RS6A 3RYPA 4ES8A 4BA6A 2RR13 4D7TA 1TME3 4FPGA 2AREA 4Z2WA 1KFUL 4PF5A 3Q9OA 4BCUA 3M8LA 3OD0A 4NOTA 5KXEA 3IM0A 3BOWA 2VUAA 1IS5A 3OD4A 4TZDA 3NWKA 1ZYBA 3WP4A 1LHUA 2XVLA 3FMGA 1O4TA 2VW2A 4JGYC 4NWWA 2XVGA 3WUCA 1HQWA 3ZXDA 1S0IA 2Z42A 4EV0A 2XB6C 5J7MA 1D4M2 3LOBA 4NVPA 1BBT1 3L2YA 3N3HA 1A3KA 1JN2P 3HMYA 4Z07A 1PMIA 4Q29A 5DZEA 4LBQB 1D4M1 2Z69A 4TWTA 1DIWA 4GMP0 3U07A 4NN0A 3GF6A 1WW7A 2PHRA 1AR63 2F4PA 1DZQA 1RUE2 2UURA 2D97A 5D8AA 2JEMA 1UCXA 1ASJ2 1RUF2 4WVZA 3ZXAC 2LM3A 2RS52 4C91A 3VKLA 3VBHC 1NCQA 3EBRA 3KMHA 4GKXA 5JWPA 2WZR2 1ASJ1 4XJWA 4GH4B 3CLPA 4C0HA 2GSYA 3VBFC 3KGLA 5BNQA 2K9ZA 4BYYA 4SLIA 3FZ3A 4LBQD 1UL9A 1MZFA 3SHRA 2PN5A 2ZAAA 4HZFA 2ARXA 1MS1A 2AGSA 4RD7A 4BPZA 1JYIA 2ZX1A 3LSDA 2YYOA 4Q26A 5JLVA 1RHI1 4CYDA 5FOBB 1RUG1 4YW2A 1S0FA 3VV1A 4YVSA 4X8PA 1KFXL 1XNCA 3JU9A 3WDYA 5BNNA 1HIXA 4HMZA 4Q4X1 1RUC3 1ZRRA 3AKSA 5JI7A 2QKDA 4AQ6A 1H30A 1YYNA 3ZFFC 1KRIA 2ZAHA 1UF2C 2VMIA 2IFWA 4AGGA 5KHJA 1C57A 1WCDJ 1Q3EA 1MZ6A 4N7UA 4Y4YA 1ND2A 4IQPA 4LE4A 3AP9A 4XFFA 4BHPA 1V6IA 1GICA 3ZVXA 1U0AA 4WVVA 1SLIA 3GBGA 5AC92 2X5IB 2UYBA 3IDCB 1UIKA 1Y7BA 1AL21 3QACA 2W0XA 2EAAA 3MICA 4YFZA 1LCLA 4LBLA 2BVVA 3I4IA 2VVDA 3S0MA 4AI0A 2RS13 1NA1A 4HT1T 1S0BA 1SCSA 5GM0A 3TN91 1TE1B 1CVNA 1XE7A 4MV2A 5GLTA 1YIFA 2OZJA 3B5LB 3AX4A 4CP1A 1V6NA 2YPJA 1LOCA 5I8TA 2CGNA 2PHWA 4ORFA 4LUKA 4HK9A 2D3PA 2P3KA 4Q4Y1 1PO22 2RM23 4EN6B 1C8M3 4KGQA 5DXDA 1KS5A 2A6XA 5BNPC 4BWOA 1DHKB 1QXJA 1ULCA 1FOD3 4QU2A 4FPKA 4WM7A 1VAVA 3K48A 3ZIXA 5GALA 4XTPA 5GLVA 4NWVA 1WD3A 1MZ5A 4Q0SA 5J48A 1HRI2 1VBA1 4X6RB 1REFA 3SCGA 2Q1ZB 5JZGB 3GZTB 1MEC2 4UW4A 1HRI1 1LENA 4W6YA 4XFBA 1SDWA 3VZMA 1OQDA 4R4XA 1UAIA 3ZYRA 2WKKA 3L9JT 4HPKB 2B5HA 4KU8A 2NQYA 1COV1 1GQGA 2ZJCA 4B7EA 1VBC1 2R062 1GFF2 4LBMA 2HWF3 4JV4A 4IV3A 3VL9A 2DWRA 4KWJA 5TSWA 4XBLA 2VVEA 1FPN2 1LOFC 1V70A 1CPNA 3D6EA 2VNOA 3JQWA 4YZ4A 5J09A 1PVC2 4OHWA 4AFBA 1DZRA 2BQPA 4K9SA 3OPZA 4KH9A 3VBSA 3VZKA 1FPN1 3ZDSA 5K8SA 4M3CF 4K6BA 4HKWA 3ZSKA 5DDJ3 4KG8A 4XEZA 5I8YA 2ET7A 5L7OB 2YGMA 1KQRA 1O3QA 4M01A 4R8HA 1Q8OA 1QJU3 2FZ1A 5CA6A 2D7FA 1QMJA 2DFCA 4TSVA 4AFMA 4N53C 2JD4A 2H6BA 5JVVA 1RTVA 4EWAA 1EAH1 1TNRA 3LCPA 3ZSMA 1HRV2 4EJRA 3MIBA 3AMQA 2RHPA 3RI9A 2ZABA 3WG3A 2EXJA 2WS92 1MS5A 1H9WA 2BNOA 1FNYA 2PHUA 2WINB 5EZWA 1H1MA 4HKLA 5B2GB 2QZ3A 5LK7B 1H8VA 4BIFA 3USUB 1Q43A 4Q4V2 1ZBE3 1LB2A 2ZHKA 4N9IA 4XFHA 4E4DX 1QQP2 1C8NA 3I7DA 5CG9A 3VUOA 1D2SA 2XH6A 1IKQA 1MACA 4IL7A 3PNAA 1XXNA 4N7IA 4NHKA 1NCRB 3MIHA 5BPXA 2E53A 2R043 1XNKA 3P3NA 5IK4A 2BEOA 1N47A 4JGZA 2DCTA 1GYKA 4PDWB 5FREA 4M3CB 1PIV1 3APBA 4KWKA 1VLNA 1VBB1 5K0UC 5JPMB 5H9RA 5KHIA 2PAMA 1OHFA 1QJY2 1DQ4A 3ZXLA 2WNVB 1YI7A 1OOPC 1E57A 2WQZC 3JB8A 4C1WA 1QHDA 4GMP3 2P17A 1ZBA1 4JTNA 5SV8A 4QQHA 1V9U1 1CAVA 3ILFA 1J3PA 5D1IA 1AR91 4ITCA 3B00A 3UJQA 1VRH3 2GN3A 2B8MA 4KGGA 2GAUA 1PK6B 2Q8OA 1ONAA 1ENSA 4R9DA 4YVWC 4BMEA 4XTMA 2R6QA 4MXWB 2R0HA 4DZGA 4YGBA 1Y3TA 2AH2A 5FQ0B 1OMIA 2RR11 1TME1 4I3GA 1D0GA 3I8TA 2JG8A 5F5QA 4CDWB 1ULGA 4V1PA 4FQ4A 3UJOA 2DVDA 5A3LA 3ZO0B 1ALYA 4MYEA 4IERA 4AEJA 2WQ4A 3M3IA 3NV4A 3GZAA 1VAMA 5BY5A 2D6LX 2RS32 3VBRB 3N35A 2NLRA 4XF1A 1OFNA 2FMYA 3WY6A 2DUQA 3ZFEC 1GV9A 5D8AC 4OULA 4PBPA 1DQ2A 1SMVA 5DUWA 2JDZA 2B45X 2FQPA 2Y0IA 2WFF2 1MQTB 2JJ6A 1LGBA 4K8FA 4Y5Z0 1ZZ9A 3RRDA 1BVP1 4WM8B 3AKTA 1WW6A 2ZKNA 3FBYA 4CEWB 2IFRA 1R092 3CL1A 4UBHA 4DB5A 1O3SA 1LHVA 4OFGA 5JOYA 3FHIB 2VNRA 1H4GA 1AR61 2DCZA 1JUIA 1A8MA 4COWA 1RUH3 3S6PA 4F3JA 2NN8A 1WCKA 5FLJA 4JGYA 3JB4C 5E1RA 4U2AA 2XUMA 3IT8A 5BNNC 1N3OA 1W6MB 4LE3A 5L73A 4NO4A 1R1A2 1WMFA 1MS3A 1EV13 3EQEA 4IV1C 4UBGA 5AFEA 5IK8A 4RA0A 3KZ4C 1ND2C 2R1DA 3JBG2 2E9QA 4P9GA 2YXSA 4A7KA 3C2UA 1VIWB 2K0GA 4IESA 5T5JA 3R4DB 3POWA 4MGKE 5T52A 4Y1XA 2MNGA 4HBNA 4COUA 2PQQA 4Q4W3 1RUC1 3ST7A 3VBHA 3OTFA 5C4WC 2QJVA 4P9LA 2A3WA 2ENRA 1W39A 4FPYA 3HT1A 3WR0A 3WP6A 1KITA 1EPWA 2VXRA 1LKNA 2XL7A 4P9JA 3CEWA 4Y20B 4YSFA 3V0BB 1ZM1A 1GR3A 2HWB3 2G9GA 4FQZA 4QPGB 3AZYA 1AR73 1WW5A 4XOGA 2R073 5FMOL 2I45A 5ABJC 3RYRA 1X7NA 1N1SA 1RUD3 2YC0A 3HWJA 5CBLA 3NO8A 2RS11 4LLOA 3O0XA 1G7YA 3ZFFA 5FMOS 4MH0E 4XDQA 1FI2A 1J3RA 5FO9B 1CD3G 1H1AA 3H8UA 3AYEA 2CWMA 3ZPYA 4W65A 1YXWA 3AJYA 1Z7S3 4L92A 4WM7C 2WNEA 3MIDA 1S0DA 1H0BA 4UW5A 4XHBA 1JOJA 1LEDA 2WLQA 4CRQA 4PBOA 1FMD2 1UZZA 1C8M1 1W6QA 2D93A 2RMU2 1KJLA 4CDUB 2D6KA 3AM2A 1BVVA 1S0EA 4S2FA 1AR83 1AYN3 3AK0A 1AYM2 1FOD1 4FSJA 4XXPA 2WT0A 3VLBB 3NKGA 1ZRFA 2TEPA 2D98A 1VR3A 4BQ1A 3BTAA 1WLDA 3NAPA 3PJQA 5JR7B 1MS0A 2A5ZA 1FNZA 4GKYA 4IV3C 5ACA2 1R1ZA 2R0FA 2GU9A 3B3QE 5HXVA 3ZMOA 5K7PA 2CGPA 4AEDC 1AX0A 4Q8KA 1F5FA 1BEV2 1NXD1 2VH9A 3CJIC 3KD4A 1QKQA 3N4MA 1AX1A 1SLAA 3LOIA 3J8F3 4CEYC 2BTVC 5FO8B 1N1TA 4LO5B 1U5IA 5C33A 3HIFA 5BNPA 2ZGOA 4IEUA 3MEPA 3BOPA 2DTYA 3FWEA 2HWF1 2ZMNA 4HANA 5GZDA 2XBO2 3ZYJB 4RGAA 5JOZA 1QNYA 3WLUA 3UKNA 2SBAA 3OGGA 3WP3A 1IS6A 2HWE2 2ZGUA 4Z82A 4CDXB 1G6NA 3AKPA 3OY8B 2VOWA 2WT2A 1H2NA 3WDWA 2HWE1 3FUQA 2ZPXA 1HW5A 3VBOB 1HDKA 1H8TC 1CIWA 4Q1RA 2WNUB 4E9KA 4M0NA 1H4HA 2XWJB 5H9QA 1I6XA 1AZDA 4AWDA 2FHRA 4E4ZA 1LOGA 3A4UA 1BCXA 1KDKA 1YIPA 2JE7A 1LOFA 4QD2A 4KWLA 3KLSA 2WL1A 1RC6A 3QH6A 1GQHA 5FLHA 1G9CA 4Y22B 3H3UA 1PGW2 2IXJA 3BODA 3UL2A 4Z1VA 3ZYIB 3V64A 4JAAA 1UU5A 1ZBE1 4XETA 4XJ9A 1VBD3 3NW4A 1CX4A 1GZ9A 4URTA 4Q8LA 4XJZA 4N53A 1Y9QA 2JG9B 1NE6A 3ZN4A 1PHMA 2UWCA 3MIEA 5C9AB 1BJQA 5JIUA 5CIRA 2R041 3WQ1A 4EWEA 1GNZA 2E7TA 2BWCA 2O1QA 3VBUA 3LA3A 1QH6A 3SH5A 1GLHA 5FTTC 4XJ8A 3MI8A 1GNHA 2IZWA 4P5HA 1UU4A 2VW0A 1K5MC 1WMEA 4OHYA 2A6VA 2OYZA 4GMP1 4RS5B 1GZWA 1CAWB 5BNOB 2JG8C 4BMBA 1B35B 2OIIA 2P37A 5F1RA 2XHKA 4R52A 4XPVA 3FJSA 1RVF2 4COZA 1LOAA 1REEA 3AMHA 3WDXA 5FPZA 4OHVA 2G9FA 5JI9A 3U0ZA 1PO12 1RMU2 5K0UA 1WCSA 2LUWA 2B7YA 1ZREA 1QOTA 1WLWA 3LAGA 4FAGA 2ATFA 1RMU1 3VBFB 1MS9A 3ZFGB 4LBKA 5LEJA 4G3YC 4BH9A 3AP7A 1Q56A 4IEXA 4AW7A 1HKDA 1WBLA 3M3OA 4OVEA 2YUEA 5I93A 4AI1A 1QU0A 1RIRA 2OA2A 1DG6A 1YLLA 4A7ZA 1UN1A 2R30A 4OHZA 4YVWA 1BBT2 3AZZA 3WVJA 4ASMB 1TNFA 1N3PA 3QOPA 4XMIA 2E7AA 1VALA 1W6NB 3M1HA 3MIGA 1AX2A 3NL1A 4I01A 4LA3A 4OLLA 4OUMA 3KB5A 2ZA9A 1WGPA 3ELNA 4YG6A 3VDDB 4LO6B 2B9UA 2HJIA 1AUYA 1RUH1 1YFYA 1PM7A 3ZN6A 5CAZA 3OJBA 4YW3A 3JD73 4N43C 1PGL1 4RQPB 5C8CC 1HXS3 1I3HA 3PVOA 3ZFEA 1AF9A 1LRHA 3KSCA 2GNBA 2EA7A 5KWRA 2XLGA 2D44A 4GQ7A 1M4WA 4QPIB 5E88A 1SLBA 2Q4SA 1FV3A 4AFDA 3VZNA 1LU2A 2A71A 1CESA 3V0AB 1DGRA 3KT4A 4I3PA 1QNWA 1ND3B 1ZNPA 2XJSA 1YJKA 4IEZA 4ZU4A 1RHI2 4J1XA 1G9DA 3IIAA 4XJAA 1YFWA 5IK5A 1RUG2 1PNGA 3RZZA 2N7GA 5FAXA 3E5UA 4H7MA 4Q4X2 3K51A 3MFAA 4Q4W1 4X6QB 2EVXA 4AI8A 1VBE2 3ETQA 1KD7A 1CAXA 1CQ9A 5BV6A 3OBRA 1FAYA 1CAUB 5JOXA 2OW4A 4XILA 3MGUA 5T5PA 3AMNA 1B09A 1VBE1 1W0OA 4YGEA 4IV1A 1VJ2A 3WXPA 2ZACA 4BOWA 5BUVA 3FUOA 2UU8A 2HWD3 3N7LA 1VB4A 2PLV2 3SISA 3EO6A 3MF6A 4A3XA 2HWB1 4KBBA 1RUJ3 1AL22 3PTYA 4D7YA 1YUDA 1AR71 2R071 5KBFA 2P3IA 2PLV1 3WQ0A 1DQ1A 2ZBJA 4AQSA 4MUVA 5L36A 3O0VA 4K40A 4H55A 5C4WA 4B7KA 3TN92 4F7ZA 4JRLA 2D6PA 1V6OA 1Y43B 3BCWA 3I54A 1W6PB 4FOVA 2BBVA 2YY1A 1IHMA 3VZJA 1Z7S1 5EYYA 2ET1A 2GDFA 1PGSA 3NAPC 4D3WA 3R0RA 4A2UA 1S0CA 4Q4Y2 1JYCA 4PLMA 3ILNA 2GH2A 3J9SA 4TLFA 5ABJA 5IK7A 3V65A 4FOYA 2RJKA 1RL3A 3D0SA 4Y1YA 1OQ1A 4D69A 4LO7A 1AR81 2H0VA 4S2DA 2ZGMA 4LBOA 4XW3A 4K1ZA 5KXCA 1OLRA 1WD4A 1FATA 2NMOA 5KXDA 1XYOA 4RFT0 3ECQA 4FPFA 4FT8A 4OUSA 1RB8G 2PHTA 1VBA2 4QX5A 3T2TA 4G4FA 3VKNA 1QH7A 3IDBB 3WDVA 4RGGA 4PJYA 4YZ3A 1IPJA 5KHHA 3MLLA 2QZ2A 2JICA 3J8F1 5EV7A 1DF0A 2D43A 2HWC3 2CL2A 1COV2 3RI8A 4DY5A 4ATEA 1VBC2 1LOBA 3ALQA 3RQ0A 4CZSA 4K3UA 4AFCA 3ZSJA 2NYYA 1KDMA 5A33B 1O4YA 2ZGQA 2H6CA 1QGLA 1SLLA 1OSGA 4QM8A 4LT5A 2X5IC 1ULEA 2XWBB 4AEDA 3WW3A 1IGOA 4XZPA 4I02A 3CJIA 1RJ8A 4QPYA 1Q8PA 3ZSEA 3DV8A 1H2MA 1V6KA 2DCJA 1TMF2 4CEYA 3ZXEA 4P9WA 2UY9A 4PQ9A 1DU3D 5T50A 3RJ2X 3JUUA 2ZX2A 2ERFA 1EAH2 2UY8A 1TMF1 2SLIA 2DU0A 3SITA 1QDCA 1R083 5E89A 5GLWA 1OOPB 3WNXA 3JCIA 5GLZA 1M06G 4I2OA 1O3TA 3LA7A 3D0JA 3FLPA 1FXZA 1QJX3 4QQPA 1S2BA 4LUMA 3J26N 2HKXA 4H3WA 3PMEA 3WCSA 1UD1A 4EN7B 1O4ZA 2A6YA 3VBUC 1H8TA 1SBFA 3N7JA 3VHRA 3R6SA 4BZ4A 3H1MA 3MZHA 3DPRA 1PZ7A 1RUI3 1G9BA 4HVOA 3H1YA 3LGRA 3W9AA 4BLIA 2I2SA 3TYJA 4DQAA 1NY71 2HEYF 1VB2A 2VMHA 4B4RA 1JHNA 5CFDA 2GMEA 1YO8A 1PIV2 3FFZA 2VOKA 1JTZX 1BQPA 3FE5A 4FPLA 4XF4A 1APNA 1VBB2 2IC1A 4PLNA 1W6OB 4JDNA 5T3NA 2WZPP 3QLQA 3MLKA 5D8AB 2VNGA 1C28A 3MDPA 5I0SA 1UMZA 3IPVA 1RJ7A 4JVAA 3WDUA 1NCQB 2DCKA 4XQ4A 3L2HA 1ZBA2 4XJUA 2QDNA 4HETA 4RHV3 3T1MA 4WVMA 1V9U2 2CTVA 4GIQA 1D2QA 1AR92 3ZIWA 1X8MA 3OF1A 3N7MA 1RUNA 4RR3A 2ILMA 4F83A 4FPCA 1DQ0A 2KA3A 1XYNA 5CVRA 5LRRA 4DOUA 2BGCA 5L7OC 3D5OA 3EJKA 2RR12 4AYUA 1TME2 4Y1UA 4YVSB 1OFSA 3I59A 4GB33 2ZMKA 5BNNB 1HX6A 1K5MA 2ZGTA 1HLCA 3LA2A 4XMAA 1SQ4A 1LGNA 2QDRA 2IXKA 3P3PA 5FO7B 4CDXA 3VKMA 4COVA 4DY3A 1LTEA 4HN1A 1O7FA 2PHLA 4AHZA 1MR5A 1ND2B 1HQLA 1S0JA 2AZ5A 2ZMLA 4ASLA 1HV0A 1C5IA 1RGSA 2R1BA 3BPZA 3TBDA 2MEV3 5CG8A 2WLPA 4ONUA 1MZEA 3AKRA 1XNDA 3RMXA 5A32A 4YRDA 1AJKA 2DV9A 3D4KA 2VGDA 3UK9A 5JSPA 5CADA 2MHFA 1S0GA 1N3QA 4CDQA 3B93A 2XKOA 1I9RA 1KJRA 3HD8B 3ACLA 4YZ2A 2GNTA 5F6LB 3ZXKA 4OI0A 1NA1B 1AR62 2A70A 2ZOEB 5FPXA 3RWNA 2OUHA 3IKWA 4N9HA 5K9YA 3ZXFA 4MLOA 1NCRC 3HAGA 3R05A 3CNAA 2FMDA 4LA2A 3JD71 4DRRA 2B42B 1YRZA 4FXKB 1LODA 1QY4A 4PDWC 1XQNA 3ASIA 5DUUA 2UWBA 3MIFA 3R4SA 4AQ2A 4HLTA 1LHWA 2VQAA 2WNVC 1H2LA 4XBQA 4LO4B 4AVTA 1NLSA 1UKRA 4YM0A 3OYWA 4JTOA 3G6JB 1IQAA 1D4M3 2PHXA 4WM7B 3H7YA 3ROUA 1ZVFA 2VY0A 2NP0A 1WW4A 2IXCA 2O8OA 4N43A 1RUC2 3ZMNA 4XYXA 1PK6C 5C8CA 4AVVA 4BLJA 4CP0A 3E6CC 1OQEA 1OD5A 1RUE3 2VMGA 4AI3A 1N1VA 2I74A 2ZGSA 3RMYA 4AHYA 1ASJ3 1OA4A 1RUF3 3AXEA 2RS53 4QXKA 4R9AA 3ZSLA 4LBNA 4CDWC 3ZX7A 3BALA 3E6BA 5EJ3A 1BXHA 1DFQA 4D7SA 2WZR3 5EFUA 2P2KA 1RUJ1 3R4UA 2BWAA 2ZTNA 2X8KA 3FLTA 4P14A 2ARBA 4IV3B 3VBRC 2I07B 1YCIA 1BZWA 1C4RA 3SLIA 2NZ9A 1WUVA 4A7YA 2RS12 1J59A 3NSTA 3HT2A 4XXAA 3SCHA 4P9IA 3MW3A 1C1FA 1MQTC 2DVGA 2XJTA 2D3RA 3VBSB 4BE3A 4WM8C 4E2SA 1OPOA 3KT7A 4UXAA 4PIXA 4CEWC 4Z8BA 2A6ZA 1HQNA 4LO8A 5E16A 3N7KA 3E6DA 3E97A 2E51A 2RM22 1C8M2 4DMIA 3G7DA 3W59A 2QUOA 4L9BA 4QQ2A 4W6WA 1A6CA 3NJZA 1DGWX 1FOD2 2RM21 2V09A 5AC93 5I91A 3WDTA 1ZX5A 4Y1ZA 3CU7A 1XE8A 4YG0A 4W6XA 4MXVA 3B69A 4L99A 3AYDA 4QGLA 2DU1A 4LBQA 4AEMA 1LULA 1SEFA 3MFCA 1F2NA 3HN1A 2WSUA 3H3ZA 3WP5A 4WVWA 4QQOA 4JDMA 3DL3A 5FDBA 3RNSA 3PHMA 2GC0A 2HWC1 4DPNA 4FO9A 4NR1A 1DQ6A 1NOVA 4JGZB 2OPKA 4FP3A 4GH4A 1X33A 2HWF2