3B9UA

Crystal structure of l26n/d28n/h93g mutant of human acidic fibroblast growth factor
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
132
structure length
132
Chain Sequence
NYKKPKLLYCSNGGHFLRINPNGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENGYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title A logical OR redundancy within the Asx-Pro-Asx-Gly type I beta-turn motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 34
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3b9uA00
4IY8A 1R8NA 1QQLA 3UJ4A 4L4HA 3UD8A 3OGGA 2Z49A 1RY7A 1WBCA 5JLVA 1WD4A 4II0A 4X37A 1IHKA 1Q1UA 1V6VA 1NZKA 1F31A 5E24E 3UDAA 3KMVA 3P6IA 3Q7WA 5BXSA 1WBAA 4I4UA 1S0GA 1HWPB 2FFVA 3R4UA 4IYBA 2AAIB 1IJTA 3BRFA 1K5UA 4USPA 1PUUB 4JRAA 3CRHA 3CU1B 3WO3A 3VUOA 3ZX7A 1YTOA 2HWAA 2ZR1B 1TOOA 3OGFA 3O4CA 3ZXDA 4ISRA 41BIA 3HSMA 5EHAA 4J2XA 1CE7B 4ZFYB 2ZQOA 3WINC 3A07A 4WBCA 1G82A 1HIBA 2D20A 4KEJA 4Q9GA 1FN0A 3FJAA 3AJ6A 3BA7A 3JRRA 1NUNA 1N4KA 3FJJA 4IY9A 4XFTA 1SR4A 3FUQA 2ET2A 5G00A 2KI4A 3WO2A 4P6AA 5FZYA 2DRZA 5FZZA 3K1XA 2VU9A 3BA4A 4HR6C 4EKXB 3BTAA 4DEPA 4G9MA 1FGAA 1W3AA 1V6UA 4X39A 3W9TA 5BXPA 2IWTB 1P63A 3FJFA 3VEQA 4ZKTB 2NM1A 3A22A 1A8DA 4I4OA 3C9ZA 1AVXB 4LO7B 4I4YA 3FJHA 1HWOB 2Y9GA 3AKHA 4I37A 1ILR1 1JTCA 3F62B 2AFGA 4QKSA 1ISVA 4JAWA 4GP0A 3HMYA 4P0JA 2E4MC 3O4AA 3NBCA 1BASA 4PC4A 3IM5A 3POKA 3UD9A 1Q03A 3BB2A 5F8SA 3CA1A 1JLXA 3AZWA 3O49A 2D7RA 3WA1A 4HA2A 4Q9PA 4J2KA 1IT0A 2BEAA 3RTIB 2GZBA 4I1BA 4QD2C 1AVUA 3ZC9A 1HWNB 4ZFWB 3D7WB 4I4SA 3Q7YA 3R4SA 1I1BA 4D0TA 5BQUC 1V6XA 3VSZA 1G9AA 3OBRA 1BFGA 4EB2B 1AVAC 3AZVA 5BP5A 4GAIA 1XYFA 3AH4A 4J2YA 4IONA 4JQ0A 1YBIA 4I4RA 4A7YA 5F8WA 1PWAA 3NJ5A 1XZZA 2NVHA 3QYDA 2FO1A 3HN1A 4LO3A 3E8LC 1W3GA 4QBVA 3PUBA 1CVSA 4ZA3B 1KNMA 3NBDA 4H9WA 1WD3A 4G6MA 4H04A 1S0EA 2ESUA 4FGFA 3CA3A 1E0OA 1ONKB 5FNWA 2NP0A 3CQAA 4I4QA 1G9DA 3BRGC 4ENDA 4EFRA 1IRAX 4OUJA 5BXRA 3V0BA 2LIEA 2RG9B 1HKNA 3VSFA 3LTQA 4A7ZA 2XOAA 7I1BA 4J2SA 1JT5A 1BFFA 1YYNA 3FFZA 3P53A 3FJEA 4LO2C 5DZUA 3O3QA 3BRDA 2KI6B 4Q91A 1R8OA 4I3NA 3O44A 3QR5A 1BARA 3RSJA 4I96A 2MLLB 4Z9WB 3WINA 3P6JA 1JT3A 4HJJA 1RMLA 1DFQA 1IRPA 3WMVA 4F34A 4I7IA 3AJ5A 3V0BB 3AH1A 4JKQA 4KC3A 4QBCA 1M2TB 3N0KA 4LO0C 5GAQA 3SNVA 4QKRA 4G1RA 4F83A 3WMUA 1PUMB 5JMCA 2MC2A 3AKIA 1DZCA 2D22A 2AQZA 2MIBA 1S0BA 1BLAA 4OEFA 1UPSA 1V6WA 4DENA 2DREA 3O4BA 1BFCA 2DS0A 3O4DA 3V0AA 5EG6C 1D0HA 4ZGRB 2ZQNA 3ILAA 21BIA 2KLLA 3F1RA 3UJ0A 1G9CA 3TC2A 3FJBA 2Z48A 1DLLA 1MC9A 3EF2A 2E4MA 4I4XA 4I6IA 3JUTA 1FV3A 4GP3A 4I8MA 2X2SA 1L2HA 4I2SA 1HCEA 4OWKA 4ZBVB 2AXMA 4IZEA 4ZOTA 3V0AB 4JP0A 1ABRB 5I1BA 2K8RA 3RMXA 1DZDA 6I1BA 3FJ9A 4QC4A 5BQUA 3H6QA 3OJVA 1AFCA 4OWJA 4G6JA 3BX1C 3RTJB 3CA5A 3V79C 4LO1C 5BVPI 3VT2A 3ZC8A 3A23A 3OJ2A 1BLDA 2FFUA 3LLPA 1S0LA 3PG0A 1RZOB 4L4IA 1MD6A 4OWLA 1T9FA 31BIA 3CAHA 4QD2B 1Z0HA 2VLCA 2IHOA 2KH2A 3BAOA 2P23A 4GOVA 5D62A 4I1EA 5HPZA 3I2XA 3IIRA 3CA0A 4EEEB 1PZZA 1FMMS 1AVWB 4YOLA 2K4AB 2D7IA 2Y9XE 3BAQA 5D61A 3VT1A 4A7KA 3T8SA 4GOYA 4J23B 2F2FC 4P0KA 4LO2A 4R6UB 1FWVA 3N7JA 4FVVA 5DUYA 4OEGA 4AN6A 3BAHA 4TLPA 3AKFA 5BP5C 1FWUA 2VSEA 3OBTA 1IOBA 2Q9XA 1DJSB 1SZ6B 1Z2VA 3FJ8A 3Q7XA 2KKIA 2QN4A 1TWEA 4ZFUB 3VT0A 4LO3C 2ERMA 1DFCA 2X2TA 1OQLB 3CRIA 2LIQA 1TIEA 5FNXA 4Z8SB 3PHZA 2NZ9A 4LO0A 4QO3A 2F8XC 3CA6A 1S0FA 4IQPA 4XFUA 4OEEA 5FZUA 2GO2A 3CA4A 2VSAA 2RSTA 1Q04A 4AN7B 2DRYA 2UUSA 1EVTA 3MPPG 1HCDA 3RMYA 3FJIA 3HALA 1YF8B 2D1ZA 1M16A 3IAGC 4JKXB 2HZ9A 1TP0A 4EFQA 3VWCA 2BFHA 4XFSA 2HWMA 2D43A 1FV2A 5DVHA 2P39A 2D23A 4D8HA 5D63A 2Y9FA 5BXTA 1G9BA 3N7KA 2I1BA 3WO4A 2NTDA 2YUGA 1EPWA 2VUAA 2D44A 1T4QA 1DQGA 3S8KA 4G9NA 3S8JA 4I4PA 1IILA 1ISXA 1TWMA 3PMEA 2R9KB 1BFBA 4LO7C 1RG8A 3FJKA 3NBEA 4X38A 3N7MA 3I2AA 3IM7A 2NYYA 1AXMA 3BAVA 1PC8B 1SR4C 3BAUA 2Q3NB 1AF9A 1ISWA 2FGFA 3H6RA 2K43A 3BA5A 3B9UA 3HOMA 3I29B 3UD7A 3FJDA 4IHZA 2D24A 1ISZA 4LO1A 1GGPB 1JT7A 2QYIB 2WRYA 3O4OA 4ISQA 1DIWA 2FDBM 4CJMA 3BAGA 2L5XA 1TFMB 1JY0A 4X3AA 2Y9WC 1S0CA 5F90A 1W3FA 3BADA 3MALA 3FJCA 2M49A 3OJMA 5B2HA 1EYLA 3ZXGA 4IZXA 1J0SA 4P0LA 8I1BA 3AH2A 4EFPA 1QXMA 4QALA 4GAFA 4KBBA 1S0DA 3H6RB 1XHBA 5F8YA 1QQKA 1YXWA 4KEKA 4JPZA 4D0ZA 1TTUA 1II4A 5BOWA 2J3PA 4KEIA 4ZLBB 2F2FA 2VXTI 1JQZA 1JT4A 3A21A 4XKIA 1JLYA 1BA7A 3FGMA 5DSSB 3H6SE 4LO8B 1XG6A 2WBCA 1Z4SA 4I4VA 3FUOA 1ISYA 3O5WB 3AKGA 1I1EA 1K5VA 1VCLA 4OW4A 4DCKC 3N7LA 1FMZA 3HBWA 1HWMB 2VXRA 2HW9A 1EV2A 2BEBA 2RQ9A 1DQOA 5EC5A 1ITBA 3CRGA 4USOA 1FQ9A 9ILBA 3NBNA 4I0YA 3IM6A
chains in the Genus database with same CATH superfamily
4IY8A 1R8NA 1QQLA 3UJ4A 4L4HA 3UD8A 3OGGA 2Z49A 1RY7A 1WBCA 5JLVA 1WD4A 4II0A 4X37A 1IHKA 1Q1UA 1V6VA 1NZKA 1F31A 5E24E 4H75A 3UDAA 3KMVA 3P6IA 4MZHA 3Q7WA 5BXSA 1WBAA 4I4UA 1S0GA 1HWPB 2FFVA 3R4UA 4IYBA 2AAIB 1IJTA 3BRFA 1K5UA 4USPA 1PUUB 4JRAA 3CRHA 3CU1B 3WO3A 3VUOA 3ZX7A 1YTOA 2HWAA 2ZR1B 1TOOA 3OGFA 3O4CA 3ZXDA 4ISRA 41BIA 3HSMA 5EHAA 4J2XA 1CE7B 4ZFYB 2ZQOA 3WINC 3A07A 4WBCA 1G82A 1HIBA 2D20A 4KEJA 4Q9GA 1FN0A 3FJAA 3AJ6A 3BA7A 3JRRA 1NUNA 1N4KA 3FJJA 4IY9A 4XFTA 1SR4A 3FUQA 2ET2A 5G00A 2KI4A 3WO2A 4P6AA 5FZYA 2DRZA 5FZZA 3K1XA 2VU9A 3BA4A 4HR6C 4EKXB 3BTAA 4DEPA 4G9MA 1FGAA 1W3AA 1V6UA 4X39A 3W9TA 5BXPA 2IWTB 1P63A 3FJFA 3VEQA 4ZKTB 2NM1A 3A22A 1A8DA 4I4OA 3C9ZA 4UY4A 1AVXB 4LO7B 4I4YA 3FJHA 1HWOB 2Y9GA 3AKHA 4I37A 1ILR1 1JTCA 3F62B 2AFGA 4QKSA 1ISVA 4JAWA 4GP0A 3HMYA 4P0JA 2E4MC 3O4AA 3NBCA 1BASA 4PC4A 3IM5A 3POKA 3UD9A 1Q03A 3BB2A 5F8SA 3CA1A 1JLXA 3AZWA 3O49A 2D7RA 3WA1A 4HA2A 4Q9PA 4J2KA 1IT0A 2BEAA 3RTIB 2GZBA 4I1BA 4QD2C 1AVUA 3ZC9A 1HWNB 4ZFWB 3D7WB 4I4SA 3Q7YA 3R4SA 1I1BA 4D0TA 5BQUC 1V6XA 3VSZA 1G9AA 3OBRA 1BFGA 4EB2B 1AVAC 3AZVA 5BP5A 4GAIA 1XYFA 3AH4A 4J2YA 4IONA 4JQ0A 1YBIA 4I4RA 4A7YA 5F8WA 1PWAA 3NJ5A 1XZZA 2NVHA 3QYDA 2FO1A 3HN1A 4LO3A 3E8LC 1W3GA 4QBVA 3PUBA 1CVSA 4ZA3B 1KNMA 3NBDA 4H9WA 1WD3A 4G6MA 4H04A 1S0EA 2ESUA 4FGFA 3CA3A 1E0OA 1ONKB 5FNWA 2NP0A 3CQAA 4I4QA 1G9DA 3BRGC 4ENDA 4EFRA 1IRAX 4OUJA 5BXRA 3V0BA 2LIEA 2RG9B 1HKNA 3VSFA 3LTQA 4A7ZA 2XOAA 7I1BA 4J2SA 1JT5A 1BFFA 1YYNA 3FFZA 3P53A 3FJEA 4LO2C 5DZUA 3O3QA 3BRDA 2KI6B 4Q91A 1R8OA 4I3NA 3O44A 3QR5A 1BARA 3RSJA 4I96A 2MLLB 4Z9WB 3WINA 3P6JA 1JT3A 4HJJA 1RMLA 4MZFB 1DFQA 1IRPA 3WMVA 4F34A 4I7IA 3AJ5A 3V0BB 3AH1A 4JKQA 4KC3A 4QBCA 1M2TB 3N0KA 4LO0C 5GAQA 3SNVA 4QKRA 4G1RA 4F83A 3WMUA 1PUMB 5JMCA 2MC2A 3AKIA 1DZCA 2D22A 2AQZA 2MIBA 1S0BA 1BLAA 4OEFA 1UPSA 1V6WA 4DENA 2DREA 3O4BA 1BFCA 2DS0A 3O4DA 3V0AA 5EG6C 1D0HA 4ZGRB 2ZQNA 3ILAA 21BIA 2KLLA 3F1RA 3UJ0A 1G9CA 3TC2A 3FJBA 2Z48A 1DLLA 1MC9A 3EF2A 2E4MA 4I4XA 4I6IA 3JUTA 1FV3A 4GP3A 4I8MA 2X2SA 1L2HA 4I2SA 1HCEA 4OWKA 4ZBVB 2AXMA 4IZEA 4ZOTA 3V0AB 4JP0A 1ABRB 5I1BA 2K8RA 3RMXA 1DZDA 6I1BA 3FJ9A 4QC4A 5BQUA 3H6QA 3OJVA 1AFCA 4OWJA 4G6JA 3BX1C 3RTJB 3CA5A 3V79C 4LO1C 5BVPI 3VT2A 3ZC8A 3A23A 3OJ2A 1BLDA 2FFUA 3LLPA 1S0LA 3PG0A 1RZOB 4L4IA 1MD6A 4OWLA 1T9FA 31BIA 3CAHA 4QD2B 1Z0HA 2VLCA 2IHOA 2KH2A 3BAOA 2P23A 4GOVA 5D62A 4I1EA 5HPZA 3I2XA 3IIRA 3CA0A 4EEEB 1PZZA 1FMMS 1AVWB 4YOLA 2K4AB 2D7IA 2Y9XE 3BAQA 5D61A 3VT1A 4A7KA 3T8SA 4GOYA 4J23B 2F2FC 4P0KA 4LO2A 4R6UB 1FWVA 3N7JA 4FVVA 5DUYA 4OEGA 4AN6A 3BAHA 4TLPA 3AKFA 5BP5C 1FWUA 2VSEA 3OBTA 1IOBA 2Q9XA 1DJSB 1SZ6B 1Z2VA 3FJ8A 3Q7XA 2KKIA 2QN4A 1TWEA 4ZFUB 3VT0A 4LO3C 2ERMA 1DFCA 2X2TA 1OQLB 3CRIA 2LIQA 1TIEA 5FNXA 4Z8SB 3PHZA 2NZ9A 4LO0A 4QO3A 2F8XC 3CA6A 1S0FA 4IQPA 4XFUA 4OEEA 5FZUA 2GO2A 3CA4A 2VSAA 2RSTA 1Q04A 4AN7B 2DRYA 2UUSA 1EVTA 3MPPG 1HCDA 3RMYA 3FJIA 3HALA 1YF8B 2D1ZA 1M16A 3IAGC 4JKXB 2HZ9A 1TP0A 4EFQA 3VWCA 2BFHA 4XFSA 2HWMA 2D43A 1FV2A 5DVHA 2P39A 2D23A 4D8HA 5D63A 2Y9FA 5BXTA 1G9BA 3N7KA 2I1BA 3WO4A 2NTDA 2YUGA 1EPWA 2VUAA 2D44A 1T4QA 1DQGA 3S8KA 4G9NA 3S8JA 4I4PA 1IILA 1ISXA 1TWMA 3PMEA 2R9KB 1BFBA 4LO7C 1RG8A 3FJKA 3NBEA 4X38A 3N7MA 3I2AA 3IM7A 2NYYA 1AXMA 3BAVA 1PC8B 1SR4C 3BAUA 2Q3NB 1AF9A 1ISWA 2FGFA 3H6RA 2K43A 3BA5A 3B9UA 3HOMA 3I29B 3UD7A 3FJDA 4IHZA 2D24A 1ISZA 4LO1A 1GGPB 1JT7A 2QYIB 2WRYA 3O4OA 4ISQA 1DIWA 2FDBM 4CJMA 3BAGA 2L5XA 1TFMB 1JY0A 4X3AA 2Y9WC 1S0CA 5F90A 1W3FA 3BADA 3MALA 3FJCA 2M49A 3OJMA 5B2HA 1EYLA 3ZXGA 4IZXA 1J0SA 4P0LA 8I1BA 3AH2A 4EFPA 1QXMA 4MZGB 4QALA 4GAFA 4KBBA 1S0DA 3H6RB 1XHBA 5F8YA 1QQKA 1YXWA 4KEKA 4JPZA 4D0ZA 1TTUA 1II4A 5BOWA 2J3PA 4KEIA 4ZLBB 2F2FA 2VXTI 1JQZA 1JT4A 3A21A 4XKIA 1JLYA 2NS2A 1BA7A 3FGMA 5DSSB 3H6SE 4LO8B 1XG6A 2WBCA 1Z4SA 4I4VA 3FUOA 1ISYA 3O5WB 3AKGA 1I1EA 1K5VA 1VCLA 4OW4A 4DCKC 3N7LA 1FMZA 3HBWA 1HWMB 2VXRA 2HW9A 1EV2A 2BEBA 2RQ9A 1DQOA 5EC5A 1ITBA 3CRGA 4USOA 1FQ9A 9ILBA 3NBNA 4I0YA 3IM6A
chains in the Genus database with same CATH topology
4IY8A 1R8NA 1QQLA 3UJ4A 4L4HA 3UD8A 3OGGA 2Z49A 1RY7A 1WBCA 5JLVA 1WD4A 4II0A 4X37A 1IHKA 1Q1UA 1V6VA 1NZKA 1F31A 5E24E 4H75A 3UDAA 3KMVA 3P6IA 4MZHA 3Q7WA 5BXSA 1WBAA 4I4UA 1S0GA 1HWPB 2FFVA 3R4UA 4IYBA 2AAIB 1IJTA 3BRFA 1K5UA 4USPA 1PUUB 4JRAA 3CRHA 3CU1B 3WO3A 3VUOA 3ZX7A 1YTOA 2HWAA 2ZR1B 1TOOA 3OGFA 3O4CA 3ZXDA 4ISRA 41BIA 3HSMA 5EHAA 4J2XA 1CE7B 4ZFYB 2ZQOA 3WINC 3A07A 4WBCA 1G82A 1HIBA 2D20A 4KEJA 4Q9GA 1FN0A 3FJAA 3AJ6A 3BA7A 3JRRA 1NUNA 1N4KA 3FJJA 4IY9A 4XFTA 1SR4A 3FUQA 2ET2A 5G00A 2KI4A 3WO2A 4P6AA 5FZYA 2DRZA 5FZZA 3K1XA 2VU9A 3BA4A 4HR6C 4EKXB 3BTAA 4DEPA 4G9MA 1FGAA 1W3AA 1V6UA 4X39A 3W9TA 5BXPA 2IWTB 1P63A 3FJFA 3VEQA 4ZKTB 2NM1A 3A22A 1A8DA 4I4OA 3C9ZA 4UY4A 1AVXB 4LO7B 4I4YA 3FJHA 1HWOB 2Y9GA 3AKHA 4I37A 1ILR1 1JTCA 3F62B 2AFGA 4QKSA 1ISVA 4JAWA 4GP0A 3HMYA 4P0JA 2E4MC 3O4AA 3NBCA 1BASA 4PC4A 3IM5A 3POKA 3UD9A 1Q03A 3BB2A 5F8SA 3CA1A 1JLXA 3AZWA 3O49A 2D7RA 3WA1A 4HA2A 4Q9PA 4J2KA 1IT0A 2BEAA 3RTIB 2GZBA 4I1BA 4QD2C 1AVUA 3ZC9A 1HWNB 4ZFWB 3D7WB 4I4SA 3Q7YA 3R4SA 1I1BA 4D0TA 5BQUC 1V6XA 3VSZA 1G9AA 3OBRA 1BFGA 4EB2B 1AVAC 3AZVA 5BP5A 4GAIA 1XYFA 3AH4A 4J2YA 4IONA 4JQ0A 1YBIA 4I4RA 4A7YA 5F8WA 1PWAA 3NJ5A 1XZZA 2NVHA 3QYDA 2FO1A 3HN1A 4LO3A 3E8LC 1W3GA 4QBVA 3PUBA 1CVSA 4ZA3B 1KNMA 3NBDA 4H9WA 1WD3A 4G6MA 4H04A 1S0EA 2ESUA 4FGFA 3CA3A 1E0OA 1ONKB 5FNWA 2NP0A 3CQAA 4I4QA 1G9DA 3BRGC 4ENDA 4EFRA 1IRAX 4OUJA 5BXRA 3V0BA 2LIEA 2RG9B 1HKNA 3VSFA 3LTQA 4A7ZA 2XOAA 7I1BA 4J2SA 1JT5A 1BFFA 1YYNA 3FFZA 3P53A 3FJEA 4LO2C 5DZUA 3O3QA 3BRDA 2KI6B 4Q91A 1R8OA 4I3NA 3O44A 3QR5A 1BARA 3RSJA 4I96A 2MLLB 4Z9WB 3WINA 3P6JA 1JT3A 4HJJA 1RMLA 4MZFB 1DFQA 1IRPA 3WMVA 4F34A 4I7IA 3AJ5A 3V0BB 3AH1A 4JKQA 4KC3A 4QBCA 1M2TB 3N0KA 4LO0C 5GAQA 3SNVA 4QKRA 4G1RA 4F83A 3WMUA 1PUMB 5JMCA 2MC2A 3AKIA 1DZCA 2D22A 2AQZA 2MIBA 1S0BA 1BLAA 4OEFA 1UPSA 1V6WA 4DENA 2DREA 3O4BA 1BFCA 2DS0A 3O4DA 3V0AA 5EG6C 1D0HA 4ZGRB 2ZQNA 3ILAA 21BIA 2KLLA 3F1RA 3UJ0A 1G9CA 3TC2A 3FJBA 2Z48A 1DLLA 1MC9A 3EF2A 2E4MA 4I4XA 4I6IA 3JUTA 1FV3A 4GP3A 4I8MA 2X2SA 1L2HA 4I2SA 1HCEA 4OWKA 4ZBVB 2AXMA 4IZEA 4ZOTA 3V0AB 4JP0A 1ABRB 5I1BA 2K8RA 3RMXA 1DZDA 6I1BA 3FJ9A 4QC4A 5BQUA 3H6QA 3OJVA 1AFCA 4OWJA 4G6JA 3BX1C 3RTJB 3CA5A 3V79C 4LO1C 5BVPI 3VT2A 3ZC8A 3A23A 3OJ2A 1BLDA 2FFUA 3LLPA 1S0LA 3PG0A 1RZOB 4L4IA 1MD6A 4OWLA 1T9FA 31BIA 3CAHA 4QD2B 1Z0HA 2VLCA 2IHOA 2KH2A 3BAOA 2P23A 4GOVA 5D62A 4I1EA 5HPZA 3I2XA 3IIRA 3CA0A 4EEEB 1PZZA 1FMMS 1AVWB 4YOLA 2K4AB 2D7IA 2Y9XE 3BAQA 5D61A 3VT1A 4A7KA 3T8SA 4GOYA 4J23B 2F2FC 4P0KA 4LO2A 4R6UB 1FWVA 3N7JA 4FVVA 5DUYA 4OEGA 4AN6A 3BAHA 4TLPA 3AKFA 5BP5C 1FWUA 2VSEA 3OBTA 1IOBA 2Q9XA 1DJSB 1SZ6B 1Z2VA 3FJ8A 3Q7XA 2KKIA 2QN4A 1TWEA 4ZFUB 3VT0A 4LO3C 2ERMA 1DFCA 2X2TA 1OQLB 3CRIA 2LIQA 1TIEA 5FNXA 4Z8SB 3PHZA 2NZ9A 4LO0A 4QO3A 2F8XC 3CA6A 1S0FA 4IQPA 4XFUA 4OEEA 5FZUA 2GO2A 3CA4A 2VSAA 2RSTA 1Q04A 4AN7B 2DRYA 2UUSA 1EVTA 3MPPG 1HCDA 3RMYA 3FJIA 3HALA 1YF8B 2D1ZA 1M16A 3IAGC 4JKXB 2HZ9A 1TP0A 4EFQA 3VWCA 2BFHA 4XFSA 2HWMA 2D43A 1FV2A 5DVHA 2P39A 2D23A 4D8HA 5D63A 2Y9FA 5BXTA 1G9BA 3N7KA 2I1BA 3WO4A 2NTDA 2YUGA 1EPWA 2VUAA 2D44A 1T4QA 1DQGA 3S8KA 4G9NA 3S8JA 4I4PA 1IILA 1ISXA 1TWMA 3PMEA 2R9KB 1BFBA 4LO7C 1RG8A 3FJKA 3NBEA 4X38A 3N7MA 3I2AA 3IM7A 2NYYA 1AXMA 3BAVA 1PC8B 1SR4C 3BAUA 2Q3NB 1AF9A 1ISWA 2FGFA 3H6RA 2K43A 3BA5A 3B9UA 3HOMA 3I29B 3UD7A 3FJDA 4IHZA 2D24A 1ISZA 4LO1A 1GGPB 1JT7A 2QYIB 2WRYA 3O4OA 4ISQA 1DIWA 2FDBM 4CJMA 3BAGA 2L5XA 1TFMB 1JY0A 4X3AA 2Y9WC 1S0CA 5F90A 1W3FA 3BADA 3MALA 3FJCA 2M49A 3OJMA 5B2HA 1EYLA 3ZXGA 4IZXA 1J0SA 4P0LA 8I1BA 3AH2A 4EFPA 1QXMA 4MZGB 4QALA 4GAFA 4KBBA 1S0DA 3H6RB 1XHBA 5F8YA 1QQKA 1YXWA 4KEKA 4JPZA 4D0ZA 1TTUA 1II4A 5BOWA 2J3PA 4KEIA 4ZLBB 2F2FA 2VXTI 1JQZA 1JT4A 3A21A 4XKIA 1JLYA 2NS2A 1BA7A 3FGMA 5DSSB 3H6SE 4LO8B 1XG6A 2WBCA 1Z4SA 4I4VA 3FUOA 1ISYA 3O5WB 3AKGA 1I1EA 1K5VA 1VCLA 4OW4A 4DCKC 3N7LA 1FMZA 3HBWA 1HWMB 2VXRA 2HW9A 1EV2A 2BEBA 2RQ9A 1DQOA 5EC5A 1ITBA 3CRGA 4USOA 1FQ9A 9ILBA 3NBNA 4I0YA 3IM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IY8 A;  1R8N A;  1QQL A;  3UJ4 A;  4L4H A;  3UD8 A;  3OGG A;  2Z49 A;  1RY7 A;  1WBC A;  5JLV A;  1WD4 A;  4II0 A;  4X37 A;  1IHK A;  1Q1U A;  1V6V A;  1NZK A;  1F31 A;  5E24 E;  3UDA A;  3KMV A;  3P6I A;  3Q7W A;  5BXS A;  1WBA A;  4I4U A;  1S0G A;  1HWP B;  2FFV A;  3R4U A;  4IYB A;  2AAI B;  1IJT A;  3BRF A;  1K5U A;  4USP A;  1PUU B;  4JRA A;  3CRH A;  3CU1 B;  3WO3 A;  3VUO A;  3ZX7 A;  1YTO A;  2HWA A;  2ZR1 B;  1TOO A;  3OGF A;  3O4C A;  3ZXD A;  4ISR A;  41BI A;  3HSM A;  5EHA A;  4J2X A;  1CE7 B;  4ZFY B;  2ZQO A;  3WIN C;  3A07 A;  4WBC A;  1G82 A;  1HIB A;  2D20 A;  4KEJ A;  4Q9G A;  1FN0 A;  3FJA A;  3AJ6 A;  3BA7 A;  3JRR A;  1NUN A;  1N4K A;  3FJJ A;  4IY9 A;  4XFT A;  1SR4 A;  3FUQ A;  2ET2 A;  5G00 A;  2KI4 A;  3WO2 A;  4P6A A;  5FZY A;  2DRZ A;  5FZZ A;  3K1X A;  2VU9 A;  3BA4 A;  4HR6 C;  4EKX B;  3BTA A;  4DEP A;  4G9M A;  1FGA A;  1W3A A;  1V6U A;  4X39 A;  3W9T A;  5BXP A;  2IWT B;  1P63 A;  3FJF A;  3VEQ A;  4ZKT B;  2NM1 A;  3A22 A;  1A8D A;  4I4O A;  3C9Z A;  1AVX B;  4LO7 B;  4I4Y A;  3FJH A;  1HWO B;  2Y9G A;  3AKH A;  4I37 A;  1ILR 1;  1JTC A;  3F62 B;  2AFG A;  4QKS A;  1ISV A;  4JAW A;  4GP0 A;  3HMY A;  4P0J A;  2E4M C;  3O4A A;  3NBC A;  1BAS A;  4PC4 A;  3IM5 A;  3POK A;  3UD9 A;  1Q03 A;  3BB2 A;  5F8S A;  3CA1 A;  1JLX A;  3AZW A;  3O49 A;  2D7R A;  3WA1 A;  4HA2 A;  4Q9P A;  4J2K A;  1IT0 A;  2BEA A;  3RTI B;  2GZB A;  4I1B A;  4QD2 C;  1AVU A;  3ZC9 A;  1HWN B;  4ZFW B;  3D7W B;  4I4S A;  3Q7Y A;  3R4S A;  1I1B A;  4D0T A;  5BQU C;  1V6X A;  3VSZ A;  1G9A A;  3OBR A;  1BFG A;  4EB2 B;  1AVA C;  3AZV A;  5BP5 A;  4GAI A;  1XYF A;  3AH4 A;  4J2Y A;  4ION A;  4JQ0 A;  1YBI A;  4I4R A;  4A7Y A;  5F8W A;  1PWA A;  3NJ5 A;  1XZZ A;  2NVH A;  3QYD A;  2FO1 A;  3HN1 A;  4LO3 A;  3E8L C;  1W3G A;  4QBV A;  3PUB A;  1CVS A;  4ZA3 B;  1KNM A;  3NBD A;  4H9W A;  1WD3 A;  4G6M A;  4H04 A;  1S0E A;  2ESU A;  4FGF A;  3CA3 A;  1E0O A;  1ONK B;  5FNW A;  2NP0 A;  3CQA A;  4I4Q A;  1G9D A;  3BRG C;  4END A;  4EFR A;  1IRA X;  4OUJ A;  5BXR A;  3V0B A;  2LIE A;  2RG9 B;  1HKN A;  3VSF A;  3LTQ A;  4A7Z A;  2XOA A;  7I1B A;  4J2S A;  1JT5 A;  1BFF A;  1YYN A;  3FFZ A;  3P53 A;  3FJE A;  4LO2 C;  5DZU A;  3O3Q A;  3BRD A;  2KI6 B;  4Q91 A;  1R8O A;  4I3N A;  3O44 A;  3QR5 A;  1BAR A;  3RSJ A;  4I96 A;  2MLL B;  4Z9W B;  3WIN A;  3P6J A;  1JT3 A;  4HJJ A;  1RML A;  1DFQ A;  1IRP A;  3WMV A;  4F34 A;  4I7I A;  3AJ5 A;  3V0B B;  3AH1 A;  4JKQ A;  4KC3 A;  4QBC A;  1M2T B;  3N0K A;  4LO0 C;  5GAQ A;  3SNV A;  4QKR A;  4G1R A;  4F83 A;  3WMU A;  1PUM B;  5JMC A;  2MC2 A;  3AKI A;  1DZC A;  2D22 A;  2AQZ A;  2MIB A;  1S0B A;  1BLA A;  4OEF A;  1UPS A;  1V6W A;  4DEN A;  2DRE A;  3O4B A;  1BFC A;  2DS0 A;  3O4D A;  3V0A A;  5EG6 C;  1D0H A;  4ZGR B;  2ZQN A;  3ILA A;  21BI A;  2KLL A;  3F1R A;  3UJ0 A;  1G9C A;  3TC2 A;  3FJB A;  2Z48 A;  1DLL A;  1MC9 A;  3EF2 A;  2E4M A;  4I4X A;  4I6I A;  3JUT A;  1FV3 A;  4GP3 A;  4I8M A;  2X2S A;  1L2H A;  4I2S A;  1HCE A;  4OWK A;  4ZBV B;  2AXM A;  4IZE A;  4ZOT A;  3V0A B;  4JP0 A;  1ABR B;  5I1B A;  2K8R A;  3RMX A;  1DZD A;  6I1B A;  3FJ9 A;  4QC4 A;  5BQU A;  3H6Q A;  3OJV A;  1AFC A;  4OWJ A;  4G6J A;  3BX1 C;  3RTJ B;  3CA5 A;  3V79 C;  4LO1 C;  5BVP I;  3VT2 A;  3ZC8 A;  3A23 A;  3OJ2 A;  1BLD A;  2FFU A;  3LLP A;  1S0L A;  3PG0 A;  1RZO B;  4L4I A;  1MD6 A;  4OWL A;  1T9F A;  31BI A;  3CAH A;  4QD2 B;  1Z0H A;  2VLC A;  2IHO A;  2KH2 A;  3BAO A;  2P23 A;  4GOV A;  5D62 A;  4I1E A;  5HPZ A;  3I2X A;  3IIR A;  3CA0 A;  4EEE B;  1PZZ A;  1FMM S;  1AVW B;  4YOL A;  2K4A B;  2D7I A;  2Y9X E;  3BAQ A;  5D61 A;  3VT1 A;  4A7K A;  3T8S A;  4GOY A;  4J23 B;  2F2F C;  4P0K A;  4LO2 A;  4R6U B;  1FWV A;  3N7J A;  4FVV A;  5DUY A;  4OEG A;  4AN6 A;  3BAH A;  4TLP A;  3AKF A;  5BP5 C;  1FWU A;  2VSE A;  3OBT A;  1IOB A;  2Q9X A;  1DJS B;  1SZ6 B;  1Z2V A;  3FJ8 A;  3Q7X A;  2KKI A;  2QN4 A;  1TWE A;  4ZFU B;  3VT0 A;  4LO3 C;  2ERM A;  1DFC A;  2X2T A;  1OQL B;  3CRI A;  2LIQ A;  1TIE A;  5FNX A;  4Z8S B;  3PHZ A;  2NZ9 A;  4LO0 A;  4QO3 A;  2F8X C;  3CA6 A;  1S0F A;  4IQP A;  4XFU A;  4OEE A;  5FZU A;  2GO2 A;  3CA4 A;  2VSA A;  2RST A;  1Q04 A;  4AN7 B;  2DRY A;  2UUS A;  1EVT A;  3MPP G;  1HCD A;  3RMY A;  3FJI A;  3HAL A;  1YF8 B;  2D1Z A;  1M16 A;  3IAG C;  4JKX B;  2HZ9 A;  1TP0 A;  4EFQ A;  3VWC A;  2BFH A;  4XFS A;  2HWM A;  2D43 A;  1FV2 A;  5DVH A;  2P39 A;  2D23 A;  4D8H A;  5D63 A;  2Y9F A;  5BXT A;  1G9B A;  3N7K A;  2I1B A;  3WO4 A;  2NTD A;  2YUG A;  1EPW A;  2VUA A;  2D44 A;  1T4Q A;  1DQG A;  3S8K A;  4G9N A;  3S8J A;  4I4P A;  1IIL A;  1ISX A;  1TWM A;  3PME A;  2R9K B;  1BFB A;  4LO7 C;  1RG8 A;  3FJK A;  3NBE A;  4X38 A;  3N7M A;  3I2A A;  3IM7 A;  2NYY A;  1AXM A;  3BAV A;  1PC8 B;  1SR4 C;  3BAU A;  2Q3N B;  1AF9 A;  1ISW A;  2FGF A;  3H6R A;  2K43 A;  3BA5 A;  3B9U A;  3HOM A;  3I29 B;  3UD7 A;  3FJD A;  4IHZ A;  2D24 A;  1ISZ A;  4LO1 A;  1GGP B;  1JT7 A;  2QYI B;  2WRY A;  3O4O A;  4ISQ A;  1DIW A;  2FDB M;  4CJM A;  3BAG A;  2L5X A;  1TFM B;  1JY0 A;  4X3A A;  2Y9W C;  1S0C A;  5F90 A;  1W3F A;  3BAD A;  3MAL A;  3FJC A;  2M49 A;  3OJM A;  5B2H A;  1EYL A;  3ZXG A;  4IZX A;  1J0S A;  4P0L A;  8I1B A;  3AH2 A;  4EFP A;  1QXM A;  4QAL A;  4GAF A;  4KBB A;  1S0D A;  3H6R B;  1XHB A;  5F8Y A;  1QQK A;  1YXW A;  4KEK A;  4JPZ A;  4D0Z A;  1TTU A;  1II4 A;  5BOW A;  2J3P A;  4KEI A;  4ZLB B;  2F2F A;  2VXT I;  1JQZ A;  1JT4 A;  3A21 A;  4XKI A;  1JLY A;  1BA7 A;  3FGM A;  5DSS B;  3H6S E;  4LO8 B;  1XG6 A;  2WBC A;  1Z4S A;  4I4V A;  3FUO A;  1ISY A;  3O5W B;  3AKG A;  1I1E A;  1K5V A;  1VCL A;  4OW4 A;  4DCK C;  3N7L A;  1FMZ A;  3HBW A;  1HWM B;  2VXR A;  2HW9 A;  1EV2 A;  2BEB A;  2RQ9 A;  1DQO A;  5EC5 A;  1ITB A;  3CRG A;  4USO A;  1FQ9 A;  9ILB A;  3NBN A;  4I0Y A;  3IM6 A; 
#chains in the Genus database with same CATH topology
 4IY8 A;  1R8N A;  1QQL A;  3UJ4 A;  4L4H A;  3UD8 A;  3OGG A;  2Z49 A;  1RY7 A;  1WBC A;  5JLV A;  1WD4 A;  4II0 A;  4X37 A;  1IHK A;  1Q1U A;  1V6V A;  1NZK A;  1F31 A;  5E24 E;  4H75 A;  3UDA A;  3KMV A;  3P6I A;  4MZH A;  3Q7W A;  5BXS A;  1WBA A;  4I4U A;  1S0G A;  1HWP B;  2FFV A;  3R4U A;  4IYB A;  2AAI B;  1IJT A;  3BRF A;  1K5U A;  4USP A;  1PUU B;  4JRA A;  3CRH A;  3CU1 B;  3WO3 A;  3VUO A;  3ZX7 A;  1YTO A;  2HWA A;  2ZR1 B;  1TOO A;  3OGF A;  3O4C A;  3ZXD A;  4ISR A;  41BI A;  3HSM A;  5EHA A;  4J2X A;  1CE7 B;  4ZFY B;  2ZQO A;  3WIN C;  3A07 A;  4WBC A;  1G82 A;  1HIB A;  2D20 A;  4KEJ A;  4Q9G A;  1FN0 A;  3FJA A;  3AJ6 A;  3BA7 A;  3JRR A;  1NUN A;  1N4K A;  3FJJ A;  4IY9 A;  4XFT A;  1SR4 A;  3FUQ A;  2ET2 A;  5G00 A;  2KI4 A;  3WO2 A;  4P6A A;  5FZY A;  2DRZ A;  5FZZ A;  3K1X A;  2VU9 A;  3BA4 A;  4HR6 C;  4EKX B;  3BTA A;  4DEP A;  4G9M A;  1FGA A;  1W3A A;  1V6U A;  4X39 A;  3W9T A;  5BXP A;  2IWT B;  1P63 A;  3FJF A;  3VEQ A;  4ZKT B;  2NM1 A;  3A22 A;  1A8D A;  4I4O A;  3C9Z A;  4UY4 A;  1AVX B;  4LO7 B;  4I4Y A;  3FJH A;  1HWO B;  2Y9G A;  3AKH A;  4I37 A;  1ILR 1;  1JTC A;  3F62 B;  2AFG A;  4QKS A;  1ISV A;  4JAW A;  4GP0 A;  3HMY A;  4P0J A;  2E4M C;  3O4A A;  3NBC A;  1BAS A;  4PC4 A;  3IM5 A;  3POK A;  3UD9 A;  1Q03 A;  3BB2 A;  5F8S A;  3CA1 A;  1JLX A;  3AZW A;  3O49 A;  2D7R A;  3WA1 A;  4HA2 A;  4Q9P A;  4J2K A;  1IT0 A;  2BEA A;  3RTI B;  2GZB A;  4I1B A;  4QD2 C;  1AVU A;  3ZC9 A;  1HWN B;  4ZFW B;  3D7W B;  4I4S A;  3Q7Y A;  3R4S A;  1I1B A;  4D0T A;  5BQU C;  1V6X A;  3VSZ A;  1G9A A;  3OBR A;  1BFG A;  4EB2 B;  1AVA C;  3AZV A;  5BP5 A;  4GAI A;  1XYF A;  3AH4 A;  4J2Y A;  4ION A;  4JQ0 A;  1YBI A;  4I4R A;  4A7Y A;  5F8W A;  1PWA A;  3NJ5 A;  1XZZ A;  2NVH A;  3QYD A;  2FO1 A;  3HN1 A;  4LO3 A;  3E8L C;  1W3G A;  4QBV A;  3PUB A;  1CVS A;  4ZA3 B;  1KNM A;  3NBD A;  4H9W A;  1WD3 A;  4G6M A;  4H04 A;  1S0E A;  2ESU A;  4FGF A;  3CA3 A;  1E0O A;  1ONK B;  5FNW A;  2NP0 A;  3CQA A;  4I4Q A;  1G9D A;  3BRG C;  4END A;  4EFR A;  1IRA X;  4OUJ A;  5BXR A;  3V0B A;  2LIE A;  2RG9 B;  1HKN A;  3VSF A;  3LTQ A;  4A7Z A;  2XOA A;  7I1B A;  4J2S A;  1JT5 A;  1BFF A;  1YYN A;  3FFZ A;  3P53 A;  3FJE A;  4LO2 C;  5DZU A;  3O3Q A;  3BRD A;  2KI6 B;  4Q91 A;  1R8O A;  4I3N A;  3O44 A;  3QR5 A;  1BAR A;  3RSJ A;  4I96 A;  2MLL B;  4Z9W B;  3WIN A;  3P6J A;  1JT3 A;  4HJJ A;  1RML A;  4MZF B;  1DFQ A;  1IRP A;  3WMV A;  4F34 A;  4I7I A;  3AJ5 A;  3V0B B;  3AH1 A;  4JKQ A;  4KC3 A;  4QBC A;  1M2T B;  3N0K A;  4LO0 C;  5GAQ A;  3SNV A;  4QKR A;  4G1R A;  4F83 A;  3WMU A;  1PUM B;  5JMC A;  2MC2 A;  3AKI A;  1DZC A;  2D22 A;  2AQZ A;  2MIB A;  1S0B A;  1BLA A;  4OEF A;  1UPS A;  1V6W A;  4DEN A;  2DRE A;  3O4B A;  1BFC A;  2DS0 A;  3O4D A;  3V0A A;  5EG6 C;  1D0H A;  4ZGR B;  2ZQN A;  3ILA A;  21BI A;  2KLL A;  3F1R A;  3UJ0 A;  1G9C A;  3TC2 A;  3FJB A;  2Z48 A;  1DLL A;  1MC9 A;  3EF2 A;  2E4M A;  4I4X A;  4I6I A;  3JUT A;  1FV3 A;  4GP3 A;  4I8M A;  2X2S A;  1L2H A;  4I2S A;  1HCE A;  4OWK A;  4ZBV B;  2AXM A;  4IZE A;  4ZOT A;  3V0A B;  4JP0 A;  1ABR B;  5I1B A;  2K8R A;  3RMX A;  1DZD A;  6I1B A;  3FJ9 A;  4QC4 A;  5BQU A;  3H6Q A;  3OJV A;  1AFC A;  4OWJ A;  4G6J A;  3BX1 C;  3RTJ B;  3CA5 A;  3V79 C;  4LO1 C;  5BVP I;  3VT2 A;  3ZC8 A;  3A23 A;  3OJ2 A;  1BLD A;  2FFU A;  3LLP A;  1S0L A;  3PG0 A;  1RZO B;  4L4I A;  1MD6 A;  4OWL A;  1T9F A;  31BI A;  3CAH A;  4QD2 B;  1Z0H A;  2VLC A;  2IHO A;  2KH2 A;  3BAO A;  2P23 A;  4GOV A;  5D62 A;  4I1E A;  5HPZ A;  3I2X A;  3IIR A;  3CA0 A;  4EEE B;  1PZZ A;  1FMM S;  1AVW B;  4YOL A;  2K4A B;  2D7I A;  2Y9X E;  3BAQ A;  5D61 A;  3VT1 A;  4A7K A;  3T8S A;  4GOY A;  4J23 B;  2F2F C;  4P0K A;  4LO2 A;  4R6U B;  1FWV A;  3N7J A;  4FVV A;  5DUY A;  4OEG A;  4AN6 A;  3BAH A;  4TLP A;  3AKF A;  5BP5 C;  1FWU A;  2VSE A;  3OBT A;  1IOB A;  2Q9X A;  1DJS B;  1SZ6 B;  1Z2V A;  3FJ8 A;  3Q7X A;  2KKI A;  2QN4 A;  1TWE A;  4ZFU B;  3VT0 A;  4LO3 C;  2ERM A;  1DFC A;  2X2T A;  1OQL B;  3CRI A;  2LIQ A;  1TIE A;  5FNX A;  4Z8S B;  3PHZ A;  2NZ9 A;  4LO0 A;  4QO3 A;  2F8X C;  3CA6 A;  1S0F A;  4IQP A;  4XFU A;  4OEE A;  5FZU A;  2GO2 A;  3CA4 A;  2VSA A;  2RST A;  1Q04 A;  4AN7 B;  2DRY A;  2UUS A;  1EVT A;  3MPP G;  1HCD A;  3RMY A;  3FJI A;  3HAL A;  1YF8 B;  2D1Z A;  1M16 A;  3IAG C;  4JKX B;  2HZ9 A;  1TP0 A;  4EFQ A;  3VWC A;  2BFH A;  4XFS A;  2HWM A;  2D43 A;  1FV2 A;  5DVH A;  2P39 A;  2D23 A;  4D8H A;  5D63 A;  2Y9F A;  5BXT A;  1G9B A;  3N7K A;  2I1B A;  3WO4 A;  2NTD A;  2YUG A;  1EPW A;  2VUA A;  2D44 A;  1T4Q A;  1DQG A;  3S8K A;  4G9N A;  3S8J A;  4I4P A;  1IIL A;  1ISX A;  1TWM A;  3PME A;  2R9K B;  1BFB A;  4LO7 C;  1RG8 A;  3FJK A;  3NBE A;  4X38 A;  3N7M A;  3I2A A;  3IM7 A;  2NYY A;  1AXM A;  3BAV A;  1PC8 B;  1SR4 C;  3BAU A;  2Q3N B;  1AF9 A;  1ISW A;  2FGF A;  3H6R A;  2K43 A;  3BA5 A;  3B9U A;  3HOM A;  3I29 B;  3UD7 A;  3FJD A;  4IHZ A;  2D24 A;  1ISZ A;  4LO1 A;  1GGP B;  1JT7 A;  2QYI B;  2WRY A;  3O4O A;  4ISQ A;  1DIW A;  2FDB M;  4CJM A;  3BAG A;  2L5X A;  1TFM B;  1JY0 A;  4X3A A;  2Y9W C;  1S0C A;  5F90 A;  1W3F A;  3BAD A;  3MAL A;  3FJC A;  2M49 A;  3OJM A;  5B2H A;  1EYL A;  3ZXG A;  4IZX A;  1J0S A;  4P0L A;  8I1B A;  3AH2 A;  4EFP A;  1QXM A;  4MZG B;  4QAL A;  4GAF A;  4KBB A;  1S0D A;  3H6R B;  1XHB A;  5F8Y A;  1QQK A;  1YXW A;  4KEK A;  4JPZ A;  4D0Z A;  1TTU A;  1II4 A;  5BOW A;  2J3P A;  4KEI A;  4ZLB B;  2F2F A;  2VXT I;  1JQZ A;  1JT4 A;  3A21 A;  4XKI A;  1JLY A;  2NS2 A;  1BA7 A;  3FGM A;  5DSS B;  3H6S E;  4LO8 B;  1XG6 A;  2WBC A;  1Z4S A;  4I4V A;  3FUO A;  1ISY A;  3O5W B;  3AKG A;  1I1E A;  1K5V A;  1VCL A;  4OW4 A;  4DCK C;  3N7L A;  1FMZ A;  3HBW A;  1HWM B;  2VXR A;  2HW9 A;  1EV2 A;  2BEB A;  2RQ9 A;  1DQO A;  5EC5 A;  1ITB A;  3CRG A;  4USO A;  1FQ9 A;  9ILB A;  3NBN A;  4I0Y A;  3IM6 A; 
#chains in the Genus database with same CATH homology
 4IY8 A;  1R8N A;  1QQL A;  3UJ4 A;  4L4H A;  3UD8 A;  3OGG A;  2Z49 A;  1RY7 A;  1WBC A;  5JLV A;  1WD4 A;  4II0 A;  4X37 A;  1IHK A;  1Q1U A;  1V6V A;  1NZK A;  1F31 A;  5E24 E;  4H75 A;  3UDA A;  3KMV A;  3P6I A;  4MZH A;  3Q7W A;  5BXS A;  1WBA A;  4I4U A;  1S0G A;  1HWP B;  2FFV A;  3R4U A;  4IYB A;  2AAI B;  1IJT A;  3BRF A;  1K5U A;  4USP A;  1PUU B;  4JRA A;  3CRH A;  3CU1 B;  3WO3 A;  3VUO A;  3ZX7 A;  1YTO A;  2HWA A;  2ZR1 B;  1TOO A;  3OGF A;  3O4C A;  3ZXD A;  4ISR A;  41BI A;  3HSM A;  5EHA A;  4J2X A;  1CE7 B;  4ZFY B;  2ZQO A;  3WIN C;  3A07 A;  4WBC A;  1G82 A;  1HIB A;  2D20 A;  4KEJ A;  4Q9G A;  1FN0 A;  3FJA A;  3AJ6 A;  3BA7 A;  3JRR A;  1NUN A;  1N4K A;  3FJJ A;  4IY9 A;  4XFT A;  1SR4 A;  3FUQ A;  2ET2 A;  5G00 A;  2KI4 A;  3WO2 A;  4P6A A;  5FZY A;  2DRZ A;  5FZZ A;  3K1X A;  2VU9 A;  3BA4 A;  4HR6 C;  4EKX B;  3BTA A;  4DEP A;  4G9M A;  1FGA A;  1W3A A;  1V6U A;  4X39 A;  3W9T A;  5BXP A;  2IWT B;  1P63 A;  3FJF A;  3VEQ A;  4ZKT B;  2NM1 A;  3A22 A;  1A8D A;  4I4O A;  3C9Z A;  4UY4 A;  1AVX B;  4LO7 B;  4I4Y A;  3FJH A;  1HWO B;  2Y9G A;  3AKH A;  4I37 A;  1ILR 1;  1JTC A;  3F62 B;  2AFG A;  4QKS A;  1ISV A;  4JAW A;  4GP0 A;  3HMY A;  4P0J A;  2E4M C;  3O4A A;  3NBC A;  1BAS A;  4PC4 A;  3IM5 A;  3POK A;  3UD9 A;  1Q03 A;  3BB2 A;  5F8S A;  3CA1 A;  1JLX A;  3AZW A;  3O49 A;  2D7R A;  3WA1 A;  4HA2 A;  4Q9P A;  4J2K A;  1IT0 A;  2BEA A;  3RTI B;  2GZB A;  4I1B A;  4QD2 C;  1AVU A;  3ZC9 A;  1HWN B;  4ZFW B;  3D7W B;  4I4S A;  3Q7Y A;  3R4S A;  1I1B A;  4D0T A;  5BQU C;  1V6X A;  3VSZ A;  1G9A A;  3OBR A;  1BFG A;  4EB2 B;  1AVA C;  3AZV A;  5BP5 A;  4GAI A;  1XYF A;  3AH4 A;  4J2Y A;  4ION A;  4JQ0 A;  1YBI A;  4I4R A;  4A7Y A;  5F8W A;  1PWA A;  3NJ5 A;  1XZZ A;  2NVH A;  3QYD A;  2FO1 A;  3HN1 A;  4LO3 A;  3E8L C;  1W3G A;  4QBV A;  3PUB A;  1CVS A;  4ZA3 B;  1KNM A;  3NBD A;  4H9W A;  1WD3 A;  4G6M A;  4H04 A;  1S0E A;  2ESU A;  4FGF A;  3CA3 A;  1E0O A;  1ONK B;  5FNW A;  2NP0 A;  3CQA A;  4I4Q A;  1G9D A;  3BRG C;  4END A;  4EFR A;  1IRA X;  4OUJ A;  5BXR A;  3V0B A;  2LIE A;  2RG9 B;  1HKN A;  3VSF A;  3LTQ A;  4A7Z A;  2XOA A;  7I1B A;  4J2S A;  1JT5 A;  1BFF A;  1YYN A;  3FFZ A;  3P53 A;  3FJE A;  4LO2 C;  5DZU A;  3O3Q A;  3BRD A;  2KI6 B;  4Q91 A;  1R8O A;  4I3N A;  3O44 A;  3QR5 A;  1BAR A;  3RSJ A;  4I96 A;  2MLL B;  4Z9W B;  3WIN A;  3P6J A;  1JT3 A;  4HJJ A;  1RML A;  4MZF B;  1DFQ A;  1IRP A;  3WMV A;  4F34 A;  4I7I A;  3AJ5 A;  3V0B B;  3AH1 A;  4JKQ A;  4KC3 A;  4QBC A;  1M2T B;  3N0K A;  4LO0 C;  5GAQ A;  3SNV A;  4QKR A;  4G1R A;  4F83 A;  3WMU A;  1PUM B;  5JMC A;  2MC2 A;  3AKI A;  1DZC A;  2D22 A;  2AQZ A;  2MIB A;  1S0B A;  1BLA A;  4OEF A;  1UPS A;  1V6W A;  4DEN A;  2DRE A;  3O4B A;  1BFC A;  2DS0 A;  3O4D A;  3V0A A;  5EG6 C;  1D0H A;  4ZGR B;  2ZQN A;  3ILA A;  21BI A;  2KLL A;  3F1R A;  3UJ0 A;  1G9C A;  3TC2 A;  3FJB A;  2Z48 A;  1DLL A;  1MC9 A;  3EF2 A;  2E4M A;  4I4X A;  4I6I A;  3JUT A;  1FV3 A;  4GP3 A;  4I8M A;  2X2S A;  1L2H A;  4I2S A;  1HCE A;  4OWK A;  4ZBV B;  2AXM A;  4IZE A;  4ZOT A;  3V0A B;  4JP0 A;  1ABR B;  5I1B A;  2K8R A;  3RMX A;  1DZD A;  6I1B A;  3FJ9 A;  4QC4 A;  5BQU A;  3H6Q A;  3OJV A;  1AFC A;  4OWJ A;  4G6J A;  3BX1 C;  3RTJ B;  3CA5 A;  3V79 C;  4LO1 C;  5BVP I;  3VT2 A;  3ZC8 A;  3A23 A;  3OJ2 A;  1BLD A;  2FFU A;  3LLP A;  1S0L A;  3PG0 A;  1RZO B;  4L4I A;  1MD6 A;  4OWL A;  1T9F A;  31BI A;  3CAH A;  4QD2 B;  1Z0H A;  2VLC A;  2IHO A;  2KH2 A;  3BAO A;  2P23 A;  4GOV A;  5D62 A;  4I1E A;  5HPZ A;  3I2X A;  3IIR A;  3CA0 A;  4EEE B;  1PZZ A;  1FMM S;  1AVW B;  4YOL A;  2K4A B;  2D7I A;  2Y9X E;  3BAQ A;  5D61 A;  3VT1 A;  4A7K A;  3T8S A;  4GOY A;  4J23 B;  2F2F C;  4P0K A;  4LO2 A;  4R6U B;  1FWV A;  3N7J A;  4FVV A;  5DUY A;  4OEG A;  4AN6 A;  3BAH A;  4TLP A;  3AKF A;  5BP5 C;  1FWU A;  2VSE A;  3OBT A;  1IOB A;  2Q9X A;  1DJS B;  1SZ6 B;  1Z2V A;  3FJ8 A;  3Q7X A;  2KKI A;  2QN4 A;  1TWE A;  4ZFU B;  3VT0 A;  4LO3 C;  2ERM A;  1DFC A;  2X2T A;  1OQL B;  3CRI A;  2LIQ A;  1TIE A;  5FNX A;  4Z8S B;  3PHZ A;  2NZ9 A;  4LO0 A;  4QO3 A;  2F8X C;  3CA6 A;  1S0F A;  4IQP A;  4XFU A;  4OEE A;  5FZU A;  2GO2 A;  3CA4 A;  2VSA A;  2RST A;  1Q04 A;  4AN7 B;  2DRY A;  2UUS A;  1EVT A;  3MPP G;  1HCD A;  3RMY A;  3FJI A;  3HAL A;  1YF8 B;  2D1Z A;  1M16 A;  3IAG C;  4JKX B;  2HZ9 A;  1TP0 A;  4EFQ A;  3VWC A;  2BFH A;  4XFS A;  2HWM A;  2D43 A;  1FV2 A;  5DVH A;  2P39 A;  2D23 A;  4D8H A;  5D63 A;  2Y9F A;  5BXT A;  1G9B A;  3N7K A;  2I1B A;  3WO4 A;  2NTD A;  2YUG A;  1EPW A;  2VUA A;  2D44 A;  1T4Q A;  1DQG A;  3S8K A;  4G9N A;  3S8J A;  4I4P A;  1IIL A;  1ISX A;  1TWM A;  3PME A;  2R9K B;  1BFB A;  4LO7 C;  1RG8 A;  3FJK A;  3NBE A;  4X38 A;  3N7M A;  3I2A A;  3IM7 A;  2NYY A;  1AXM A;  3BAV A;  1PC8 B;  1SR4 C;  3BAU A;  2Q3N B;  1AF9 A;  1ISW A;  2FGF A;  3H6R A;  2K43 A;  3BA5 A;  3B9U A;  3HOM A;  3I29 B;  3UD7 A;  3FJD A;  4IHZ A;  2D24 A;  1ISZ A;  4LO1 A;  1GGP B;  1JT7 A;  2QYI B;  2WRY A;  3O4O A;  4ISQ A;  1DIW A;  2FDB M;  4CJM A;  3BAG A;  2L5X A;  1TFM B;  1JY0 A;  4X3A A;  2Y9W C;  1S0C A;  5F90 A;  1W3F A;  3BAD A;  3MAL A;  3FJC A;  2M49 A;  3OJM A;  5B2H A;  1EYL A;  3ZXG A;  4IZX A;  1J0S A;  4P0L A;  8I1B A;  3AH2 A;  4EFP A;  1QXM A;  4MZG B;  4QAL A;  4GAF A;  4KBB A;  1S0D A;  3H6R B;  1XHB A;  5F8Y A;  1QQK A;  1YXW A;  4KEK A;  4JPZ A;  4D0Z A;  1TTU A;  1II4 A;  5BOW A;  2J3P A;  4KEI A;  4ZLB B;  2F2F A;  2VXT I;  1JQZ A;  1JT4 A;  3A21 A;  4XKI A;  1JLY A;  2NS2 A;  1BA7 A;  3FGM A;  5DSS B;  3H6S E;  4LO8 B;  1XG6 A;  2WBC A;  1Z4S A;  4I4V A;  3FUO A;  1ISY A;  3O5W B;  3AKG A;  1I1E A;  1K5V A;  1VCL A;  4OW4 A;  4DCK C;  3N7L A;  1FMZ A;  3HBW A;  1HWM B;  2VXR A;  2HW9 A;  1EV2 A;  2BEB A;  2RQ9 A;  1DQO A;  5EC5 A;  1ITB A;  3CRG A;  4USO A;  1FQ9 A;  9ILB A;  3NBN A;  4I0Y A;  3IM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...