3B94A

Crystal structure of human gitrl
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
120
structure length
102
Chain Sequence
EPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAFEVRLYKNKDMIQTLTNKQNVGGTYELHVGDTIDLIFNLKNNTYWGIILLANPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human GITRL
rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Tumor necrosis factor ligand superfamily member 18
total genus 15
structure length 102
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3b94A00
4MXWA 5L19A 3TYJA 2R6QA 2JG9A 1PK6A 4MXVA 1U5ZA 1PK6B 2HEYF 2RJKA 2WNUA 4OULA 2AZ5A 4G4FA 4E4DX 2WNVB 1XU1A 3B94A 4TWTA 1TNFA 5TSWA 1A8MA 4QPYA 1JH5A 4RSUA 1OQEA 4DB5A 5KC5A 3V56A 4KG8A 5KC6A 2E7AA 2WNUB 4G3YC 4TSVA 4QQLA 5HBAA 1GR3A 3URFA 1C3HA 4N90A 4F3JA 2OIIA 1U5YA 2QE3A 1DG6A 5CIRA 1D0GA 4D7YA 2WNVA 2R30A 2JG9B 3L9JT 2Z5WA 2Q1MA 3IT8A 4J6GA 3B93A 2WNUC 5L36A 2R32A 3MI8A 1WCKA 3K48A 4GIQA 1RJ7A 3WD5A 2JG9C 3K51A 1IQAA 1KXGA 3TWIA 1TNRA 3AB0A 4MXWB 1XU2A 4QQHA 1C28A 5KWRA 1OQDA 4DOUA 2ZJCA 2HEWF 2JG8B 1D2QA 2HEVF 2KA3A 4QQPA 3ME2A 1KD7A 2RJLA 2WNVC 4NN0A 1S55A 1PK6C 4KGGA 4HT1T 2ZPXA 3LKJA 1JTZX 3QD6A 5BNQA 2X29A 1OSGA 2RE9A 4QQOA 3QBQA 4QQ2A 3FC0A 2O0OA 2QDNA 4OUMA 4OUSA 1RJ8A 3B9IA 1D4VB 1ALYA 2TNFA 2JG8A 4MSVA 4EN0A 1O91A 1I9RA 4KGQA 4E4SA 2Q8OA 2TUNA 3ALQA 2JG8C 1U5XA 1DU3D
chains in the Genus database with same CATH superfamily
2F6BA 2WC2A 3BODA 5JPNB 2YU1A 3ZYIB 5A6XA 4K8RB 2YDEA 1TG7A 2YFUA 2R063 2C6SA 2X09A 3M8LA 3NV1A 3KV9A 4IEVA 4DXZA 1SMVA 4MG2A 3NO8A 1AJOA 1S0FA 4KBZA 5CEHA 1A8MA 4WM8C 3EB7A 4AFBA 4OHYA 2BDRA 1PO11 4BDVB 2Z42A 2ZACA 1N3QA 2IXJA 3PUAA 3RMXA 1ZA4A 1PHMA 4Y1VA 3FMGA 4Z92B 3VUOA 4RGKA 4QQLA 5T54A 4LIVA 4AVAA 3H8RA 1QOOA 1EUUA 3FLRA 5CFDA 3ZX7A 4AQ6A 4WM7C 4QPIB 1U0AA 1XE7A 2G9GA 1GBGA 1U12A 2JB8A 4YARA 4I0BA 4L2NA 3BTZA 4L9BA 5EJZB 3LQCA 5EV7A 1J58A 1HDKA 5CZKA 2BWCA 3WZ1A 1CAUA 2NMOA 1C8M2 1X50A 4U36A 2FMYA 4LHLA 4AK3A 4I3PA 5T5PA 1CVNA 4IGQA 1OUSA 2YG0A 1JZ3A 1DYKA 2W5FA 2XBO3 4IE4A 5FZ4A 5KHGA 1W8ZA 2YBSA 2GNBA 2OYZA 2JDNA 3IWZA 1O5UA 1GSLA 1IPKA 1R1ZA 2K2SA 3GJBA 1CN1A 5CNAA 5L36A 3KT7A 4OUEA 2VXRA 4QKBA 1M4WA 1XPWA 5DAQA 3UETA 3K48A 1KQRA 2WZEA 4Y20A 1UZVA 5GLVA 4CP1A 4AEJA 3VD3A 5JI7A 4XZUG 3ZFFB 5JOXA 3UKTA 3GBWA 1KDMA 4PQQA 5DAWA 4BLIA 1DZTA 3V0AA 4LLFA 2D3PA 1EV12 2AC1A 3GDBA 4AOCA 4CRQA 4QQHA 2MEV2 3F95A 1T6BX 2WO7A 3H3UA 2A73B 1MZFA 3VBFA 1LHWA 4LHSA 3GZTB 1NY72 3VBUA 2OXBA 3W58A 3AP7A 1I5ZA 3RNSA 5FKCA 2E32A 1ND2A 4QKDA 4XUQA 1W9SA 2CYFA 3WW2A 3EXUA 2RDNA 1UU6A 3IIIA 1ZBA3 4YVWB 2WRAA 3IBMA 1QQP2 1SDDB 1IG3A 3B5LB 3U75A 3BKZA 3DXUA 3TRSB 1G9FA 3IAQA 4W6XA 2E51A 3I3QA 3V65A 1JOBA 2VUCA 4HVRA 4XFFA 4ZPIA 1YNAA 2ZX4A 5EYXA 5K7PA 1Z7S3 5A32A 4WM7A 3BGAA 1B35A 5IFPA 3USUA 2GNMA 2VECA 3ZN6B 2X53S 2HWE1 3ZYJB 4LQRA 3I7DA 1BVP1 5FDBA 4LR4A 1MZ5A 3ZFEA 2CWMA 3WNLA 1JODA 1WCQA 4UF0B 5FJKA 5A7PA 1SCSA 5FY4A 1LHOA 1MR5A 3VBOB 1OURA 2R1DA 3VZMA 4FOVA 2SBAA 5ACA1 1H1IA 3UGGA 1LOBA 2P3IA 2E63A 2GU9A 3DGTA 4QM8A 1U5XA 1OPOA 1GU3A 1Q8QA 3GYDA 5F6LB 1FXZA 2ZMNA 5L19A 2EAAA 3NWKA 4EN8B 1LECA 4BZ4A 2JDHA 3Q8FA 1R64A 5FP9A 3RZKA 4K40A 3LD8A 4V1PA 1HB2A 4OULA 3DECA 4UW4A 2WNVB 1QOTA 1RUH1 4LO8A 3NJZA 1N3PA 1XQNA 1ZBE1 2ZEWA 3VKMA 1R1A3 4BK5A 4D7TA 5BY5A 5LA1A 1EAH1 5FPBA 5HXMA 1BLZA 1DZRA 3B3QE 4LE3A 1QJZA 3SH4A 5GLWA 1OOPA 4G3YC 4OMCA 2ZEYA 3TEWA 2Y6GA 1BKZA 1RUE2 2R49A 3P6BA 4XXPA 4CDWC 1RB8G 3WW4A 2IXHA 1JS9A 4HK8A 4A4AA 2XJTA 2E26A 1O3SA 1IHMA 1ZZBA 2XH6A 4ZHNA 4K3UA 2QDRA 1D0GA 3ACIA 4FP3A 3U07A 3VKFC 4WVZA 2VAUA 1COV3 5FWEA 4AVVA 2A6YA 1BMV1 3QH6A 3GNEA 3CJXA 1SQ4A 3CJIB 3KZ4C 2PAKA 3LGRA 1F8VA 1L3JA 3VBSB 1E5RA 3AKPA 3IB3A 3AMQA 3MI8A 3ELNA 1LHVA 1XNTA 2DVDA 5A7NA 2ADEA 4HK9A 3OPTA 1UL9A 1BXHA 1OKOA 3SHRA 1LOEA 4UAPA 2D6NA 5DABA 5CG8A 1JYIA 1ZRRA 4TN7A 1FAYA 3ES4A 1UOGA 2O14A 4AHXA 2GALA 5CKMA 4YG3A 1QJX2 1W99A 3ABZA 4F83A 3OBRA 5E6HA 5T50A 2VQTA 2KM2A 1XYPA 2BFUS 4BIFA 1QJX1 1SEFA 3NJVA 1PO12 1FPN3 4QPIC 3FX3A 4UF0A 5D8AA 5FRAA 1FV2A 3ZDSA 3BTYA 5FZ7A 3ME2A 5IAVA 3AYDA 4COWA 3O0WA 3OUJA 5A6ZA 1YFYA 4Q1PA 5FY9A 1BYHA 3LA7A 2J22A 2R071 5FYSA 3LSDA 4D94A 2R7EB 4EV0A 5C3OA 1C8NA 1HRV2 2EALA 2GP5A 2ZMKA 5GZCA 2VOXA 2W46A 3RRDA 3K3NA 4OMDA 3JD72 2B8MA 4DUWA 2FQPA 2FDHA 2OUJA 3D4KA 4KL1A 1VBA1 2VY0A 3K75B 2YB7A 5FWJA 1NE6A 2A6VA 4BOWA 4AG4A 4AFCA 5BPXA 3HQXA 2JX9A 2WZPP 1PNGA 2JXAA 2WN3A 3B01A 4YW6A 4CCEA 3U11A 4IV3A 4YW4A 4CEWA 4EZHA 5SV8A 5IK8A 1DLCA 4O9EA 4UFKA 5FYVA 1QMJA 5A80A 1RMU3 3ZYBA 2WO3A 3AC0A 4KBBA 5C8CC 3D0SA 3AKQA 3K77A 4MSVA 2YGMA 2RM22 4IV1A 1EPZA 1PVC3 2PHFA 4Y1XA 5BNOB 3LF7A 3KQRA 3PUIA 1UD1A 1EY2A 2HWD3 2VULA 2PLV3 3ALQA 2IXLA 2P4EA 3GZAA 4M0NA 1BVVA 1PGW1 3MHZA 3FZ3A 1TE1B 2Z79A 2A3YA 4KMQA 4GULA 4HZFA 4X6QB 2PHWA 2CGPA 3TYJA 1F31A 4RS5A 1G6NA 1PK6A 2R1BA 2EA7A 3ZFGA 3EHKA 4Y20B 4ES8A 3VDDC 2HWC2 1RUOA 5DZFA 2WNUA 1CIYA 3J9SA 3M7AA 3MIBA 3VL8A 3ZLIA 5DDJ1 2E33A 5EXOA 3UJOA 3ZFFC 1VBD2 1UYPA 2HWC1 5H9PA 1KITA 2XQXA 1KJRA 4AVCA 1URXA 1RXGA 4XAEA 3KCYA 3ZSMA 3N9LA 5IVFA 1AXKA 2RR13 3WP5A 4TSVA 4XF9A 3BCWA 3ITQA 4A41A 2WFF2 4WVWA 3VD7A 1W8HA 5JXIA 4MX3A 2OIIA 1DG6A 1VPHA 1K5MA 3CF6E 5D8AC 1WCSA 1TME2 1ULPA 4JDNA 1OA4A 2D44A 3ZSJA 1RTVA 2ID4A 4B29A 5JOZA 3I3EA 2P3KA 5T5LA 4ARYA 3QOPA 4HVQA 3CZJA 5J3UA 3RZLA 4P9JA 1OHFA 3I59B 3WCRA 2DUPA 1OMIA 4Y1UA 1RHI3 5DQ0A 3USSA 1OH4A 3Q8AA 4IDZA 1J84A 3ZYFA 4UFHA 4AFMA 3BI3A 1PO23 3WD5A 1NLRA 2AUYA 3K51A 1FOD2 1NA1B 3B02A 4BM8A 2OUHA 5HI0A 2HWD1 1F4AA 4O65A 3WINE 1ZZ8A 5JXGA 2VZQA 4N53A 1D4M2 5KHJA 2E7QA 1JYCA 2UY9A 5F3IA 4AZZA 4QX5A 1RGSA 1XE8A 1RUC2 3GCXA 3N7KA 2VZTA 1GFF2 1IPSA 3KVBA 1VP6A 2GDFA 2QQJA 4UXAA 3LEMA 4Y1ZA 5B4XA 1LOFA 1PIV2 5LEJA 4XCAA 3O1TA 3M3IA 2A6WA 4WM8B 2Y6JA 2CY6A 2H0VA 4Q4Y3 4P9IA 2VBBA 2J7MA 2DCJA 1Q5OA 4ISRA 3ZFGC 1O7FA 2D5FA 2LUWA 3OG2A 1AL21 4JDOA 4YZ5A 5SV5A 3CBNA 1K5MB 4HANA 3J26N 5FZ1A 5BNQA 4LUKA 3OF1A 3TEXA 4FPEA 5I0DA 3O1RA 1XYOA 1S0CA 4YG6A 3ZMNA 3NW4A 3D82A 3A22A 2CGOA 5C7GA 4QKNA 2EAKA 1FNZA 2ZMLA 3OYWA 4X8PA 2CU5A 2PN5A 3KT4A 1GMMA 2DYCA 2VOKA 5C33A 3RWKX 2BPA2 1GQHA 2JG8A 1W8WA 2HLEA 1HKDA 2ARAA 2DCTA 1SLTA 4P5YA 3QACA 4JAAA 5FIXA 4KGQA 1C8M3 1F5FA 2D3RA 3K4AA 2JICA 3DYPA 2ZTNA 4CUCA 5JIUA 4XJZA 1XBFA 2RMU1 2R042 2V73A 5DDJ3 4NRPA 3E5QA 1W8FA 2WS91 4SLIA 2EIDA 4AVSA 5F5IA 1RUH3 5JDBA 3U78A 2HWF3 1G9DA 2L9LA 1UOFA 5FZGA 2WS92 2QQNA 5FZBA 1NCRB 2JIJA 4XW3A 3ZXGA 3UKNA 4GMP3 2I74A 3NV4A 4LULA 2NZ9A 1AHSA 3B00A 2XQRA 4ET7A 2PLV1 1W6QB 3MLJA 2Y34A 5FUNA 4PDWA 1XNCA 1EUTA 1XNDA 5DAPA 4OI2A 3R4UA 4HVOA 1A3KA 1NUKA 1OQEA 1EV13 3O12A 4JGZB 3DYOA 5GALA 3FUQA 4E8CA 3LDKA 3IDAA 1BEV1 1VBA2 1IS4A 2DDUA 4GB32 5FLHA 2W39A 1AL0G 5FYCA 5CYYA 5JWPA 1CZSA 1OC1A 2DCYA 3H1MA 2QCSB 5LK7B 3R4SA 1PGL2 4KQ7A 2ZGSA 2PHDA 1YFWA 1T2XA 4D6SA 3BUCA 1HLCA 2LROA 4F7ZA 1NQDA 5GZEA 2B9UA 1ND3B 1MS4A 4RHV3 2XKPA 2HYKA 3FLTA 1SBFA 4A7ZA 4M00A 1VRH2 5FPXA 4QB6A 2TBVA 4EWEA 3FJSA 3GHMA 2WNUC 3POIA 3NL1A 1XRUA 2GH2A 1O4YA 2VR4A 3BTAA 4RR3C 1YWKA 1LEMA 3O5SA 3N9NA 4XMAA 2CGNA 2CL2A 4CUBA 1OFSA 1AYM3 5D2AA 1NA1C 1SCRA 2JDUA 2YHJA 2Y38A 3DKQA 4CXYA 4XURA 1GQGA 4ZONA 1KFXL 2VMCA 5AFBA 3WF0A 1J1LA 3MIDA 3VZLA 4ZU4A 3T1MA 4XILA 1F35A 1QJU2 1AL23 1EP0A 3ENRA 4B4RA 1RINA 2IFWA 4JC1A 2ZGLA 5FQ0A 2XBO1 3AFKA 4Q0QA 2ETEA 1POV1 5FZ6A 2GMMA 5FZAA 1NKGA 4BMBA 1UX6A 4CDUC 2AYHA 4JRAA 5F2SA 3MDPA 4CDQB 4GWIA 1HJFA 4QU2A 1S0BA 1UYXA 4XDPA 4PBOA 3TNPB 4ATFA 2ZGQA 1UIKA 2WO2A 1E5SA 2ATFA 5A6YA 1S0JA 2YC4A 1OOPB 5FYZA 3IKWA 1OLQA 2QZ3A 1QNYA 2WZR3 3DUIA 1RYYA 3LDRA 4LBQA 1OSGA 4WZCA 3HR9A 3IMMA 3ZFEB 3OGGA 1OD3A 4FFGA 1WCDJ 4QX8A 3ZXFA 1H4GA 4PBPA 4NHXA 1X33A 1NCQC 2QVSB 2Q4SA 3ES1A 1B35B 3VKNA 3T4VA 5CADA 3DYMA 2ZEZA 3BPSA 4NHKA 1AX0A 2OVUA 3LOIA 1COV2 4E4SA 4LIUA 5LA2A 1X7NA 2CDPA 3RFRA 1ULDA 2NM1A 2VMDA 2O8QA 4XTMA 4FSJA 3AP6A 1COV1 5C4WA 2WLPA 1W6QA 4FBFA 1D0HA 4IEWA 5FLJA 5FPUA 4E4HA 3UYJA 2PHLA 3N9QA 2CTVA 5FMOS 4YZ2A 5BNOC 5JSOA 1MZEA 1CR7A 2ARBA 3POBA 5FZHA 3U1XA 5C8WA 2D97A 3VDBA 1H9PA 4XQ4A 2AZ5A 4G4FA 4GKXA 3D6EA 1ZVFA 3ACHA 4QXKA 2GMPA 3N4MA 4EN7B 1HRI1 4NRMA 4UW5A 3U10A 4IQPA 4JCKA 4ASMB 5I93A 3POFA 5C3QA 2P17A 3LOBA 1WUVA 2Q0AA 3EMRA 5L7OB 2WABA 1JU4A 1YQ8A 3PVOA 1RITA 2BBAA 3T0BA 1VBE1 1MS9A 3DV8A 1NLQA 2YBPA 5J98B 5FP8A 4HPKA 1ZYBA 1V6LA 4XDOA 5FP3A 2VTFA 3GZUC 2Q8CA 2I45A 5IHRA 3MFAA 2RDQA 2XJRA 1NCRC 2E9QA 2ORXA 3HT1A 2VNGA 4XFAA 1KDKA 1W6OB 3HPNA 3LSEA 4Y4YA 4IEUA 3VD5A 5EZWA 1N47A 4IE6A 2SLIA 4ASLA 1W2AX 5CFCA 2VMFA 5JZGB 2XUEA 2P2KA 3MGUA 3NAPA 1GZWB 2B9VA 3WF2A 1EAH3 4UW6A 5I8YA 4RL7A 1BK0A 4FP2A 4IW3A 3ZFFA 4AI2A 3B69A 3PMSA 4LXLA 5A3TA 2BVBA 2VNOA 3RVHA 3WR0A 2BYVE 4CA9A 4PDWB 1V0AA 2O8OA 1DDLA 2ZAHA 2LRPA 4UFMA 4IGPA 2PQSA 1XNKA 2NN8A 5FZFA 3KVAA 2JKXA 1LR5A 4RS5B 4YGDA 1NE4A 2WINB 3R05A 4OHWA 1Z0HA 2G1MA 3NV2A 5HV0A 4FPOB 2VW2A 3ACGA 4XFIA 3CU7A 3VBHA 1ZM1A 5A33B 1IZ3A 1XYNA 4OYUA 2B39A 2JE9A 3POYA 4QX0A 1ASJ2 4M4RA 1ZZ9A 2DBNA 4YM1A 5DUXA 5D1IA 4QGNA 4DXTA 1Y9GA 4QGMA 2QKDA 2UU8A 1TMF2 1R091 2VL4A 3FN9A 5FMBA 3NVCA 4G9SB 2PAMA 4HPKB 5FPAA 4MZUA 3WG3A 1ND2B 1S0EA 1VE0A 1LRHA 2WFF3 1JZ2A 2FDKA 1KS4A 3WF3A 1R092 2W1WA 3H9AA 1RC6A 1HB3A 1NXMA 3KB5A 1WCUA 4DO0A 3ZMOA 5ABJA 4YVSB 4NRQA 2GN3A 1Z7S2 5A33A 2LTNA 1H1MA 3CKHA 4NIHA 3HAGA 3KCXA 4IEYA 5FZLA 5FJHA 3A4UA 2OZ6A 5F3GA 1LODA 1H0BA 5DN2A 4EWAA 5IATA 3OD0A 4MGIE 1H8TC 2H0BA 5BUVA 5LB6A 5A3WA 3P5BA 4GH4C 4XQDA 2ILMA 4IV1C 1SLAA 4JX0A 2J1AA 2RG4A 3RSJA 4AL9A 3PNAA 3VL9A 4FQ4A 5J36A 5L7OA 3DN7A 4R4XA 5IK7A 3WV6A 1NG0A 1RHI1 1UY2A 2R073 5J96B 1NCQA 3E1F1 3IDEA 1V6OA 3MICA 1VBB2 3IPVA 2X8KA 4N9IA 1RUD1 2VZOA 1DGRN 1SLIA 2WAAA 2QQOA 4DY5A 1FMD3 4UYBA 1W8OA 5FZOA 1UU5A 1W2OA 4BJ0A 1R1A1 1DGWA 1W03A 1QXRA 2D40A 4TXWA 1FYUA 3IM0A 1XOYA 5CIRA 3BU0A 1OBNA 1R1A2 5IVJA 3O1UA 1LEDA 1JZ5A 4QX1A 1UIJA 5KR7A 5DAXA 2G19A 1ENSA 2BU9A 3L9JT 1VB4A 3CO2A 4LK7A 2W47A 5LK5A 4PLNA 1W0OA 2JENA 2XMLA 1MQTC 1QF3A 2ZGNA 3PVBB 2PMWB 1GANA 3T09A 4COVA 5JPMB 1FNYA 2FZ2A 1R082 1PVC1 3FUOA 3AYEA 3S7IA 1RUJ3 3U14A 1WCKA 5LBCA 1IS3A 3ZYGA 5IVVA 2VCBA 3MO4A 3N7MA 3QLQA 4E4ZA 1SFPA 2X5IB 4O9GA 2WDBA 2HBUA 2X10A 1GLHA 1V70A 4PI0A 3SCFA 3VD4A 4LITA 3WHUA 3AB0A 3FHAA 4R9AA 4K21A 3MPPG 5GLTA 4EN6B 4BU2A 3RWNA 5T55A 4RR3B 3VV1A 2EXJA 1JOJA 3ZXDA 1HRI2 3AZWA 3WCSA 1AX2A 1UXXX 4QKFA 4Q0UA 1M06G 4XFBA 2PHTA 2XUMA 1D2QA 4IEQA 5F7UA 3C7OA 1HRV1 3KD4A 2VH9A 3CIHA 4LJHA 4R8HA 4PLOA 4A44A 3E6DA 1LGNA 1O4ZA 1RUH2 4BE3A 1F15A 4IUGA 1Y9MA 2MPFA 4AFDA 2WS93 4LEJA 3WG1A 1UY0A 4W6WA 2VW0A 1G9CA 1AYN3 4RGGA 2RS53 1HV0A 4FVVA 1BHGA 1F4HA 3JBG3 3LKJA 1LESA 3M3QA 1OLRA 4AGVA 2EF6A 1LGBA 1BJQA 1J3PA 4UT5A 4YFWA 4QQOA 3AKRA 1US3A 1VBC3 4GB33 4XFGA 3SQOA 2ZGMA 4AEDA 4Q4W3 5A32B 2QDNA 3KMHA 3ZIWA 1JUHA 1WBFA 2A1XA 4IL7A 4CU9A 1BMV2 1DP0A 2Y8KA 2UY8A 3FWEA 4EROA 4B4PA 3SEEA 3BB6A 5J48A 3I2DA 1JBCA 2DVBA 1I9RA 4LE4A 2D3SA 2Z4FA 3HBKA 4XJAA 2Q30A 5HCAA 3QH7A 4NIDA 4BQ3A 5I8SA 5GM0A 1V9U2 1SG3A 4YGBA 4QPGC 3H1YA 5A7OA 4XF3A 4BLJA 3J8F2 1CZVA 1MVEA 3WG4A 3DKWA 4CDUA 4QMAA 3U4SA 4MV2A 3H3ZA 3M3OA 4Y24A 4KU8A 2RM23 1QWRA 4DMIA 2WQZC 2XR4A 3U0ZA 1OPMA 1W05A 3JXSA 1O59A 2PHUA 2VE1A 3A23A 3PMEA 3JU9A 4NPLA 4TWTA 4ZZ5A 1JZ7A 3ZSKA 3W21A 1AYM2 5JMCA 4H3WA 3N9OA 1Q8SA 4Q4Y1 5DXDA 5IK5A 1OD5A 5CKNA 1GKBA 4XACA 4AGGA 4MVTA 2PFWA 3I4IA 5J37A 1AYM1 3NNGA 5FZIA 3P1IA 4KH9A 4AGRA 3RZMA 4YM0A 3T0AA 5FY5A 2ARCA 2F4PA 3OGRA 2DV9A 4Q4X3 2A5ZA 3DPRC 5BYNA 3ZN5A 5IJRA 4AEDB 1WKYA 1BBT3 4L97A 2RMU3 2OT7A 2RS51 2NYYA 3NJYA 5LEKA 5JI9A 2AGSA 3B7MA 2CV6A 4S2FA 4BQ4A 3AZYA 2VOTA 2FDFA 4YG0A 4NO4A 2XJVA 1PM7A 1YJLA 4MUVA 1Y4WA 2ZBJA 5EP9A 3ZIXA 3A21A 3AKSA 1RVF2 4JKMA 2BZDA 5L7OC 3SMHA 3WNNA 1UMZA 1MEC3 3LIHA 3NNFA 2TEPA 3S30A 3TEYA 1YC61 3ZSEA 2ZZQA 3E6CC 3C7EA 4LA3A 1CX1A 3GGLA 3ZYHA 4FPCA 3I2GA 1XU2A 4MGZE 3HBZA 4IERA 3ZKYA 4AI3A 1C28A 4C1XA 1W28A 4OI1A 4L92A 5FO9B 4D6RA 1RHI2 2C9AA 3WW3A 5C9AC 2W2IA 4M3CA 3WP6A 5CB7A 4BXSV 2MHFA 4YW1A 4UI9L 4Q27A 3WNOA 4DIQA 3W59A 2XJPA 1AR83 2RS33 3CEWA 3MFCA 4JRLA 4LBJA 1QXPA 3WEZA 1UO9A 4C91A 4CPBA 1GZCA 4MHRA 5A1FA 2A7AA 3MUY1 4R52A 4UWDA 3T0DA 2I07B 4S2GA 4AVTA 1QJEA 1H8VA 1RUI2 2CWSA 2BRTA 5LATA 1YQCA 3I2HA 2WL1A 3VB9A 5C5UA 3MW4A 3GBGA 4LKDA 3UGHA 1WLTA 3VZJA 1MS8A 4AQTA 5AC93 4AEKA 5F2WA 3I49A 1XJAA 2HH9A 4H14A 1TME1 1AXYA 3AXEA 4FFHA 4FPKA 5F9TA 1JZ8A 4CPBD 2PA7A 4OLLA 5BV6A 2A6XA 3LEGA 5FO7B 1WMFA 2KXLA 4IE7A 2GSYA 5IT6A 1F9KA 3P3NA 4NWVA 1PGL1 2ZX2A 1MPXA 4ES9A 1Y3TA 3L2HA 1ZREA 5EPAA 3PUQA 2RDRA 1AR92 4Q4V1 2D6PA 2EIBA 3VHPA 3ORJA 2WYFA 2DCZA 2P34A 3PVNA 4NPMA 4OI4A 5F8PA 3WNPA 1OA2A 4CCNA 5C3SA 4I3GA 1U5IA 3E6BA 4MXWA 4Q4V2 5ACA2 4DPNA 4LLOA 1LAJA 1MS0A 5K0UC 1QIQA 4Y5SA 2Z69A 4CU6A 1O5LA 2HWB2 4DS0A 1ZRIA 3K2OA 4FI9A 4Q4X1 1W39A 2QUOA 3SEPA 4AHYA 5T52A 5A1AA 1CAXA 3PUSA 4P02B 2HWB1 4AYUA 3NKTA 3KF3A 1BEV2 4XHBA 3C7FA 4GB31 5IVEA 1SFNA 3HJRA 5A70A 4J25A 4JKKA 2K0GA 3I2KA 1VJ2A 4WM7B 3BALA 4XOGA 3ZM8A 4AI1A 5LZ6A 4BIOA 2WNUB 4BCUA 3FLPA 5HBAA 4ZXKA 1VBD3 3JZVA 3H1WA 4OZOA 3RJ2X 2GP3A 1G8WA 4QGLA 4DUXA 2RVAA 1QY4A 4Q5OA 4QXCA 2DWRA 4LBQD 3VBRA 2JB4A 2V5DA 1EPWA 2RR12 1IKQA 4DFSA 5FZMA 5FZDA 3T4HB 4OCTA 3G7DA 4YSFA 1PM4A 1HW5A 5CFCB 2FMDA 3WOGA 1ZRFA 2Q1MA 3LDBA 4IV1B 1W8UA 1W9YA 5C6CA 3PJYA 4OFGA 3AJYA 4NIAA 5FV3A 1CONA 1VAVA 3CDZB 4RGAA 4CEYB 3BIWE 1S2EA 1AUYA 2B4KA 4CXXA 2DF7A 4YW7A 3ZXJA 3J8F1 4LOSA 2J1UA 3J7MA 3WQBA 4NJ4A 3E5UA 3FL7A 2VUJA 5FZ0A 4V2WA 2BBVA 5GZGA 1E5IA 2VU9A 1TEIA 1R093 1LOCA 1N1SA 1XSRA 3OJBA 5F3EA 1CAWA 4CCJA 1K45A 4W8JA 3FHQA 3JB4C 1EYBA 4PI2A 2C24A 2OA2A 1DIWA 4GWNA 5T3NA 3WDWA 1CD3G 1VLNA 2QNKA 5FPZA 2IVJA 2YC0A 1US2A 4OHXA 1JYXA 4JKLA 5FY1A 4AE2A 5IAXA 3CJIC 4FPHA 4QPGB 2KA3A 4WBBA 1QXJA 4Y5TA 3GM8A 3TN93 2LW8A 4LKEA 2DU0A 1KFUL 1NAEA 2WWSA 5I0TA 1QJFA 2V72A 1AR63 2RJLA 3RZZA 4FAGA 2WYSA 2WR9A 3D0JA 4N43A 4FFFA 1N1YA 4Y22B 1GNYA 3ECQA 4XBQA 1GICA 1S55A 2AENA 1SFYA 4E9KA 5A7WA 3VHRA 3A0NA 2VZVA 4Y33A 5BXXA 3IAPA 1JTZX 3ROUA 5LCWL 1MS1A 2XL7A 5L73A 1VBB3 1RMU1 1YXWA 4FTBA 1AVBA 3ASIA 4AAPA 1UOJA 2RE9A 4Z82A 2PXJA 3I3BA 3U4XA 5E1RA 3VZKA 4YW5A 5DPNA 2VQUA 3GCWA 3H3LA 3IN9A 5JLVA 3OY8A 3AX4A 4B7KA 4LA2A 4GALA 3OEAA 3H7JA 4C90A 5GJ6A 5A1LA 5BNPC 3WLUA 3VBFC 2ZHLA 4AWDA 1FOD1 1NOVA 4ONUA 1SPPB 2QQVA 3KV6A 1TQ5A 4XYXA 1ONAA 3C7GA 5F1RA 5BNPA 4AFAA 2RM21 3SITA 4XPVA 5FYHA 1WMEA 1WD4A 2FCUA 2XWBB 3HQUA 1R083 1QDCA 2YXSA 3LEKA 5FZEA 2W68A 5GZDA 1GWKA 1LHNA 1X8EA 2HEYF 4HOOA 4CDWA 4Z2WA 3ZFGB 5EYYA 1LNSA 1CGPA 4CUAA 4FPFA 4NHYA 5KHKA 4HMZA 3AZZA 2EXIA 4LNVA 1HB4A 4BMEA 3LB9A 4ZU7A 1K3IA 1QH7A 2GC2A 4RSUA 5KC5A 1OVPA 2OQ7A 3ZXKA 5J09A 1CAVA 4J1WA 4RHV1 4YPJA 4QDRA 4CU8A 1CAVB 3N9MA 3UESA 4D69A 2OPWA 1A6CA 1TVGA 1HRI3 5IVBA 1YYNA 2D5HA 4CSWA 5IVCA 3HN3A 4LO6B 1U5YA 5EHDA 2P6CA 3O1MA 5FXWA 3AVSA 3CJIA 2ET7A 5A6QA 4EYUA 3KCCA 4A7YA 2E7TA 5C5TA 3KF5A 1BK1A 5A7QA 4V2VA 1XC6A 4NROA 2P3JA 2K9ZA 4ITCA 4AF9A 3HNYM 5GZFA 3B93A 5FBZA 2VZ3A 3S57A 1POV0 4L0PA 2W94A 4CEYC 2W0XA 1AR91 4XJUA 1C1FA 2FDJA 1ND3A 1FX5A 3MLLA 1VRH3 2VBPA 4PQ9A 4CP9B 2BOJA 3RYRA 2XWJB 2HJIA 4CEYA 1VBC2 1OKQA 2W52A 1RUC1 2W92A 2YV8A 4ZS3A 4EWDA 3D8CA 1ULEA 4C0BA 2JD4A 5ABJB 2VTXA 4RQPA 5D8AB 4YW3A 5A3NA 2B5HA 2BNNA 2PHRA 5HCHA 4K1YA 5FY0A 1CX4A 1W2NA 1OQDA 2HWD2 3NNMA 2PLV2 5E89A 4BQ2A 5CG9A 4XVHA 1NCQB 1BCXA 4MHUA 4N7IA 1ZBE2 2B45X 2CAVA 2VVDA 4XABA 5DMYA 3WQ7A 3FFZA 1EAH2 1UPIA 2D6OX 4HKWA 1QOSA 4EQVA 4XIOA 1UWWA 3LE0A 4B3NA 4L8QA 2A3XA 5F6KA 3NJXA 4EZ4A 1RUE1 4BXFA 5A3PA 2BUKA 5A7WB 3U37A 3VKOA 1W6PB 1NZIA 2Y26A 4KWLA 1IOAA 1W9TA 2PYTA 2W9XA 4I09A 4QAWA 1FI2A 3VKLA 3PL0A 4IEOA 4NPRA 4TTGA 1QJY1 2WQ8A 3OBTA 3ACLA 1PK6C 1ND2C 4LKSA 2BGOA 4S2HA 4QHZA 4BQ1A 2WT0A 5K8SA 3FHIB 3TN91 5CKQA 3NV3A 1VBE2 1W6NB 5FUPA 3ILFA 1PMHX 2CDOA 1S4CA 3HNBM 5FOBB 2IWGB 2WLQA 3SCHA 4IESA 2OW4A 2DFBA 4QM9A 5EQUA 1VB2A 1UYYA 4CCMA 1C8M1 3OYWB 3OEBA 4P9LA 3RYPA 1WBLA 3SC7X 1PZ7A 5JOYA 1RJ8A 3IIAA 3MW2A 5CFDC 3OGJA 3C3VA 2W1SA 2OS2A 3HEIA 1FPN1 4IXLA 3KLSA 4LBOA 3HOBA 1S1AA 3OCPA 5EJ1B 3VDAA 1XB9A 4FXGB 4YRDA 2HWF1 3F2ZA 1GP6A 1JW6A 1MS3A 1SLLA 5JCTA 5JZGA 2FZ1A 3H8OA 1GOFA 2R6QA 2BWAA 1C57A 3MV01 4QDSA 3TNQA 4P5HA 1PO22 1GP4A 4ZY9A 3BPZA 1SACA 3P3PA 3Q8CA 4HN0A 4D3WA 2ZHMA 1GWLA 1ND3C 3WX5A 4JTNA 1RXFA 4Q8LA 1XU1A 4GAZA 2D43A 1K12A 3S5AA 3PTRB 4XC9A 2DURA 1Y7BA 3V56A 3FBYA 1QHDA 3AYCA 4NOTA 4XUOA 3PHMA 2YU2A 4COZA 5B2GB 1OF3A 3JD71 1CIWA 4XEZA 3VBHB 5C9AB 3W5MA 3MLKA 2LALA 4N53B 2YC2A 4QU1A 1OVSA 2AEYA 3T2PA 3ZR6A 5C70A 4NHMA 1ZRCA 2LM3A 1WGPA 1PMIA 2CHHA 3VBUC 2JECA 2WBKA 5FUIA 4LMFA 4D7YA 5F3CA 1GQPA 1RUF1 1CAXB 2WT2A 1ASJ1 2JG9B 1OF4A 3HNMA 4GJZA 1R081 1W90A 2VNVA 2Z5WA 3VHNA 3MZHA 4LBKA 4P9YA 4RS5C 4JQTA 4N53C 3WNMA 1JMUB 2HKXA 4Q2FA 4CCLA 4D0QA 1RUI3 2AEZA 1O3TA 2HWE2 4L99A 2IXIA 4P9XA 4CCDA 5C4WB 5A3UA 3AM2A 3K3OA 3H42B 2VMHA 5AC92 4PF5A 4CCCA 1WW7A 2ZCWA 4UBGA 2JG9C 1KXGA 2D98A 4JQRA 2VZPA 5I0SA 1JYVA 2ZZJA 3WDYA 2R062 1MVQA 4XUNA 5AC91 3TOJA 4FTSA 1DGRA 4KWKA 1AR71 5FR3A 2WT1A 3VBUB 5CISA 4NVPA 5IW0A 4DXSA 2BQPA 2R043 3DPRB 3L2YA 5DDJ2 4FPLA 3I97A 1MZ6A 5JAXA 3R0RA 4EN9B 4JGYC 1YFUA 1J1TA 1JN2P 3JUUA 4BHPA 1ENQA 2DVGA 4NMIA 4CVUA 1ST8A 4NE9A 4Q4V3 4CXWA 5LBBA 2WNVC 1GNZA 1J83A 2B42B 2VZUA 4A42A 4INDA 4CDQA 5BNNB 3V0BB 1GNHA 2V4AA 3VD9A 2FHRA 4M01A 3O1OA 1NYWA 1NQJA 4WV8A 1D2SA 1C4RA 2VVFA 2YPJA 3NRUA 1UU4A 2W1QA 4KNCA 4XJ8A 4LHNA 2ZGPA 1UCXA 4LBNA 4XBLA 5DG1A 1F5JA 1WMDA 2BJSA 1UN1A 4S2DA 4KG0A 5A3LA 4JVAA 4QQ2A 1ASJ3 1H2LA 3SXWA 1JOPA 1N1VA 4J1XA 1AF9A 2VUAA 1WMXA 3MIHA 1QH6A 2QQKA 3JBG2 4BISA 3RDIA 4AHZA 3I3MA 2VGDA 1VBC1 4OVEA 4EN0A 3ZPYA 5A3MA 4OHVA 5K0UB 3AZXA 3EYPA 4ISQA 3LA3A 1W0PA 2KD7A 3CLPA 4FCAA 1W06A 1HXS2 5C8CA 1XE0A 2Z2SB 4LT5A 4Q4W2 4HN1A 4OQ8A 3WUCA 2G9FA 2JG9A 4CP2A 2D6MA 1UKGA 2GMEA 4AQSA 4Q0SA 5DZGA 1LKNA 1JZ6A 1V00A 1PK6B 2VVEA 3O0XA 4QDQA 1DZQA 2G9ZA 2D6LX 3KGZA 1YUDA 1B35C 2VMIA 1ZBA2 1V6MA 3LPGA 2GC0A 4GJYA 1GYKA 4QPYA 2ES3A 4DB5A 5FK8A 1YLLA 1QJY2 1ZBA1 5JR7B 2DUQA 2GN7A 1HJGA 2V09A 4L11A 5KC6A 5JVVA 1AL22 1G7YA 1JXNA 1YQ6A 2E6VA 5FMOL 3M3CA 3AL5A 1Q8VA 4F3JA 3RZHA 4K1ZA 2J1SA 4JGZA 3O14A 4AXOA 2P1BA 1H9WA 3GZEA 2A75A 1AR62 2UURA 3A0KA 3MF6A 1LOGA 1LHUA 1GP5A 1XSQA 5FPVA 2K46A 5FPLA 1H6XA 3SH3A 5C3PA 1FMD1 4D6QA 5IVYA 5GLZA 2WFPA 1H4HA 2J42A 4TLFA 3T2OA 2BERA 4META 2RMU2 3AMHA 4BA6A 1H8TB 4P9WA 4XJWA 3W9AA 4GIQA 1RJ7A 3ILRA 4RYDA 1EV11 3WF1A 2NMNA 1IQAA 4FXKB 5LRSA 1TNRA 1JHJA 4ZKTB 5FMCA 5C8CB 4FPJA 5HCFA 4D8MA 4QPWA 2E31A 1V9U1 3TAYA 4FOQA 4ZZ8A 1NY71 1SBDA 2P37A 1Y43B 2R16A 2XB6C 2XLAA 3NAPC 4XCBA 2BNOA 2ZJCA 4FPYA 3M1HA 2OKXA 2P6HA 1PVXA 2MEV1 2JD9A 2UWBA 1RUD2 1RUF3 2QQLA 3FBMA 3AXDA 4WZFA 2VM9A 3M70A 2O1QA 3NNLA 3PIGA 4XHXA 1VBD1 3WQ1A 2XXZA 1UY1A 2PELA 4LPLA 5FLIA 4MYEA 3AMPA 3WF4A 3OPZA 2DFCA 5I8TA 3JB8A 2BW8A 2Q1ZB 4TLGA 5LA9A 5LRRA 1LENA 1YJKA 4M3CF 2P5BA 3J7NA 3RI9A 5F32A 2WFF1 2X29A 4FPGA 4ZXEA 2Q1FA 1OI6A 3V0BA 2WAOA 4XF4A 4Z1VA 4DQAA 5CAZA 2QQWA 3MV11 5EFUA 4Q8KA 1AR73 1RL3A 3W20A 2RS52 4D7SA 3AYAA 1OLMA 3LPFA 1UW8A 1CJDA 4YZ3A 4A3XA 2J1TA 1NT0A 4RA0A 4F8AA 1AYN1 4OUSA 1ALYA 1PGSA 2ERFA 4EE2A 1DHKB 4JGYA 5BNPB 4OI0A 1CWPA 3R6SA 1WA6X 1HX6A 5G04L 2OZJA 3IDBB 2ZGOA 1G9BA 5IK4A 3POSA 3DCQA 4XMIA 2TUNA 4I0AA 4YM2A 2FBEA 4K6BA 5C3RA 2JG8C 4PF1A 2WSUA 3S7EA 3TEZA 4QXBA 2W1UA 1PO13 5LWBA 3TB0A 3UV9A 1W04A 3N9PA 4URAA 3C8XA 5AVAA 2VTXJ 1UAIA 1ZX5A 1PX3A 1Q56A 3GXUA 3K46A 5FQ0B 3UGFA 2N7GA 2GH8A 4CE8A 2I2SA 2ZXQA 4E4DX 4URTA 3LZZA 4MGQA 1TNFA 1S0IA 4UFLA 2E53A 1W8NA 2EIEA 3WNXA 1KRIA 1S2BA 5APAA 2ET1A 5FYUA 4Y22A 5CU1A 4LBLA 5FY7A 1ZA7A 1RUNA 3VZOA 1WLWA 3OSDA 4I2OA 1KGYA 3VBRB 2C0ZA 2QE3A 3MIFA 4W6YA 1CESA 2ZGKA 3IMNA 3BIEA 1LOFC 3PDQA 5FMDA 2ZKNA 2EXHA 3GHNA 2WNEA 1H2MA 2Y6LA 1JUIA 4B1MA 1X82A 3N3HA 3J7HA 4NHLA 4RR3A 3SCGA 1A8DA 1KJLA 1BBT2 3IT8A 4RN5A 5AFEA 2C4XA 1DGLA 2V4VA 5JZGC 3WHTA 3LFIA 2BV4A 4AAXA 2WZ8A 4X6RB 5JOWA 1BBT1 4B8EA 4PCRA 3M4FA 2JWPA 3I3DA 2IC1A 3ZR5A 1FT9A 2X5IA 2YYOA 1W3VA 4JTOA 2MEV3 4E27A 3THCA 4CTEA 1NZCA 4DEVA 5FCCA 1UNBA 2H6CA 2YY1A 4B4QA 3AL6A 3I59A 2CAUA 3KSCA 1NX9A 1ULOA 5CFDB 1MEC2 3VDDB 3ZYPA 5LW9A 2VCCA 5JXHA 3WDXA 1VAMA 4MLOA 3IPVB 3VGIA 4B1LA 1DF0A 3UL2A 1GUIA 1ACCA 3PIJA 3RS6A 4YVWA 2NLRA 2OQ6A 2YZ4A 4JHZA 5I91A 4FO9A 4I0WB 1ODNA 1MQTB 4AI8A 3ZXLA 1QQP3 2ADDA 4MOAA 2IXCA 4K20A 5D21A 5GKAC 3RG0A 4A3ZA 4DRRA 3NQHA 2UYBA 1NCRA 1D7PM 3IZOA 4RD7A 1IQDC 1J3RA 3KV5A 1TME3 4IEPA 4QD2A 3OPWA 5J1XA 2UYAA 1P8JA 2JE7A 2GZWA 3WP4A 4A6SA 5JR2A 2R072 2VOVA 3RMYA 2VCAA 1AR61 2DVFA 4KGGA 4P08A 1YO8A 4NAMA 1IS6A 5JUVA 3ZXEA 4WVVA 1FMD2 3PUHA 3THTA 3BU7A 1UKRA 3PLQA 1DBNA 3O0VA 1RVF1 3H0OA 1H30A 1LU2A 4AW7A 3T2QA 2RS13 2VUDA 4R9BA 2QZ2A 4K9SA 2VOWA 5FZ9A 2RDSA 1VRH1 4M3CE 4CDXA 2AREA 3EO6A 1PGW2 1UY3A 3CHXA 2FDIA 1RUJ1 4GD4A 4DEQA 1REFA 1RUC3 1E5HA 1JHNA 2FCVA 5F5AA 1RUG1 1W6PA 2QQIA 4YVSA 1HN1A 4HLTA 3ZFEC 3ZXAC 4FQZA 1RUJ2 4PJYA 3SKJE 4PIZA 1O8PA 4R9DA 1RUG2 1CQ9A 3WY6A 3H8XA 5IUQA 1BQPA 1WZXA 2ZGUA 4CDQC 1HV1A 4XF0A 1V6JA 5ISLA 1VMHA 3C2UA 2YROA 4K7JA 4Q4Y2 4UBHA 2BGCA 3LCPA 5A7SA 2AACA 3EQEA 5ACA3 1RUE3 5FZKA 2XVKA 4Y5Z0 4MO3M 1AJKA 1Q3EA 3FFQA 1S0DA 3OD4A 4LHKA 2Q8DA 3VZNA 4E2GA 1HQNA 2ZAAA 3AMNA 3MEPA 4KI5M 3OOXA 4AHWA 2XG3A 2AR6A 5DUUA 1JI6A 3Q9OA 4QHBA 2YGLA 4KWUA 3ILNA 4FAHA 1QGLA 3T1LA 4XUPA 2W95A 2ZS6B 5FOJB 1DQ2A 1PNFA 2JJ6A 2XBO2 2GNDA 3N35A 3URFA 1E57A 1O4TA 2Y33A 4CP9A 2VBDA 5DAVA 4FFIA 2ZOEB 4FT8A 2BNMA 1F2NA 4Q0PA 1UMHA 3KM5A 2BGPA 1PZ9A 4SBVA 3LWCA 5H9QA 3HVDA 1W6MB 1AYN2 4XE9A 3GJAA 2IZWA 2CSGA 1KEXA 4GH4A 3SISA 1L7RA 1UOBA 1X9TA 4J6GA 4DZGA 1YI7A 2A6ZA 3CQOA 2JDYA 5F5QA 2R32A 1G9AA 4RFT0 1GZTA 1UQXA 2HBTA 2DVAA 4LTAA 5JSRA 3VDDA 2W08A 2F4LA 2KR2A 1QJX3 2ZKLA 3HQRA 4YZ4A 4JDMA 4YNIA 3ACFA 2ZA9A 5FYBA 3R4DB 4QXHA 1APNA 4DXRA 3VBSA 1G86A 2YMZA 4AR2A 2QQPA 1JYNA 3UJQA 1DQ1A 3RZJA 3E97A 2IVIB 2BOIA 4AEDC 1W6OA 2DBIA 4DOUA 2XJUA 3J8F3 2XHNA 3M2MA 1V6KA 2JDMA 1UX7A 1VBA3 1TZOA 2IXKA 2JDKA 3CMGA 2LS6A 3SH5A 1HXS3 2BP6A 1UF2C 4ATEA 1K5MC 1ZZCA 4YFZA 1PMJX 4JGZC 1ENXA 1O8SA 4LUMA 2JDZA 1KD7A 3JD73 1ULCA 1DFQA 3JCIA 3ZO0B 1DQ0A 1VRBA 1PIV1 2XLGA 4EJRA 4NN0A 4Q0VA 1LB2A 3BOPA 2XKOA 3AK0A 3TN92 2Y6FA 2OPKA 3O7OA 4RHV2 4CCKA 3RZGA 4XQWA 2JEMA 1DYOA 1LTEA 3ZVXA 4OHZA 3VHOA 5I0RA 1SLCA 2V5YA 2ZPXA 1DGWX 2XJSA 1QQP1 2VZSA 3QD6A 3D3AA 3CNAA 2XL9A 4N43B 1QJY3 1W2UA 3ETPA 1Q43A 1VALA 1SBEA 3DEMA 4JHTA 5DG2A 5M0TA 3HT2A 1S0GA 3POJA 1PVC2 2VQ0A 5FYYA 2X05A 1SHWB 2QQUA 3NKGA 1QEXA 5B4NA 1JZ4A 4OUMA 3I2OA 3WQ0A 4GWMA 1GZ9A 2IUWA 2TNFA 4YVWC 1CJPA 1LOAA 3IDCB 1WWYA 4MGKE 4NUBA 4DRVA 3POGA 1VBE3 3K4DA 2Y64A 4Y4RA 2Y60A 3I2JA 4DUVA 1L7QA 1MEC1 3BVCA 4TYSA 3E5XA 3O1PA 5FYTA 3O1SA 2XHKA 2HWC3 1UZZA 1SLBA 1RVF3 1WLCA 2G4IA 3AP9A 3OTFA 4PT6A 4Y26A 5CVRA 2Y0OA 1YHFA 1QJU3 2BTVC 4LKFA 2R041 3NMBA 3SLIA 3KHCA 4CP0A 2UWAA 2XVLA 3APBA 2J1VA 2B46X 1LCLA 2RV9A 3PJQA 3K4ZA 3RQ0A 2EIGA 2WWUA 3VBOC 5CFCC 1S2KA 5FAXA 2ZHNA 3QCWA 3AZVA 1X9PA 4UFJA 5FYIA 2DCKA 2PAEA 2VXJA 2A71A 2QBXA 4I30A 4BK4A 4HXCA 3HWJA 4KG8A 4DY3A 1AR81 2AH2A 2RS31 3ON7A 1UPSA 2Y6KA 3PVEA 5L9BA 1RIRA 2EVXA 2E7AA 3NNJA 2YFZA 4NR1A 4W50A 3RJRA 4CDXC 1C3HA 1N3OA 1UY4A 3BTXA 1AR82 2RS32 4JV4A 2QJVA 3BYWA 3H8UA 1RUD3 1RUF2 2VQAA 2VW1A 3ZPOA 2WNOA 4MGTA 1A78A 1Y9QA 1HN0A 2Y0IA 3AMMA 5KHHA 1ZZ6A 1Z78A 1YQ2A 1GOGA 4MH0E 1VMFA 2WN2A 2X5IC 1OXCA 3JQWA 4HETA 2BEOA 3KHBA 1STMA 5F37A 5A3OA 1XNAA 1FV3A 1X36A 4KU7A 1FOD3 4CDXB 3T2TA 3INAA 2W87A 2YUEA 1NA1A 5FZ3A 5LY1A 3AP4A 2WIIB 3V0AB 1W8TA 1UZWA 4QPGA 3OUHA 1W3XA 1D4M3 2ENRA 2XONA 1ULGA 1WLDA 5CBLA 2ORZA 2XDVA 3KQ4B 4WVMB 5GLUA 5ABJC 4IE5A 3ST7A 2EXKA 2D93A 3N36A 1I6XA 4IGOA 1HQLA 4HBNA 3AKTA 4Q29A 3S6PA 5DUVA 3WNKA 4ASKA 1CAWB 2ZGTA 4GXLA 1ENRA 3J7LA 3SNMA 3X29B 5FTTC 1UZYA 1H8TA 5KWRA 1OH3A 4CYDA 1HRV3 1AR93 3HMYA 4XBNA 4NIIA 1J59A 3A7QA 4PHZA 3T3YA 2NPIA 2HEWF 4XXAA 2XLFA 1N1TA 1CAUB 2Q5TA 3ZKUA 1DYPA 1Q8PA 4W4ZA 4HSJA 3I2FA 3N7JA 3PURA 4BWOA 3SKVA 1POQA 2P3YA 2RHPA 5G05L 1SZBA 4Q26A 2HWB3 4UW3A 3POEA 3V64A 4QPIA 3WVJA 1ZBE3 2VJXA 2EICA 1REDA 3VBFB 4YYOA 4Z8BA 4BYYA 5BNNC 1QDOA 3LA2A 4E2SA 1BEV3 5K0UA 3D5OA 2H6BA 1RMU2 1UZ0A 2GAUA 4GWJA 3PU8A 4HT1T 1X8MA 1VR3A 1YIPA 3ZSLA 3UKVA 2JDPA 2D6KA 1XXNA 4GH4B 4N43C 2DUOA 1W6MA 5HV4A 4HSLA 5H9RA 3T08A 3OB8A 3HD8B 4FOWA 4XIKA 4LO5B 4LORA 4C0HA 3KGLA 1YIFA 3QBQA 4I01A 1DQ4A 4Y3OA 1W6NA 1OUXA 4YVSC 4MGYE 1D4VB 2CNAA 3RGBA 5DZEA 4XETA 5LBFA 4GZ9A 5C9AA 2C9KA 3USUB 3ZN6A 1FATA 1DLLA 4Q4W1 5BNOA 1JU3A 2PHXA 5FO8B 1I5PA 2FD8A 1WW5A 1D4M1 2ZX3A 4QT6A 2VMGA 1GOHA 1IPJA 1DU3D 3MYXA 3LIGA 4HL0A 4IV3B 5E8AA 4CEWB 1JYTA 4C8DA 1U5ZA 4UOJA 1GZWA 4UFIA 4H7MA 5FP7A 1K42A 2RJKA 1YCIA 4M3CB 3UK9A 1DCSA 4B7EA 3B94A 5TSWA 4HKLA 2FCTA 1PZ8A 3LFMA 5FZOB 1IG0A 1C5IA 3BN6A 5FXXA 1JH5A 3C7HA 2VO5A 4LOTA 2W3JA 1H2NA 1QJU1 3WP3A 4IE0A 3M3EA 4MADA 3O1VA 4AI9A 4JGYB 3ZDVA 4BQYA 1GR3A 4QHOA 5FFOC 4N90A 1TMF3 4CUGA 3H50A 1GV9A 4PDWC 1O6UA 3VN4A 4WM8A 4LO7A 4M0HA 5BNNA 2JIGA 1VMJA 5JIAA 1V6NA 5ERLA 1KS5A 1T6GC 3HIFA 1QNWA 3Q8BA 4YM3A 3I8TA 2DTWA 3WUDA 3DXTA 4CU7A 1SDWA 5K4LA 5C4WC 3W5NA 2F17A 3J4UH 5F5CA 4I02A 3MUZ1 3VBSC 5JMOA 3RYKA 1JYWA 3NAPB 1Q8OA 2UWCA 4GQ7A 2C1FA 3PTYA 2C5DA 5FK7A 3WT3A 1WA4A 4QX2A 3WXPA 2VPVA 1NXD1 2HYXA 2R0HA 4MXWB 4PLMA 2WA3A 3WG2A 1MQTA 2YPDA 3WW1A 1POV3 2GC1A 3H7YA 1CPNA 3DF0A 2ARXA 4YWAA 1B09A 2RS11 4XJ9A 1H2KA 4HFSA 5AVPA 4CCOA 4H7LA 4CDWB 3VBHC 1VAKA 5ANNA 5KHIA 1OA3A 5EWSA 2HEVF 1AX1A 4KWJA 4P9GA 4A7KA 2WZR1 4HKOA 5H9SA 3AFGA 4QX3A 3S0MA 1RUG3 2BFUL 2NQYA 5IWFA 5FZCA 2WZR2 2VZRA 5FXVA 5KXEA 4BQXA 1W2TA 5ANQA 4LBQB 3POWA 3Q8EA 2RR11 3RPQA 1GWMA 2VD7A 1TMF1 1OLME 3AP5A 3ATGA 3OY8B 4GA9A 5HXVA 4E8DA 4NAOA 1CZTA 2MNGA 2JE8A 1W0NA 3AVRA 1DQ6A 4GMP0 4LK6A 4AI0A 1OOPC 3G6JB 1OT5A 3VLBB 5E16A 5IFTA 4DINB 2C26A 3EJKA 3OUIA 4LO4B 5J7MA 5LA0A 2W91A 4XFHA 2O0OA 1Z7S1 5E88A 1I1EA 1LU1A 4ZS2A 4BQ5A 5C71A 2QTWB 2YBKA 3B9IA 4BQWA 2XPJA 1K5JA 1WW6A 4O61A 5KXCA 1ZRDA 4XF1A 1V6IA 2HWF2 1HB1A 1O91A 2R061 3VBOA 5FBJA 1QU0A 4XFCA 2Q8OA 1AR72 1WD3A 1FPN2 1W9FA 1O3QA 1IS5A 4IEXA 1PO21 1VIWB 2B7YA 4COYA 2GNTA 2XVGA 1BZWA 1WW4A 1ULFA 2WO1A 4OZXA 4GMP1 4H55A 4C1WA 1C5HA 5FY8A 4XDQA 1HQWA 2GC3A 2WSVA 2XOMA 3I54A 4YGCA 2ZGRA 4MXVA 2J1EA 3GALA 4YLZA 5KXDA 3HN1A 1QKQA 1ZZ7A 4Q1RA 2D7FA 5JXJA 4CDUB 2JDAA 2DTYA 1VBB1 1MS5A 1IGOA 1AZDA 4PIYA 3KT1A 4N7UA 4A6OA 3MBWA 3MW3A 4K8FA 4TZDA 2VC9A 1YI9A 3UT0A 2J1RA 2XGXA 1W9WA 2IFRA 3GF6A 5F39A 4A2UA 5T5OA 3AJZA 1REEA 3ETQA 3MIEA 5KBFA 4P00B 3OGVA 4IEZA 3MIGA 4N8MA 1LULA 5HPOA 2VZ1A 2ZEXA 5FKBA 1LGCA 1YEWA 2WKKA 3FE5A 2WNVA 1RUI1 2R30A 5FYMA 4Z2AA 2ZABA 1IKPA 4RFRB 4BB3A 4YZ1A 5FP4A 3VBRC 2RJ2A 4W65A 1YRZA 4OQ9A 5L9RA 2WQ4A 1V9U3 1UYZA 4GKYA 2VG9A 2NP0A 4XTPA 5FZ8A 4PIXA 5K9YA 4BH9A 3UNPA 2A3WA 3I2IA 4RQPB 5LBEA 4LBMA 1I3HA 4CZSA 2A70A 1H6YA 4ORFA 4H2AA 1OFNA 3TWIA 3KS7A 4BPZA 3B9CA 3CL1A 2VCMA 4QB1A 2PQQA 2Y6HA 4AEMA 4ARXA 5I0UA 2OX0A 1CPMA 4HONA 4IETA 4P14A 4XAAA 4XZPA 4A45A 2WJSA 3OGSA 4QWNA 4Z07A 3DPRA 2QFEA 4NWWA 3RI8A 3THDA 5EIYB 3MF9A 4DNYA 1YQ5A 3ZN4A 3NSTA 3WSOA 3GBFA 4U2AA 1PX4A 4ZU5A 2JG8B 1ODMA 1XNBA 5FXZA 2Q8EA 3BOWA 4AVBA 4Q4X2 4QQPA 4O7XA 2WUHA 1UXZA 2WWJA 4FTEA 2DU1A 5L9VA 3MPBA 1C1LA 4AQ2A 2ZHKA 4YW2A 2BVVA 4Y1YA 1MACA 5LY2A 2FDGA 3KV4A 5FREA 1HIXA 5T5JA 1SPPA 4XUTA 3N7LA 3ZYRA 1L7LA 1A34A 3VDCA 5HCBA 2ZX1A 4HG6B 5KXBA 4N9HA 4QX7A 5EJ3A 3WDTA 3DL3A 3CZUA 3EBRA 3JQXA 3S5QA 4COUA 1OQ1A 3OBZA 4R9CA 1O3RA 3TBDA 3JBG1 2VMEA 3FC0A 5CA6A 1NLSA 4X8NA 1J3QA 1UMIA 2ZX0A 4JZRA 4YGEA 1YFXA 2R0FA 3OBAA 2WA4A 4FOYA 4QB2A 2JKBA 3WDUA 3ZOIA 5IYYA 4E2QA 1DQ5A 3PU3A 2QQMA 4M4PA 3T30A 1HXS1 1LJ7A 4MGSA 4NIGA 4IV3C 5LASA 4CEWC 3WDVA 2VNRA 2XJQA 4RQPC 1H1AA 3KWVA 4WVMA 5JSPA 1ZNPA 3LAGA 2HWE3 1PIV3 1AXZA 3THPA 4R4ZA 2PTMA 2RS12 3LEIA 5DUWA
chains in the Genus database with same CATH topology
2F6BA 2WC2A 3BODA 5JPNB 3ZYIB 2YDEA 2R063 3M8LA 3NV1A 4IEVA 4DXZA 1SMVA 3NO8A 1AJOA 1S0FA 1A8MA 4WM8C 4AFBA 4OHYA 1PO11 2Z42A 2ZACA 1N3QA 2IXJA 3RMXA 4Z92B 1ZA4A 1PHMA 4Y1VA 3FMGA 3VUOA 4QQLA 5T54A 4AVAA 1QOOA 3FLRA 5CFDA 3ZX7A 4AQ6A 4WM7C 4QPIB 1U0AA 1XE7A 2G9GA 1GBGA 1U12A 4YARA 4I0BA 4L2NA 4L9BA 5EV7A 1J58A 1HDKA 2BWCA 1CAUA 2NMOA 1C8M2 1X50A 4U36A 2FMYA 4LHLA 4AK3A 4I3PA 5T5PA 1CVNA 1DYKA 2XBO3 5KHGA 2GNBA 2OYZA 3IWZA 1O5UA 1GSLA 1IPKA 1R1ZA 2K2SA 5L36A 1CN1A 5CNAA 3KT7A 2VXRA 1M4WA 3K48A 1KQRA 4Y20A 5GLVA 4CP1A 4AEJA 5JI7A 3ZFFB 5JOXA 3UKTA 3GBWA 1KDMA 4BLIA 3V0AA 1DZTA 4LLFA 2D3PA 1EV12 4QQHA 2MEV2 3H3UA 2A73B 1MZFA 3VBFA 1LHWA 3GZTB 1NY72 3VBUA 3W58A 3AP7A 1I5ZA 3RNSA 1ND2A 2CYFA 3WW2A 3EXUA 1UU6A 4YVWB 1ZBA3 3IBMA 1QQP2 3B5LB 3TRSB 1G9FA 4W6XA 2E51A 3V65A 4HVRA 4XFFA 1YNAA 2ZX4A 5EYXA 5K7PA 1Z7S3 5A32A 4WM7A 1B35A 3USUA 2GNMA 2VECA 3ZN6B 2X53S 2HWE1 3ZYJB 3I7DA 1BVP1 5FDBA 4LR4A 1MZ5A 3ZFEA 2CWMA 1SCSA 3VBOB 1LHOA 1MR5A 2R1DA 3VZMA 4FOVA 2SBAA 5ACA1 1H1IA 1LOBA 2P3IA 2E63A 3DGTA 2GU9A 4QM8A 1U5XA 1OPOA 1Q8QA 3GYDA 5F6LB 1FXZA 2ZMNA 5L19A 2EAAA 3NWKA 4EN8B 1LECA 4BZ4A 4K40A 4V1PA 4UW4A 4OULA 2WNVB 1QOTA 1RUH1 4LO8A 3NJZA 1N3PA 1XQNA 1ZBE1 3VKMA 1R1A3 4D7TA 5BY5A 1EAH1 4LE3A 1DZRA 3B3QE 1QJZA 3SH4A 5GLWA 1OOPA 4G3YC 1RB8G 1BKZA 1RUE2 2R49A 4XXPA 4CDWC 3WW4A 2IXHA 4HK8A 2XJTA 1O3SA 1IHMA 1ZZBA 2XH6A 4K3UA 2QDRA 1D0GA 4FP3A 3U07A 3VKFC 4WVZA 1COV3 4AVVA 2A6YA 1BMV1 3QH6A 3GNEA 3CJXA 1SQ4A 3CJIB 3KZ4C 2PAKA 3LGRA 1F8VA 1L3JA 3VBSB 3AKPA 3AMQA 3MI8A 3ELNA 1LHVA 2DVDA 4HK9A 1UL9A 1BXHA 3SHRA 1LOEA 2D6NA 5CG8A 1JYIA 1ZRRA 1FAYA 3ES4A 4AHXA 2GALA 4YG3A 1QJX2 4F83A 3OBRA 5T50A 2KM2A 1XYPA 2BFUS 4BIFA 1QJX1 1SEFA 5D8AA 1PO12 1FPN3 5FRAA 3FX3A 1FV2A 3ZDSA 3ME2A 3AYDA 4COWA 3O0WA 5KXBA 1YFYA 4Q1PA 1BYHA 3LA7A 4D94A 2R071 3LSDA 4EV0A 1C8NA 1HRV2 2EALA 5GZCA 2ZMKA 2VOXA 3RRDA 3JD72 2B8MA 2FQPA 2OUJA 3D4KA 4KL1A 1VBA1 2VY0A 1NE6A 2A6VA 4BOWA 4AG4A 4AFCA 5BPXA 3HQXA 2JX9A 2WZPP 1PNGA 2JXAA 3B01A 3U11A 4IV3A 4YW4A 4CEWA 5SV8A 5IK8A 4O9EA 1QMJA 1RMU3 4KBBA 5C8CC 3D0SA 3AKQA 4MSVA 2YGMA 2RM22 4IV1A 1EPZA 1PVC3 2PHFA 4Y1XA 5BNOB 3KQRA 1UD1A 1EY2A 2HWD3 2VULA 2PLV3 3ALQA 2IXLA 3GZAA 4M0NA 1BVVA 1PGW1 3FZ3A 1TE1B 2Z79A 2A3YA 4X6QB 4GULA 4HZFA 2CGPA 2PHWA 3TYJA 1F31A 4RS5A 1G6NA 1PK6A 2R1BA 2EA7A 3ZFGA 3EHKA 4Y20B 4ES8A 3VDDC 2HWC2 1RUOA 5DZFA 2WNUA 3VL8A 3J9SA 3M7AA 3MIBA 5DDJ1 5EXOA 3UJOA 3ZFFC 1VBD2 5H9PA 2HWC1 1KITA 1KJRA 4AVCA 1URXA 3KCYA 3ZSMA 1AXKA 2RR13 3WP5A 4TSVA 4XF9A 3BCWA 2WFF2 4WVWA 4MX3A 2OIIA 1DG6A 1K5MA 3CF6E 5D8AC 1WCSA 1TME2 4JDNA 1OA4A 2D44A 3ZSJA 1RTVA 4B29A 5JOZA 2P3KA 5T5LA 4HVQA 3QOPA 5J3UA 4P9JA 1OHFA 3I59B 3WCRA 2DUPA 1OMIA 4Y1UA 1RHI3 3USSA 4AFMA 1PO23 3WD5A 1NLRA 2AUYA 3K51A 1FOD2 1NA1B 3B02A 4BM8A 2OUHA 5HI0A 2HWD1 3WINE 1ZZ8A 4N53A 1D4M2 5KHJA 2E7QA 1JYCA 2UY9A 4QX5A 1RGSA 1XE8A 1RUC2 3N7KA 1GFF2 1VP6A 2GDFA 4UXAA 4Y1ZA 1LOFA 1PIV2 5LEJA 3M3IA 2A6WA 4WM8B 2CY6A 2H0VA 4Q4Y3 4P9IA 2DCJA 1Q5OA 4ISRA 3ZFGC 1O7FA 2D5FA 2LUWA 1AL21 4JDOA 4YZ5A 5SV5A 1K5MB 4HANA 3J26N 5BNQA 4LUKA 3OF1A 4FPEA 1XYOA 1S0CA 4YG6A 3ZMNA 3NW4A 3D82A 2CGOA 2EAKA 1FNZA 2ZMLA 3OYWA 4X8PA 2PN5A 3KT4A 2VOKA 2DYCA 5C33A 2BPA2 1GQHA 2JG8A 1HKDA 2DCTA 1SLTA 3QACA 4JAAA 4KGQA 1C8M3 1F5FA 2D3RA 2JICA 5JIUA 2ZTNA 4XJZA 2RMU1 2R042 2V73A 5DDJ3 3E5QA 2WS91 4SLIA 4AVSA 1RUH3 5JDBA 2HWF3 1G9DA 2WS92 1NCRB 4XW3A 3ZXGA 3UKNA 4GMP3 2I74A 3NV4A 4LULA 2NZ9A 1AHSA 3B00A 2PLV1 1W6QB 3MLJA 4PDWA 1XNCA 1XNDA 4OI2A 3R4UA 4HVOA 1A3KA 1OQEA 1EV13 3O12A 4JGZB 5GALA 3FUQA 1BEV1 1VBA2 1IS4A 5FLHA 4GB32 2W39A 1AL0G 5JWPA 3H1MA 2DCYA 2QCSB 5LK7B 3R4SA 4KQ7A 2ZGSA 2PHDA 1YFWA 1HLCA 4F7ZA 1NQDA 5GZEA 2B9UA 1ND3B 1MS4A 4RHV3 2XKPA 2HYKA 3FLTA 1SBFA 4A7ZA 4M00A 1VRH2 5FPXA 2TBVA 4EWEA 3FJSA 3GHMA 2WNUC 3NL1A 1XRUA 2GH2A 1O4YA 3BTAA 4RR3C 1YWKA 1LEMA 3O5SA 4XMAA 2CGNA 2CL2A 1OFSA 1AYM3 1NA1C 1SCRA 2YHJA 2Y38A 1GQGA 1KFXL 5AFBA 1J1LA 3MIDA 3VZLA 4ZU4A 3T1MA 4XILA 1QJU2 1AL23 1EP0A 3ENRA 4B4RA 1RINA 2IFWA 4JC1A 2ZGLA 5FQ0A 2XBO1 3AFKA 4Q0QA 2ETEA 1POV1 2GMMA 4BMBA 1UX6A 4CDUC 2AYHA 4JRAA 3MDPA 4CDQB 4QU2A 1S0BA 3TNPB 4PBOA 4ATFA 2ZGQA 1UIKA 2ATFA 1S0JA 1OOPB 3IKWA 1OLQA 2QZ3A 1QNYA 2WZR3 3DUIA 4WZCA 4LBQA 3ZFEB 1OSGA 4CDUA 3HR9A 3ZXFA 3OGGA 1WCDJ 1H4GA 4PBPA 1X33A 1NCQC 2QVSB 2Q4SA 3ES1A 1B35B 3VKNA 5CADA 4NHKA 1AX0A 2OVUA 3LOIA 1COV2 4E4SA 1X7NA 1ULDA 2NM1A 2O8QA 4XTMA 4FSJA 3AP6A 1COV1 5C4WA 2WLPA 1W6QA 1D0HA 4IEWA 5FLJA 2PHLA 5BNOC 2CTVA 5FMOS 4YZ2A 5JSOA 1MZEA 1CR7A 2ARBA 5C8WA 2D97A 1H9PA 4XQ4A 2AZ5A 4G4FA 4GKXA 3D6EA 1ZVFA 4QXKA 2GMPA 3N4MA 4EN7B 1HRI1 4UW5A 3U10A 4IQPA 4JCKA 4ASMB 5I93A 2P17A 3LOBA 1WUVA 2Q0AA 5L7OB 3PVOA 1RITA 1VBE1 1MS9A 3DV8A 5J98B 4HPKA 1ZYBA 1V6LA 3GZUC 2I45A 3MFAA 2XJRA 1NCRC 2E9QA 3HT1A 2VNGA 4XFAA 1KDKA 1W6OB 4Y4YA 3LSEA 4IEUA 5EZWA 1N47A 2SLIA 4ASLA 5CFCA 5JZGB 2P2KA 3MGUA 3NAPA 1GZWB 1EAH3 4UW6A 5I8YA 4RL7A 4FP2A 3ZFFA 4AI2A 3B69A 3PMSA 2BVBA 2VNOA 3WR0A 2BYVE 4PDWB 2O8OA 1DDLA 2ZAHA 1XNKA 2NN8A 1LR5A 4RS5B 4YGDA 1NE4A 2WINB 3R05A 4OHWA 1Z0HA 3NV2A 4FPOB 2VW2A 4XFIA 3CU7A 3VBHA 1ZM1A 5A33B 1IZ3A 1XYNA 2B39A 2JE9A 3POYA 1ASJ2 1ZZ9A 4YM1A 5DUXA 5D1IA 4QGNA 4QGMA 2QKDA 2UU8A 1TMF2 1R091 3NVCA 4G9SB 2PAMA 4HPKB 4MZUA 3WG3A 1ND2B 1S0EA 1LRHA 2WFF3 1KS4A 1R092 3H9AA 1RC6A 1NXMA 3KB5A 3ZMOA 5ABJA 4YVSB 2GN3A 1Z7S2 5A33A 2LTNA 1H1MA 3HAGA 3KCXA 4IEYA 3A4UA 2OZ6A 1LODA 1H0BA 3OD0A 4MGIE 1H8TC 2H0BA 5BUVA 4GH4C 4XQDA 2ILMA 4IV1C 1SLAA 3RSJA 3PNAA 3VL9A 4FQ4A 5J36A 5L7OA 3DN7A 4R4XA 5IK7A 3WV6A 1NG0A 1RHI1 2R073 5J96B 1NCQA 3IDEA 1V6OA 3MICA 1VBB2 3IPVA 2X8KA 4N9IA 1RUD1 1DGRN 1SLIA 4DY5A 1FMD3 1UU5A 1R1A1 1DGWA 1QXRA 2D40A 1FYUA 3IM0A 5CIRA 1R1A2 1LEDA 1UIJA 1ENSA 3L9JT 1VB4A 3CO2A 5LK5A 4PLNA 1W0OA 2JENA 1MQTC 1QF3A 2ZGNA 3PVBB 4COVA 1GANA 5JPMB 1FNYA 2FZ2A 1R082 1PVC1 3FUOA 3AYEA 3S7IA 1RUJ3 1WCKA 3ZYGA 1IS3A 3N7MA 3QLQA 4E4ZA 2X5IB 4O9GA 1GLHA 1V70A 3SCFA 3WHUA 3AB0A 4R9AA 4K21A 3MPPG 5GLTA 4EN6B 3RWNA 5T55A 4RR3B 3VV1A 2EXJA 1JOJA 3ZXDA 1HRI2 3AZWA 3WCSA 1AX2A 4Q0UA 1M06G 4XFBA 2PHTA 2XUMA 1D2QA 4IEQA 1HRV1 3KD4A 2VH9A 4R8HA 4PLOA 3E6DA 1LGNA 1O4ZA 1RUH2 4BE3A 2MPFA 4AFDA 2WS93 4LEJA 3WG1A 4W6WA 2VW0A 1G9CA 1AYN3 4RGGA 2RS53 1HV0A 4FVVA 3JBG3 3LKJA 1LESA 3M3QA 1OLRA 4AGVA 2EF6A 1LGBA 1BJQA 1J3PA 4YFWA 4QQOA 3AKRA 4GB33 1VBC3 4XFGA 2ZGMA 4AEDA 4Q4W3 5A32B 2QDNA 3KMHA 3ZIWA 1JUHA 1WBFA 1BMV2 4IL7A 3FWEA 4EROA 2UY8A 4B4PA 3BB6A 5J48A 3I2DA 1JBCA 2DVBA 1I9RA 4LE4A 2D3SA 4XJAA 5HCAA 2Q30A 3QH7A 5I8SA 5GM0A 1V9U2 4YGBA 4QPGC 3H1YA 4XF3A 4BLJA 3J8F2 1MVEA 3WG4A 3DKWA 4QMAA 4MV2A 3H3ZA 3M3OA 4Y24A 4KU8A 2RM23 1QWRA 4DMIA 2WQZC 3U0ZA 1OPMA 2PHUA 3PMEA 3JU9A 4TWTA 3ZSKA 1AYM2 5JMCA 4H3WA 1Q8SA 4Q4Y1 5DXDA 5IK5A 1OD5A 1GKBA 4AGGA 4MVTA 2PFWA 3I4IA 5J37A 1AYM1 4KH9A 4AGRA 4YM0A 2F4PA 4Q4X3 2DV9A 2A5ZA 3DPRC 5BYNA 3ZN5A 4AEDB 1BBT3 4L97A 2RMU3 2RS51 2NYYA 5LEKA 5JI9A 2AGSA 3B7MA 2CV6A 4S2FA 3AZYA 4YG0A 4NO4A 2XJVA 1PM7A 1YJLA 4MUVA 2ZBJA 3ZIXA 3AKSA 1RVF2 5L7OC 3SMHA 1UMZA 1MEC3 2TEPA 3S30A 3ZSEA 2ZZQA 3E6CC 4LA3A 4FPCA 1XU2A 4MGZE 3HBZA 4IERA 4AI3A 4C1XA 1C28A 4OI1A 4L92A 5FO9B 1RHI2 2C9AA 3WW3A 5C9AC 4M3CA 3WP6A 5CB7A 2MHFA 4YW1A 4Q27A 3W59A 2XJPA 1AR83 2RS33 3CEWA 3MFCA 4JRLA 4LBJA 1QXPA 4C91A 1GZCA 2A7AA 4R52A 2I07B 4S2GA 4AVTA 1H8VA 1RUI2 2CWSA 2WL1A 3MW4A 3GBGA 1WLTA 3VZJA 1MS8A 4AQTA 5AC93 4AEKA 4H14A 1TME1 1AXYA 3AXEA 4FPKA 5F9TA 2PA7A 4OLLA 5BV6A 2A6XA 5FO7B 1WMFA 2KXLA 2GSYA 5IT6A 1F9KA 3P3NA 4NWVA 1PGL1 2ZX2A 4ES9A 1Y3TA 3L2HA 1ZREA 4Q4V1 1AR92 2D6PA 3VHPA 2DCZA 2P34A 3PVNA 4OI4A 1PGL2 1OA2A 4I3GA 1U5IA 3E6BA 4MXWA 4Q4V2 5ACA2 4DPNA 4LLOA 1MS0A 5K0UC 2Z69A 1O5LA 2HWB2 4DS0A 4Q4X1 1W39A 2QUOA 4AHYA 5T52A 1CAXA 2HWB1 4AYUA 3NKTA 1BEV2 4XHBA 4GB31 1SFNA 4AI1A 2K0GA 4WM7B 1VJ2A 4XOGA 3BALA 4BIOA 2WNUB 4BCUA 3FLPA 5HBAA 4ZXKA 1VBD3 3JZVA 3H1WA 3RJ2X 1G8WA 4QGLA 1QY4A 2DWRA 4LBQD 3VBRA 1EPWA 2RR12 1IKQA 4DFSA 3G7DA 4YSFA 1HW5A 5CFCB 2FMDA 3WOGA 1ZRFA 2Q1MA 4IV1B 5C6CA 3PJYA 4OFGA 3AJYA 1CONA 1VAVA 4RGAA 4CEYB 3BIWE 1AUYA 2DF7A 3ZXJA 3J8F1 3E5UA 2VUJA 2BBVA 5GZGA 2VU9A 1TEIA 1R093 1LOCA 1N1SA 3OJBA 1CAWA 3JB4C 1EYBA 2OA2A 1DIWA 4GWNA 5T3NA 3WDWA 1CD3G 1VLNA 2QNKA 5FPZA 2YC0A 4OHXA 4AE2A 3CJIC 4FPHA 4QPGB 2KA3A 4WBBA 1QXJA 3TN93 2DU0A 1KFUL 2WWSA 5I0TA 1AR63 2RJLA 3RZZA 4FAGA 3D0JA 4N43A 1N1YA 4Y22B 3ECQA 4XBQA 1GICA 1S55A 2AENA 1SFYA 4E9KA 3VHRA 3A0NA 5BXXA 1JTZX 3ROUA 1MS1A 2XL7A 5L73A 1VBB3 1RMU1 1YXWA 4FTBA 1AVBA 3ASIA 2RE9A 4Z82A 3U4XA 5E1RA 3VZKA 4YW5A 3IN9A 5JLVA 3OY8A 3AX4A 4B7KA 4LA2A 4GALA 4C90A 3H7JA 5BNPC 5GJ6A 3WLUA 3VBFC 2ZHLA 4AWDA 1FOD1 1NOVA 4ONUA 4XYXA 1TQ5A 1ONAA 5F1RA 5BNPA 4AFAA 2RM21 3SITA 4XPVA 1WMEA 1WD4A 2XWBB 1R083 1QDCA 2YXSA 2W68A 5GZDA 1X8EA 1LHNA 2HEYF 4Z2WA 4CDWA 3ZFGB 5EYYA 1CGPA 4FPFA 5KHKA 4HMZA 3AZZA 2EXIA 4LNVA 4BMEA 3LB9A 4ZU7A 1QH7A 2GC2A 4RSUA 5KC5A 3ZXKA 5J09A 1CAVA 4J1WA 4RHV1 1CAVB 4D69A 1A6CA 1HRI3 1YYNA 2D5HA 4LO6B 1U5YA 3CJIA 2ET7A 3KCCA 4A7YA 2E7TA 1BK1A 2P3JA 2K9ZA 4ITCA 4AF9A 5GZFA 3B93A 5FBZA 1POV0 4CEYC 2W0XA 1AR91 4XJUA 1C1FA 1ND3A 1FX5A 3MLLA 1VRH3 4PQ9A 3RYRA 2XWJB 2HJIA 4CEYA 1VBC2 1OKQA 2W52A 1RUC1 2YV8A 4EWDA 3D8CA 1ULEA 4C0BA 2JD4A 5ABJB 4RQPA 5D8AB 4YW3A 2B5HA 2BNNA 2PHRA 4K1YA 1CX4A 5CG9A 1OQDA 2HWD2 5E89A 2PLV2 1NCQB 1BCXA 4N7IA 1ZBE2 2B45X 2CAVA 2VVDA 3WQ7A 3FFZA 1EAH2 1UPIA 2D6OX 4HKWA 1QOSA 4XIOA 4B3NA 4L8QA 2A3XA 5F6KA 1RUE1 2BUKA 3VKOA 1W6PB 2Y26A 4KWLA 1IOAA 4I09A 2PYTA 3VKLA 5KXEA 1FI2A 4IEOA 4NPRA 1QJY1 3OBTA 3ACLA 1PK6C 1ND2C 4S2HA 4BQ1A 5K8SA 2WT0A 3FHIB 3TN91 3NV3A 1VBE2 1W6NB 3ILFA 5FOBB 2IWGB 2WLQA 3SCHA 4IESA 2OW4A 2DFBA 4QM9A 1VB2A 1C8M1 3OYWB 4P9LA 3RYPA 1WBLA 5JOYA 1PZ7A 1RJ8A 3IIAA 3MW2A 5CFDC 3OGJA 3C3VA 1FPN1 4IXLA 3KLSA 4LBOA 1S1AA 3OCPA 4FXGB 4YRDA 2HWF1 1MS3A 1JW6A 1SLLA 5JCTA 5JZGA 2FZ1A 2R6QA 2BWAA 1C57A 3TNQA 4P5HA 1PO22 3BPZA 1SACA 3P3PA 4HN0A 4D3WA 2ZHMA 3WX5A 1ND3C 4JTNA 4Q8LA 1XU1A 2D43A 2DURA 1Y7BA 3V56A 3FBYA 1QHDA 3AYCA 4NOTA 4COZA 3PHMA 4CRQA 5B2GB 3JD71 1CIWA 4XEZA 3VBHB 5C9AB 3MLKA 2LALA 4N53B 1ZRCA 4NHMA 2LM3A 1WGPA 1PMIA 3VBUC 2JECA 4D7YA 1RUF1 1CAXB 2WT2A 1ASJ1 2JG9B 1R081 2Z5WA 3VHNA 3MZHA 4LBKA 4P9YA 4RS5C 4N53C 2HKXA 4Q2FA 1O3TA 1RUI3 2HWE2 4L99A 2IXIA 4P9XA 5C4WB 3AM2A 2VMHA 5AC92 4PF5A 1WW7A 2ZCWA 4UBGA 2JG9C 1KXGA 2D98A 4JQRA 5I0SA 2ZZJA 3WDYA 2R062 1MVQA 5AC91 4FTSA 3TOJA 1DGRA 4KWKA 1AR71 2WT1A 3VBUB 4NVPA 2BQPA 2R043 3DPRB 3L2YA 5DDJ2 4FPLA 1MZ6A 5JAXA 3R0RA 4EN9B 4JGYC 1YFUA 1J1TA 1JN2P 3JUUA 4BHPA 1ENQA 2DVGA 4Q4V3 2WNVC 1GNZA 2B42B 5BNNB 4INDA 4CDQA 3V0BB 1GNHA 2FHRA 4M01A 1NYWA 1NQJA 4WV8A 1D2SA 1C4RA 2VVFA 2YPJA 1UU4A 4KNCA 4XJ8A 4LHNA 2ZGPA 1UCXA 4LBNA 4XBLA 5DG1A 1F5JA 1WMDA 1UN1A 4S2DA 4KG0A 5A3LA 4JVAA 4QQ2A 1ASJ3 1H2LA 3SXWA 1N1VA 4J1XA 1AF9A 2VUAA 3MIHA 1QH6A 3JBG2 3RDIA 4AHZA 2VGDA 1VBC1 4OVEA 4EN0A 3ZPYA 5A3MA 4OHVA 5K0UB 3AZXA 4ISQA 3LA3A 1W0PA 3CLPA 4FCAA 1HXS2 5C8CA 2Z2SB 4LT5A 4Q4W2 4HN1A 3WUCA 2G9FA 2JG9A 4CP2A 2D6MA 1UKGA 2GMEA 4AQSA 4Q0SA 5DZGA 1LKNA 1V00A 1PK6B 2VVEA 3O0XA 1DZQA 2D6LX 3KGZA 1YUDA 1B35C 2VMIA 1ZBA2 1V6MA 2GC0A 1GYKA 4QPYA 2ES3A 4DB5A 1YLLA 1QJY2 1ZBA1 5JR7B 2DUQA 2GN7A 2V09A 4L11A 5KC6A 5JVVA 1AL22 1G7YA 1JXNA 2E6VA 5FMOL 3M3CA 1Q8VA 4F3JA 4K1ZA 4JGZA 3O14A 4AXOA 1H9WA 2A75A 1AR62 2UURA 3A0KA 3MF6A 1LOGA 1LHUA 3SH3A 1FMD1 5GLZA 2WFPA 1H4HA 4TLFA 4META 2RMU2 3AMHA 4BA6A 1H8TB 4P9WA 4XJWA 3W9AA 4GIQA 1RJ7A 3ILRA 1EV11 2NMNA 1IQAA 4FXKB 5LRSA 1TNRA 4ZKTB 5C8CB 4FPJA 5HCFA 1V9U1 3TAYA 4FOQA 1NY71 1SBDA 2P37A 1Y43B 2R16A 2XB6C 2XLAA 3NAPC 2BNOA 2ZJCA 4FPYA 3M1HA 1PVXA 2MEV1 2UWBA 1RUD2 1RUF3 3FBMA 3AXDA 4WZFA 3M70A 2O1QA 4XHXA 1VBD1 3WQ1A 5FLIA 2PELA 4MYEA 3AMPA 3OPZA 2DFCA 5I8TA 3JB8A 2BW8A 2Q1ZB 5LRRA 1LENA 1YJKA 4M3CF 3RI9A 2WFF1 2X29A 4FPGA 3V0BA 1OI6A 4XF4A 4Z1VA 4DQAA 5CAZA 5EFUA 4Q8KA 1AR73 1RL3A 2RS52 4D7SA 3AYAA 4A3XA 4YZ3A 1UW8A 1CJDA 4RA0A 4F8AA 1AYN1 4OUSA 1ALYA 1PGSA 2ERFA 5BNPB 1DHKB 4JGYA 4OI0A 3R6SA 1HX6A 2OZJA 3IDBB 2ZGOA 1G9BA 5IK4A 3POSA 4XMIA 2TUNA 4I0AA 4YM2A 2FBEA 4K6BA 2JG8C 2WSUA 3S7EA 1PO13 3TB0A 3UV9A 5AVAA 1UAIA 1ZX5A 1Q56A 5FQ0B 2N7GA 2GH8A 2I2SA 4E4DX 4URTA 3LZZA 1TNFA 1S0IA 3WNXA 2E53A 1KRIA 1S2BA 2ET1A 4Y22A 5CU1A 4LBLA 1RUNA 3VZOA 1WLWA 4I2OA 3VBRB 2C0ZA 2QE3A 3MIFA 4W6YA 1CESA 2ZGKA 3IMNA 1LOFC 2ZKNA 2EXHA 3GHNA 2WNEA 1H2MA 1JUIA 1X82A 3N3HA 4NHLA 4RR3A 3SCGA 1A8DA 1KJLA 1BBT2 3IT8A 5AFEA 1DGLA 5JZGC 3WHTA 4X6RB 5JOWA 1BBT1 4B8EA 4PCRA 3M4FA 2IC1A 1FT9A 2X5IA 2YYOA 4JTOA 2MEV3 4E27A 4CTEA 1NZCA 5FCCA 2H6CA 2YY1A 4B4QA 3I59A 2CAUA 3KSCA 5CFDB 1MEC2 3VDDB 3ZYPA 3WDXA 1VAMA 4MLOA 3IPVB 3VGIA 1DF0A 3UL2A 3RS6A 4YVWA 2NLRA 2YZ4A 5I91A 4FO9A 4I0WB 4AI8A 1MQTB 3ZXLA 1QQP3 5GKAC 2IXCA 4K20A 3RG0A 4DRRA 2UYBA 1NCRA 4RD7A 1J3RA 1TME3 4IEPA 4QD2A 2UYAA 2JE7A 2GZWA 3WP4A 2R072 2VOVA 3RMYA 1AR61 2DVFA 4KGGA 1YO8A 1IS6A 3ZXEA 4WVVA 1FMD2 3THTA 3BU7A 1UKRA 3PLQA 1DBNA 3O0VA 1RVF1 3H0OA 1H30A 1LU2A 4AW7A 2RS13 4R9BA 2QZ2A 4K9SA 2VOWA 1VRH1 4M3CE 4CDXA 2AREA 3EO6A 1PGW2 1RUJ1 1REFA 1RUC3 1JHNA 1RUG1 1W6PA 4YVSA 4HLTA 3ZFEC 3ZXAC 4FQZA