3BA5A

Crystal structure of d28a mutant of human acidic fibroblast growth factor
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
b'HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPAGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title A logical OR redundancy within the Asx-Pro-Asx-Gly type I beta-turn motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 38
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ba5A00
3FJHA 1TWEA 3HN1A 4HA2A 4OEEA 3WMUA 4QBVA 2NTDA 3UJ0A 1FV3A 1RMLA 4L4HA 3FJDA 1BA7A 3RMXA 3V0AB 3E8LC 3PUBA 4OW4A 1PC8B 1ISXA 5DUYA 2NYYA 4GAIA 4OEGA 4LO1A 1TTUA 2D7RA 3O4BA 4J2XA 1II4A 2LIQA 4ZKTB 3FJIA 4H04A 4QO3A 1PWAA 3OGGA 3NJ5A 5BXRA 1VCLA 3EF2A 2ET2A 1EVTA 3UJ4A 5G00A 2Q9XA 5FNWA 5B2HA 1L2HA 1DQOA 2D20A 1RZOB 3OBTA 2FGFA 4OEFA 1AVAC 5EHAA 1I1EA 2F8XC 4ISQA 3IM6A 3BB2A 4J2SA 3Q7WA 4IHZA 4ZBVB 3CRGA 3O4CA 4EKXB 1DFQA 3CA6A 2MLLB 4JP0A 2D1ZA 3CA5A 4CJMA 1BASA 4X3AA 4YOLA 2YUGA 4KC3A 3K1XA 2NZ9A 4I37A 4J23B 4G1RA 2RSTA 1IJTA 2RG9B 2VXTI 3BA7A 1JT7A 2Q3NB 2BEBA 4TLPA 3C9ZA 4IONA 3AKIA 2K43A 3RTJB 1S0GA 1QXMA 3QYDA 3CU1B 2QYIB 4LO0A 4KEJA 1W3AA 3OJVA 3PG0A 2F2FA 5BQUA 2AXMA 5F8YA 2KI6B 1YTOA 1BFFA 2D24A 4WBCA 3RTIB 1Z0HA 2X2TA 5FZYA 4KEKA 1K5VA 2WRYA 4KEIA 4ZFUB 4LO0C 1ISWA 4LO3A 3V0AA 3BAQA 5JLVA 3I2XA 1S0DA 2K4AB 5BQUC 2F2FC 1ILR1 2VU9A 3UD9A 4OWKA 4IZXA 3ZXDA 3FJFA 1IOBA 1G82A 3WO4A 3MALA 1R8NA 2J3PA 4LO3C 5BVPI 2Y9WC 2K8RA 1YBIA 3VUOA 3T8SA 1NUNA 4ZA3B 5FZZA 1TOOA 2MIBA 3JUTA 3O3QA 3IAGC 3CA0A 2GO2A 6I1BA 1JLYA 3I29B 1EPWA 3AJ5A 1MD6A 1AVUA 3V79C 4A7KA 1IHKA 3P6IA 4I1BA 1XYFA 1GGPB 5DVHA 3AZVA 2BFHA 1WD3A 3V0BB 4ZLBB 4GAFA 3QR5A 2FDBM 1S0BA 2HWMA 3POKA 2KH2A 2BEAA 2D44A 4IY8A 3VT1A 4LO2A 4I6IA 3UDAA 3BAOA 2VSAA 1KNMA 3B9UA 3HALA 4JPZA 3HMYA 1K5UA 1PUMB 1XHBA 3FJ8A 3O4AA 1JT4A 4P0LA 1UPSA 3O5WB 4I2SA 5D62A 2IWTB 4II0A 5GAQA 4LO2C 1A8DA 9ILBA 3BA4A 4I4YA 4I8MA 1AFCA 2L5XA 1T4QA 2D22A 1JT3A 4IYBA 4EFRA 1BARA 1HKNA 2KI4A 8I1BA 3UD8A 2Y9FA 3BAGA 4I4PA 4ISRA 4L4IA 5HPZA 4D0TA 1XZZA 4USOA 4P0JA 1S0FA 1HCEA 3NBCA 2P39A 1BLAA 1ITBA 1FWVA 1FWUA 1J0SA 4I1EA 1HWPB 4ZFWB 3VSFA 3KMVA 4IY9A 3MPPG 4I4QA 3CQAA 4JAWA 4DEPA 2XOAA 1FV2A 4GOVA 5BOWA 2AQZA 3FJKA 2KKIA 3D7WB 4USPA 4AN6A 2QN4A 1HWNB 3O49A 1QQKA 3BAVA 2RQ9A 1ISYA 2VUAA 1BLDA 4EFQA 1HCDA 4P6AA 1ABRB 2HWAA 5D61A 4XKIA 4PC4A 1AVXB 3IM5A 1PUUB 4J2YA 1RG8A 2NVHA 3V0BA 1R8OA 3SNVA 1BFCA 1DFCA 4I7IA 5DSSB 3AKGA 4P0KA 3HSMA 1FMZA 1YF8B 3O4DA 2M49A 1EYLA 3A23A 4G9MA 4QBCA 4X37A 1QQLA 4JQ0A 2DRYA 3ILAA 3OGFA 3TC2A 4HR6C 4LO7B 1IRPA 1HIBA 2E4MA 2AAIB 1YXWA 3NBDA 1IRAX 1JT5A 3A21A 4IZEA 1WD4A 1V6WA 5DZUA 3WO2A 4QC4A 4G9NA 1XG6A 4Z8SB 4ZFYB 3R4SA 3FGMA 2E4MC 3A22A 1JTCA 1S0EA 3H6SE 4F34A 4JKXB 4OUJA 3WINC 5F8WA 3FJEA 1FMMS 1FN0A 3Q7XA 1F31A 2D7IA 3IIRA 4I4VA 1N4KA 3LLPA 4XFSA 1V6VA 3HBWA 3N7MA 3WO3A 3NBNA 4X38A 2ZR1B 1AVWB 2ZQNA 2P23A 3NBEA 1ISZA 1AF9A 4XFTA 4G6MA 1EV2A 1DZCA 4IQPA 1S0CA 21BIA 3RSJA 1TP0A 4I4XA 1DIWA 3WA1A 3RMYA 2IHOA 4I0YA 3BX1C 4J2KA 4GP0A 3CA4A 1Q04A 3AJ6A 5BP5A 3BADA 3ZC9A 1NZKA 3O4OA 5BXSA 1AXMA 4OWJA 4HJJA 5F8SA 1Q1UA 1CVSA 1Z4SA 3JRRA 5BP5C 3AH4A 3FJAA 1DLLA 2NP0A 2VLCA 2UUSA 2Z49A 2HW9A 4EFPA 1TFMB 1RY7A 5FZUA 2HZ9A 1HWMB 3S8KA 2FFUA 2MC2A 4Q9GA 3ZC8A 1DZDA 3FJBA 4DCKC 2I1BA 5EG6C 4F83A 4LO7C 1FGAA 4G6JA 3H6RA 1JY0A 3AKHA 3S8JA 2Z48A 3AH1A 4FGFA 4QD2C 2DS0A 1WBAA 4D8HA 3FUQA 3H6QA 4ZOTA 1SR4A 4DENA 1TIEA 3LTQA 1TWMA 3FUOA 2AFGA 4KBBA 2ESUA 2GZBA 1ISVA 3AKFA 2FO1A 1DQGA 3OBRA 1W3FA 3BAHA 2VXRA 4LO1C 3FJCA 1S0LA 4LO8B 1G9CA 4JKQA 1V6XA 1W3GA 1SR4C 4EB2B 3ZXGA 2ZQOA 5D63A 3F62B 3FJ9A 1I1BA 2NM1A 4Q9PA 3BRDA 3R4UA 1G9AA 3PMEA 3CRHA 4QALA 3BTAA 4XFUA 3BAUA 3BRFA 3VSZA 3FFZA 4I4OA 3P6JA 3VEQA 3F1RA 4EEEB 31BIA 3A07A 5FNXA 3N7JA 2ERMA 3N7KA 2DREA 3Q7YA 3CRIA 4QD2B 1JQZA 3N7LA 5EC5A 1ONKB 3HOMA 3WINA 4ENDA 2VSEA 4I4RA 3AH2A 4I4UA 3IM7A 3H6RB 1V6UA 1Q03A 3CAHA 1MC9A 3O44A 2R9KB 1IILA 2Y9GA 2Y9XE 3W9TA 7I1BA 1Z2VA 3PHZA 3I2AA 4Q91A 2WBCA 5I1BA 4QKSA 1HWOB 4JRAA 2D23A 3FJJA 3VT2A 1IT0A 4OWLA 41BIA 3AZWA 4I3NA 1FQ9A 4AN7B 3BRGC 3ZX7A 4ZGRB 1OQLB 2DRZA 3BA5A 3OJ2A 1BFGA 5BXPA 4A7YA 1SZ6B 4A7ZA 3N0KA 4H9WA 4Z9WB 3WMVA 4I4SA 1M2TB 1T9FA 3VWCA 1PZZA 5F90A 2LIEA 4R6UB 1D0HA 2KLLA 3VT0A 1M16A 5BXTA 1DJSB 5E24E 1CE7B 2X2SA 3CA1A 1JLXA 4FVVA 1G9DA 4GOYA 1BFBA 3P53A 1E0OA 4X39A 3CA3A 4GP3A 1YYNA 2FFVA 4QKRA 1WBCA 2D43A 5JMCA 1P63A 4I96A 1G9BA 4D0ZA 3UD7A 3OJMA
chains in the Genus database with same CATH superfamily
3FJHA 1TWEA 3HN1A 4HA2A 4OEEA 3WMUA 4QBVA 2NTDA 3UJ0A 1FV3A 1RMLA 4L4HA 3FJDA 1BA7A 3RMXA 3V0AB 3E8LC 3PUBA 4OW4A 1PC8B 1ISXA 5DUYA 2NYYA 4GAIA 4OEGA 4LO1A 1TTUA 2D7RA 3O4BA 4J2XA 1II4A 2LIQA 4ZKTB 3FJIA 4H04A 4QO3A 1PWAA 3OGGA 3NJ5A 5BXRA 1VCLA 3EF2A 2ET2A 1EVTA 3UJ4A 5G00A 2Q9XA 5FNWA 5B2HA 1L2HA 1DQOA 2D20A 1RZOB 3OBTA 2FGFA 4OEFA 1AVAC 5EHAA 1I1EA 2F8XC 4ISQA 3IM6A 3BB2A 4J2SA 3Q7WA 4IHZA 4ZBVB 3CRGA 3O4CA 4EKXB 1DFQA 3CA6A 2MLLB 4JP0A 2D1ZA 3CA5A 4CJMA 1BASA 4X3AA 4YOLA 2YUGA 4KC3A 3K1XA 2NZ9A 4I37A 4J23B 4G1RA 2RSTA 1IJTA 2RG9B 2VXTI 3BA7A 1JT7A 2Q3NB 2BEBA 4TLPA 3C9ZA 4IONA 3AKIA 2K43A 2NS2A 3RTJB 1S0GA 1QXMA 3QYDA 3CU1B 2QYIB 4LO0A 4KEJA 4UY4A 1W3AA 3OJVA 3PG0A 2F2FA 5BQUA 2AXMA 5F8YA 2KI6B 1YTOA 1BFFA 2D24A 4WBCA 3RTIB 1Z0HA 2X2TA 5FZYA 4KEKA 1K5VA 2WRYA 4KEIA 4ZFUB 4LO0C 1ISWA 4LO3A 3V0AA 3BAQA 5JLVA 3I2XA 1S0DA 2K4AB 5BQUC 2F2FC 1ILR1 2VU9A 3UD9A 4OWKA 4IZXA 3ZXDA 3FJFA 1IOBA 1G82A 3WO4A 3MALA 1R8NA 2J3PA 4LO3C 5BVPI 2Y9WC 2K8RA 1YBIA 3VUOA 3T8SA 1NUNA 4ZA3B 5FZZA 1TOOA 2MIBA 3JUTA 3O3QA 3IAGC 3CA0A 2GO2A 6I1BA 1JLYA 3I29B 1EPWA 3AJ5A 1MD6A 1AVUA 3V79C 4A7KA 4MZHA 1IHKA 3P6IA 4I1BA 1XYFA 1GGPB 5DVHA 3AZVA 2BFHA 1WD3A 3V0BB 4ZLBB 4GAFA 3QR5A 2FDBM 1S0BA 2HWMA 3POKA 2KH2A 2BEAA 2D44A 4IY8A 3VT1A 4LO2A 4I6IA 3UDAA 3BAOA 2VSAA 1KNMA 3B9UA 3HALA 4JPZA 3HMYA 1K5UA 1PUMB 1XHBA 3FJ8A 3O4AA 1JT4A 4P0LA 1UPSA 3O5WB 4I2SA 5D62A 2IWTB 4II0A 5GAQA 4LO2C 1A8DA 9ILBA 3BA4A 4I4YA 4I8MA 1AFCA 2L5XA 1T4QA 2D22A 1JT3A 4IYBA 4EFRA 1BARA 1HKNA 2KI4A 8I1BA 3UD8A 2Y9FA 3BAGA 4I4PA 4ISRA 4L4IA 5HPZA 4D0TA 1XZZA 4USOA 4P0JA 1S0FA 1HCEA 3NBCA 2P39A 1BLAA 1ITBA 1FWVA 1FWUA 1J0SA 4I1EA 1HWPB 4ZFWB 3VSFA 4MZGB 3KMVA 4IY9A 3MPPG 4I4QA 3CQAA 4JAWA 4DEPA 2XOAA 1FV2A 4GOVA 5BOWA 2AQZA 3FJKA 2KKIA 3D7WB 4USPA 4AN6A 2QN4A 1HWNB 3O49A 1QQKA 3BAVA 2RQ9A 1ISYA 2VUAA 1BLDA 4EFQA 1HCDA 4P6AA 1ABRB 2HWAA 5D61A 4XKIA 4PC4A 1AVXB 3IM5A 1PUUB 4J2YA 1RG8A 2NVHA 3V0BA 1R8OA 3SNVA 1BFCA 1DFCA 4I7IA 5DSSB 3AKGA 4P0KA 3HSMA 1FMZA 1YF8B 3O4DA 2M49A 1EYLA 3A23A 4G9MA 4QBCA 4X37A 1QQLA 4JQ0A 2DRYA 3ILAA 3OGFA 3TC2A 4HR6C 4LO7B 1IRPA 1HIBA 2E4MA 2AAIB 1YXWA 3NBDA 1IRAX 1JT5A 3A21A 4IZEA 1WD4A 1V6WA 5DZUA 3WO2A 4QC4A 4G9NA 1XG6A 4Z8SB 4ZFYB 3R4SA 3FGMA 2E4MC 3A22A 1JTCA 1S0EA 3H6SE 4F34A 4JKXB 4OUJA 3WINC 5F8WA 3FJEA 1FMMS 1FN0A 3Q7XA 1F31A 2D7IA 3IIRA 4I4VA 1N4KA 3LLPA 4XFSA 1V6VA 3HBWA 3N7MA 3WO3A 3NBNA 4X38A 2ZR1B 1AVWB 2ZQNA 2P23A 3NBEA 1ISZA 1AF9A 4XFTA 4G6MA 1EV2A 1DZCA 4IQPA 1S0CA 21BIA 3RSJA 1TP0A 4I4XA 1DIWA 3WA1A 3RMYA 2IHOA 4I0YA 3BX1C 4J2KA 4GP0A 3CA4A 1Q04A 3AJ6A 5BP5A 3BADA 3ZC9A 1NZKA 3O4OA 5BXSA 1AXMA 4OWJA 4HJJA 5F8SA 4H75A 1Q1UA 1CVSA 1Z4SA 3JRRA 5BP5C 3AH4A 3FJAA 1DLLA 2NP0A 2VLCA 2UUSA 2Z49A 2HW9A 4EFPA 1TFMB 1RY7A 5FZUA 2HZ9A 1HWMB 3S8KA 2FFUA 2MC2A 4Q9GA 3ZC8A 1DZDA 3FJBA 4DCKC 2I1BA 5EG6C 4F83A 4LO7C 1FGAA 4G6JA 3H6RA 1JY0A 3AKHA 3S8JA 2Z48A 3AH1A 4FGFA 4QD2C 2DS0A 1WBAA 4D8HA 3FUQA 3H6QA 4ZOTA 1SR4A 4DENA 1TIEA 3LTQA 1TWMA 3FUOA 2AFGA 4KBBA 2ESUA 2GZBA 1ISVA 3AKFA 2FO1A 1DQGA 3OBRA 1W3FA 3BAHA 2VXRA 4LO1C 3FJCA 1S0LA 4LO8B 1G9CA 4JKQA 1V6XA 1W3GA 1SR4C 4EB2B 3ZXGA 2ZQOA 5D63A 3F62B 3FJ9A 1I1BA 2NM1A 4Q9PA 3BRDA 3R4UA 1G9AA 3PMEA 3CRHA 4QALA 3BTAA 4XFUA 3BAUA 3BRFA 3VSZA 3FFZA 4I4OA 3P6JA 3VEQA 3F1RA 4EEEB 31BIA 3A07A 5FNXA 3N7JA 2ERMA 3N7KA 2DREA 3Q7YA 3CRIA 4QD2B 1JQZA 3N7LA 5EC5A 1ONKB 3HOMA 3WINA 4ENDA 2VSEA 4I4RA 3AH2A 4I4UA 3IM7A 3H6RB 1V6UA 1Q03A 3CAHA 1MC9A 3O44A 2R9KB 1IILA 2Y9GA 2Y9XE 3W9TA 7I1BA 1Z2VA 3PHZA 3I2AA 4Q91A 2WBCA 5I1BA 4QKSA 1HWOB 4JRAA 2D23A 3FJJA 3VT2A 1IT0A 4OWLA 41BIA 3AZWA 4I3NA 1FQ9A 4AN7B 3BRGC 3ZX7A 4ZGRB 1OQLB 2DRZA 3BA5A 3OJ2A 1BFGA 5BXPA 4MZFB 4A7YA 1SZ6B 4A7ZA 3N0KA 4H9WA 4Z9WB 3WMVA 4I4SA 1M2TB 1T9FA 3VWCA 1PZZA 5F90A 2LIEA 4R6UB 1D0HA 2KLLA 3VT0A 1M16A 5BXTA 1DJSB 5E24E 1CE7B 2X2SA 3CA1A 1JLXA 4FVVA 1G9DA 4GOYA 1BFBA 3P53A 1E0OA 4X39A 3CA3A 4GP3A 1YYNA 2FFVA 4QKRA 1WBCA 2D43A 5JMCA 1P63A 4I96A 1G9BA 4D0ZA 3UD7A 3OJMA
chains in the Genus database with same CATH topology
3FJHA 1TWEA 3HN1A 4HA2A 4OEEA 3WMUA 4QBVA 2NTDA 3UJ0A 1FV3A 1RMLA 4L4HA 3FJDA 1BA7A 3RMXA 3V0AB 3E8LC 3PUBA 4OW4A 1PC8B 1ISXA 5DUYA 2NYYA 4GAIA 4OEGA 4LO1A 1TTUA 2D7RA 3O4BA 4J2XA 1II4A 2LIQA 4ZKTB 3FJIA 4H04A 4QO3A 1PWAA 3OGGA 3NJ5A 5BXRA 1VCLA 3EF2A 2ET2A 1EVTA 3UJ4A 5G00A 2Q9XA 5FNWA 5B2HA 1L2HA 1DQOA 2D20A 1RZOB 3OBTA 2FGFA 4OEFA 1AVAC 5EHAA 1I1EA 2F8XC 4ISQA 3IM6A 3BB2A 4J2SA 3Q7WA 4IHZA 4ZBVB 3CRGA 3O4CA 4EKXB 1DFQA 3CA6A 2MLLB 4JP0A 2D1ZA 3CA5A 4CJMA 1BASA 4X3AA 4YOLA 2YUGA 4KC3A 3K1XA 2NZ9A 4I37A 4J23B 4G1RA 2RSTA 1IJTA 2RG9B 2VXTI 3BA7A 1JT7A 2Q3NB 2BEBA 4TLPA 3C9ZA 4IONA 3AKIA 2K43A 2NS2A 3RTJB 1S0GA 1QXMA 3QYDA 3CU1B 2QYIB 4LO0A 4KEJA 4UY4A 1W3AA 3OJVA 3PG0A 2F2FA 5BQUA 2AXMA 5F8YA 2KI6B 1YTOA 1BFFA 2D24A 4WBCA 3RTIB 1Z0HA 2X2TA 5FZYA 4KEKA 1K5VA 2WRYA 4KEIA 4ZFUB 4LO0C 1ISWA 4LO3A 3V0AA 3BAQA 5JLVA 3I2XA 1S0DA 2K4AB 5BQUC 2F2FC 1ILR1 2VU9A 3UD9A 4OWKA 4IZXA 3ZXDA 3FJFA 1IOBA 1G82A 3WO4A 3MALA 1R8NA 2J3PA 4LO3C 5BVPI 2Y9WC 2K8RA 1YBIA 3VUOA 3T8SA 1NUNA 4ZA3B 5FZZA 1TOOA 2MIBA 3JUTA 3O3QA 3IAGC 3CA0A 2GO2A 6I1BA 1JLYA 3I29B 1EPWA 3AJ5A 1MD6A 1AVUA 3V79C 4A7KA 4MZHA 1IHKA 3P6IA 4I1BA 1XYFA 1GGPB 5DVHA 3AZVA 2BFHA 1WD3A 3V0BB 4ZLBB 4GAFA 3QR5A 2FDBM 1S0BA 2HWMA 3POKA 2KH2A 2BEAA 2D44A 4IY8A 3VT1A 4LO2A 4I6IA 3UDAA 3BAOA 2VSAA 1KNMA 3B9UA 3HALA 4JPZA 3HMYA 1K5UA 1PUMB 1XHBA 3FJ8A 3O4AA 1JT4A 4P0LA 1UPSA 3O5WB 4I2SA 5D62A 2IWTB 4II0A 5GAQA 4LO2C 1A8DA 9ILBA 3BA4A 4I4YA 4I8MA 1AFCA 2L5XA 1T4QA 2D22A 1JT3A 4IYBA 4EFRA 1BARA 1HKNA 2KI4A 8I1BA 3UD8A 2Y9FA 3BAGA 4I4PA 4ISRA 4L4IA 5HPZA 4D0TA 1XZZA 4USOA 4P0JA 1S0FA 1HCEA 3NBCA 2P39A 1BLAA 1ITBA 1FWVA 1FWUA 1J0SA 4I1EA 1HWPB 4ZFWB 3VSFA 4MZGB 3KMVA 4IY9A 3MPPG 4I4QA 3CQAA 4JAWA 4DEPA 2XOAA 1FV2A 4GOVA 5BOWA 2AQZA 3FJKA 2KKIA 3D7WB 4USPA 4AN6A 2QN4A 1HWNB 3O49A 1QQKA 3BAVA 2RQ9A 1ISYA 2VUAA 1BLDA 4EFQA 1HCDA 4P6AA 1ABRB 2HWAA 5D61A 4XKIA 4PC4A 1AVXB 3IM5A 1PUUB 4J2YA 1RG8A 2NVHA 3V0BA 1R8OA 3SNVA 1BFCA 1DFCA 4I7IA 5DSSB 3AKGA 4P0KA 3HSMA 1FMZA 1YF8B 3O4DA 2M49A 1EYLA 3A23A 4G9MA 4QBCA 4X37A 1QQLA 4JQ0A 2DRYA 3ILAA 3OGFA 3TC2A 4HR6C 4LO7B 1IRPA 1HIBA 2E4MA 2AAIB 1YXWA 3NBDA 1IRAX 1JT5A 3A21A 4IZEA 1WD4A 1V6WA 5DZUA 3WO2A 4QC4A 4G9NA 1XG6A 4Z8SB 4ZFYB 3R4SA 3FGMA 2E4MC 3A22A 1JTCA 1S0EA 3H6SE 4F34A 4JKXB 4OUJA 3WINC 5F8WA 3FJEA 1FMMS 1FN0A 3Q7XA 1F31A 2D7IA 3IIRA 4I4VA 1N4KA 3LLPA 4XFSA 1V6VA 3HBWA 3N7MA 3WO3A 3NBNA 4X38A 2ZR1B 1AVWB 2ZQNA 2P23A 3NBEA 1ISZA 1AF9A 4XFTA 4G6MA 1EV2A 1DZCA 4IQPA 1S0CA 21BIA 3RSJA 1TP0A 4I4XA 1DIWA 3WA1A 3RMYA 2IHOA 4I0YA 3BX1C 4J2KA 4GP0A 3CA4A 1Q04A 3AJ6A 5BP5A 3BADA 3ZC9A 1NZKA 3O4OA 5BXSA 1AXMA 4OWJA 4HJJA 5F8SA 4H75A 1Q1UA 1CVSA 1Z4SA 3JRRA 5BP5C 3AH4A 3FJAA 1DLLA 2NP0A 2VLCA 2UUSA 2Z49A 2HW9A 4EFPA 1TFMB 1RY7A 5FZUA 2HZ9A 1HWMB 3S8KA 2FFUA 2MC2A 4Q9GA 3ZC8A 1DZDA 3FJBA 4DCKC 2I1BA 5EG6C 4F83A 4LO7C 1FGAA 4G6JA 3H6RA 1JY0A 3AKHA 3S8JA 2Z48A 3AH1A 4FGFA 4QD2C 2DS0A 1WBAA 4D8HA 3FUQA 3H6QA 4ZOTA 1SR4A 4DENA 1TIEA 3LTQA 1TWMA 3FUOA 2AFGA 4KBBA 2ESUA 2GZBA 1ISVA 3AKFA 2FO1A 1DQGA 3OBRA 1W3FA 3BAHA 2VXRA 4LO1C 3FJCA 1S0LA 4LO8B 1G9CA 4JKQA 1V6XA 1W3GA 1SR4C 4EB2B 3ZXGA 2ZQOA 5D63A 3F62B 3FJ9A 1I1BA 2NM1A 4Q9PA 3BRDA 3R4UA 1G9AA 3PMEA 3CRHA 4QALA 3BTAA 4XFUA 3BAUA 3BRFA 3VSZA 3FFZA 4I4OA 3P6JA 3VEQA 3F1RA 4EEEB 31BIA 3A07A 5FNXA 3N7JA 2ERMA 3N7KA 2DREA 3Q7YA 3CRIA 4QD2B 1JQZA 3N7LA 5EC5A 1ONKB 3HOMA 3WINA 4ENDA 2VSEA 4I4RA 3AH2A 4I4UA 3IM7A 3H6RB 1V6UA 1Q03A 3CAHA 1MC9A 3O44A 2R9KB 1IILA 2Y9GA 2Y9XE 3W9TA 7I1BA 1Z2VA 3PHZA 3I2AA 4Q91A 2WBCA 5I1BA 4QKSA 1HWOB 4JRAA 2D23A 3FJJA 3VT2A 1IT0A 4OWLA 41BIA 3AZWA 4I3NA 1FQ9A 4AN7B 3BRGC 3ZX7A 4ZGRB 1OQLB 2DRZA 3BA5A 3OJ2A 1BFGA 5BXPA 4MZFB 4A7YA 1SZ6B 4A7ZA 3N0KA 4H9WA 4Z9WB 3WMVA 4I4SA 1M2TB 1T9FA 3VWCA 1PZZA 5F90A 2LIEA 4R6UB 1D0HA 2KLLA 3VT0A 1M16A 5BXTA 1DJSB 5E24E 1CE7B 2X2SA 3CA1A 1JLXA 4FVVA 1G9DA 4GOYA 1BFBA 3P53A 1E0OA 4X39A 3CA3A 4GP3A 1YYNA 2FFVA 4QKRA 1WBCA 2D43A 5JMCA 1P63A 4I96A 1G9BA 4D0ZA 3UD7A 3OJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FJH A;  1TWE A;  3HN1 A;  4HA2 A;  4OEE A;  3WMU A;  4QBV A;  2NTD A;  3UJ0 A;  1FV3 A;  1RML A;  4L4H A;  3FJD A;  1BA7 A;  3RMX A;  3V0A B;  3E8L C;  3PUB A;  4OW4 A;  1PC8 B;  1ISX A;  5DUY A;  2NYY A;  4GAI A;  4OEG A;  4LO1 A;  1TTU A;  2D7R A;  3O4B A;  4J2X A;  1II4 A;  2LIQ A;  4ZKT B;  3FJI A;  4H04 A;  4QO3 A;  1PWA A;  3OGG A;  3NJ5 A;  5BXR A;  1VCL A;  3EF2 A;  2ET2 A;  1EVT A;  3UJ4 A;  5G00 A;  2Q9X A;  5FNW A;  5B2H A;  1L2H A;  1DQO A;  2D20 A;  1RZO B;  3OBT A;  2FGF A;  4OEF A;  1AVA C;  5EHA A;  1I1E A;  2F8X C;  4ISQ A;  3IM6 A;  3BB2 A;  4J2S A;  3Q7W A;  4IHZ A;  4ZBV B;  3CRG A;  3O4C A;  4EKX B;  1DFQ A;  3CA6 A;  2MLL B;  4JP0 A;  2D1Z A;  3CA5 A;  4CJM A;  1BAS A;  4X3A A;  4YOL A;  2YUG A;  4KC3 A;  3K1X A;  2NZ9 A;  4I37 A;  4J23 B;  4G1R A;  2RST A;  1IJT A;  2RG9 B;  2VXT I;  3BA7 A;  1JT7 A;  2Q3N B;  2BEB A;  4TLP A;  3C9Z A;  4ION A;  3AKI A;  2K43 A;  3RTJ B;  1S0G A;  1QXM A;  3QYD A;  3CU1 B;  2QYI B;  4LO0 A;  4KEJ A;  1W3A A;  3OJV A;  3PG0 A;  2F2F A;  5BQU A;  2AXM A;  5F8Y A;  2KI6 B;  1YTO A;  1BFF A;  2D24 A;  4WBC A;  3RTI B;  1Z0H A;  2X2T A;  5FZY A;  4KEK A;  1K5V A;  2WRY A;  4KEI A;  4ZFU B;  4LO0 C;  1ISW A;  4LO3 A;  3V0A A;  3BAQ A;  5JLV A;  3I2X A;  1S0D A;  2K4A B;  5BQU C;  2F2F C;  1ILR 1;  2VU9 A;  3UD9 A;  4OWK A;  4IZX A;  3ZXD A;  3FJF A;  1IOB A;  1G82 A;  3WO4 A;  3MAL A;  1R8N A;  2J3P A;  4LO3 C;  5BVP I;  2Y9W C;  2K8R A;  1YBI A;  3VUO A;  3T8S A;  1NUN A;  4ZA3 B;  5FZZ A;  1TOO A;  2MIB A;  3JUT A;  3O3Q A;  3IAG C;  3CA0 A;  2GO2 A;  6I1B A;  1JLY A;  3I29 B;  1EPW A;  3AJ5 A;  1MD6 A;  1AVU A;  3V79 C;  4A7K A;  1IHK A;  3P6I A;  4I1B A;  1XYF A;  1GGP B;  5DVH A;  3AZV A;  2BFH A;  1WD3 A;  3V0B B;  4ZLB B;  4GAF A;  3QR5 A;  2FDB M;  1S0B A;  2HWM A;  3POK A;  2KH2 A;  2BEA A;  2D44 A;  4IY8 A;  3VT1 A;  4LO2 A;  4I6I A;  3UDA A;  3BAO A;  2VSA A;  1KNM A;  3B9U A;  3HAL A;  4JPZ A;  3HMY A;  1K5U A;  1PUM B;  1XHB A;  3FJ8 A;  3O4A A;  1JT4 A;  4P0L A;  1UPS A;  3O5W B;  4I2S A;  5D62 A;  2IWT B;  4II0 A;  5GAQ A;  4LO2 C;  1A8D A;  9ILB A;  3BA4 A;  4I4Y A;  4I8M A;  1AFC A;  2L5X A;  1T4Q A;  2D22 A;  1JT3 A;  4IYB A;  4EFR A;  1BAR A;  1HKN A;  2KI4 A;  8I1B A;  3UD8 A;  2Y9F A;  3BAG A;  4I4P A;  4ISR A;  4L4I A;  5HPZ A;  4D0T A;  1XZZ A;  4USO A;  4P0J A;  1S0F A;  1HCE A;  3NBC A;  2P39 A;  1BLA A;  1ITB A;  1FWV A;  1FWU A;  1J0S A;  4I1E A;  1HWP B;  4ZFW B;  3VSF A;  3KMV A;  4IY9 A;  3MPP G;  4I4Q A;  3CQA A;  4JAW A;  4DEP A;  2XOA A;  1FV2 A;  4GOV A;  5BOW A;  2AQZ A;  3FJK A;  2KKI A;  3D7W B;  4USP A;  4AN6 A;  2QN4 A;  1HWN B;  3O49 A;  1QQK A;  3BAV A;  2RQ9 A;  1ISY A;  2VUA A;  1BLD A;  4EFQ A;  1HCD A;  4P6A A;  1ABR B;  2HWA A;  5D61 A;  4XKI A;  4PC4 A;  1AVX B;  3IM5 A;  1PUU B;  4J2Y A;  1RG8 A;  2NVH A;  3V0B A;  1R8O A;  3SNV A;  1BFC A;  1DFC A;  4I7I A;  5DSS B;  3AKG A;  4P0K A;  3HSM A;  1FMZ A;  1YF8 B;  3O4D A;  2M49 A;  1EYL A;  3A23 A;  4G9M A;  4QBC A;  4X37 A;  1QQL A;  4JQ0 A;  2DRY A;  3ILA A;  3OGF A;  3TC2 A;  4HR6 C;  4LO7 B;  1IRP A;  1HIB A;  2E4M A;  2AAI B;  1YXW A;  3NBD A;  1IRA X;  1JT5 A;  3A21 A;  4IZE A;  1WD4 A;  1V6W A;  5DZU A;  3WO2 A;  4QC4 A;  4G9N A;  1XG6 A;  4Z8S B;  4ZFY B;  3R4S A;  3FGM A;  2E4M C;  3A22 A;  1JTC A;  1S0E A;  3H6S E;  4F34 A;  4JKX B;  4OUJ A;  3WIN C;  5F8W A;  3FJE A;  1FMM S;  1FN0 A;  3Q7X A;  1F31 A;  2D7I A;  3IIR A;  4I4V A;  1N4K A;  3LLP A;  4XFS A;  1V6V A;  3HBW A;  3N7M A;  3WO3 A;  3NBN A;  4X38 A;  2ZR1 B;  1AVW B;  2ZQN A;  2P23 A;  3NBE A;  1ISZ A;  1AF9 A;  4XFT A;  4G6M A;  1EV2 A;  1DZC A;  4IQP A;  1S0C A;  21BI A;  3RSJ A;  1TP0 A;  4I4X A;  1DIW A;  3WA1 A;  3RMY A;  2IHO A;  4I0Y A;  3BX1 C;  4J2K A;  4GP0 A;  3CA4 A;  1Q04 A;  3AJ6 A;  5BP5 A;  3BAD A;  3ZC9 A;  1NZK A;  3O4O A;  5BXS A;  1AXM A;  4OWJ A;  4HJJ A;  5F8S A;  1Q1U A;  1CVS A;  1Z4S A;  3JRR A;  5BP5 C;  3AH4 A;  3FJA A;  1DLL A;  2NP0 A;  2VLC A;  2UUS A;  2Z49 A;  2HW9 A;  4EFP A;  1TFM B;  1RY7 A;  5FZU A;  2HZ9 A;  1HWM B;  3S8K A;  2FFU A;  2MC2 A;  4Q9G A;  3ZC8 A;  1DZD A;  3FJB A;  4DCK C;  2I1B A;  5EG6 C;  4F83 A;  4LO7 C;  1FGA A;  4G6J A;  3H6R A;  1JY0 A;  3AKH A;  3S8J A;  2Z48 A;  3AH1 A;  4FGF A;  4QD2 C;  2DS0 A;  1WBA A;  4D8H A;  3FUQ A;  3H6Q A;  4ZOT A;  1SR4 A;  4DEN A;  1TIE A;  3LTQ A;  1TWM A;  3FUO A;  2AFG A;  4KBB A;  2ESU A;  2GZB A;  1ISV A;  3AKF A;  2FO1 A;  1DQG A;  3OBR A;  1W3F A;  3BAH A;  2VXR A;  4LO1 C;  3FJC A;  1S0L A;  4LO8 B;  1G9C A;  4JKQ A;  1V6X A;  1W3G A;  1SR4 C;  4EB2 B;  3ZXG A;  2ZQO A;  5D63 A;  3F62 B;  3FJ9 A;  1I1B A;  2NM1 A;  4Q9P A;  3BRD A;  3R4U A;  1G9A A;  3PME A;  3CRH A;  4QAL A;  3BTA A;  4XFU A;  3BAU A;  3BRF A;  3VSZ A;  3FFZ A;  4I4O A;  3P6J A;  3VEQ A;  3F1R A;  4EEE B;  31BI A;  3A07 A;  5FNX A;  3N7J A;  2ERM A;  3N7K A;  2DRE A;  3Q7Y A;  3CRI A;  4QD2 B;  1JQZ A;  3N7L A;  5EC5 A;  1ONK B;  3HOM A;  3WIN A;  4END A;  2VSE A;  4I4R A;  3AH2 A;  4I4U A;  3IM7 A;  3H6R B;  1V6U A;  1Q03 A;  3CAH A;  1MC9 A;  3O44 A;  2R9K B;  1IIL A;  2Y9G A;  2Y9X E;  3W9T A;  7I1B A;  1Z2V A;  3PHZ A;  3I2A A;  4Q91 A;  2WBC A;  5I1B A;  4QKS A;  1HWO B;  4JRA A;  2D23 A;  3FJJ A;  3VT2 A;  1IT0 A;  4OWL A;  41BI A;  3AZW A;  4I3N A;  1FQ9 A;  4AN7 B;  3BRG C;  3ZX7 A;  4ZGR B;  1OQL B;  2DRZ A;  3BA5 A;  3OJ2 A;  1BFG A;  5BXP A;  4A7Y A;  1SZ6 B;  4A7Z A;  3N0K A;  4H9W A;  4Z9W B;  3WMV A;  4I4S A;  1M2T B;  1T9F A;  3VWC A;  1PZZ A;  5F90 A;  2LIE A;  4R6U B;  1D0H A;  2KLL A;  3VT0 A;  1M16 A;  5BXT A;  1DJS B;  5E24 E;  1CE7 B;  2X2S A;  3CA1 A;  1JLX A;  4FVV A;  1G9D A;  4GOY A;  1BFB A;  3P53 A;  1E0O A;  4X39 A;  3CA3 A;  4GP3 A;  1YYN A;  2FFV A;  4QKR A;  1WBC A;  2D43 A;  5JMC A;  1P63 A;  4I96 A;  1G9B A;  4D0Z A;  3UD7 A;  3OJM A; 
#chains in the Genus database with same CATH topology
 3FJH A;  1TWE A;  3HN1 A;  4HA2 A;  4OEE A;  3WMU A;  4QBV A;  2NTD A;  3UJ0 A;  1FV3 A;  1RML A;  4L4H A;  3FJD A;  1BA7 A;  3RMX A;  3V0A B;  3E8L C;  3PUB A;  4OW4 A;  1PC8 B;  1ISX A;  5DUY A;  2NYY A;  4GAI A;  4OEG A;  4LO1 A;  1TTU A;  2D7R A;  3O4B A;  4J2X A;  1II4 A;  2LIQ A;  4ZKT B;  3FJI A;  4H04 A;  4QO3 A;  1PWA A;  3OGG A;  3NJ5 A;  5BXR A;  1VCL A;  3EF2 A;  2ET2 A;  1EVT A;  3UJ4 A;  5G00 A;  2Q9X A;  5FNW A;  5B2H A;  1L2H A;  1DQO A;  2D20 A;  1RZO B;  3OBT A;  2FGF A;  4OEF A;  1AVA C;  5EHA A;  1I1E A;  2F8X C;  4ISQ A;  3IM6 A;  3BB2 A;  4J2S A;  3Q7W A;  4IHZ A;  4ZBV B;  3CRG A;  3O4C A;  4EKX B;  1DFQ A;  3CA6 A;  2MLL B;  4JP0 A;  2D1Z A;  3CA5 A;  4CJM A;  1BAS A;  4X3A A;  4YOL A;  2YUG A;  4KC3 A;  3K1X A;  2NZ9 A;  4I37 A;  4J23 B;  4G1R A;  2RST A;  1IJT A;  2RG9 B;  2VXT I;  3BA7 A;  1JT7 A;  2Q3N B;  2BEB A;  4TLP A;  3C9Z A;  4ION A;  3AKI A;  2K43 A;  2NS2 A;  3RTJ B;  1S0G A;  1QXM A;  3QYD A;  3CU1 B;  2QYI B;  4LO0 A;  4KEJ A;  4UY4 A;  1W3A A;  3OJV A;  3PG0 A;  2F2F A;  5BQU A;  2AXM A;  5F8Y A;  2KI6 B;  1YTO A;  1BFF A;  2D24 A;  4WBC A;  3RTI B;  1Z0H A;  2X2T A;  5FZY A;  4KEK A;  1K5V A;  2WRY A;  4KEI A;  4ZFU B;  4LO0 C;  1ISW A;  4LO3 A;  3V0A A;  3BAQ A;  5JLV A;  3I2X A;  1S0D A;  2K4A B;  5BQU C;  2F2F C;  1ILR 1;  2VU9 A;  3UD9 A;  4OWK A;  4IZX A;  3ZXD A;  3FJF A;  1IOB A;  1G82 A;  3WO4 A;  3MAL A;  1R8N A;  2J3P A;  4LO3 C;  5BVP I;  2Y9W C;  2K8R A;  1YBI A;  3VUO A;  3T8S A;  1NUN A;  4ZA3 B;  5FZZ A;  1TOO A;  2MIB A;  3JUT A;  3O3Q A;  3IAG C;  3CA0 A;  2GO2 A;  6I1B A;  1JLY A;  3I29 B;  1EPW A;  3AJ5 A;  1MD6 A;  1AVU A;  3V79 C;  4A7K A;  4MZH A;  1IHK A;  3P6I A;  4I1B A;  1XYF A;  1GGP B;  5DVH A;  3AZV A;  2BFH A;  1WD3 A;  3V0B B;  4ZLB B;  4GAF A;  3QR5 A;  2FDB M;  1S0B A;  2HWM A;  3POK A;  2KH2 A;  2BEA A;  2D44 A;  4IY8 A;  3VT1 A;  4LO2 A;  4I6I A;  3UDA A;  3BAO A;  2VSA A;  1KNM A;  3B9U A;  3HAL A;  4JPZ A;  3HMY A;  1K5U A;  1PUM B;  1XHB A;  3FJ8 A;  3O4A A;  1JT4 A;  4P0L A;  1UPS A;  3O5W B;  4I2S A;  5D62 A;  2IWT B;  4II0 A;  5GAQ A;  4LO2 C;  1A8D A;  9ILB A;  3BA4 A;  4I4Y A;  4I8M A;  1AFC A;  2L5X A;  1T4Q A;  2D22 A;  1JT3 A;  4IYB A;  4EFR A;  1BAR A;  1HKN A;  2KI4 A;  8I1B A;  3UD8 A;  2Y9F A;  3BAG A;  4I4P A;  4ISR A;  4L4I A;  5HPZ A;  4D0T A;  1XZZ A;  4USO A;  4P0J A;  1S0F A;  1HCE A;  3NBC A;  2P39 A;  1BLA A;  1ITB A;  1FWV A;  1FWU A;  1J0S A;  4I1E A;  1HWP B;  4ZFW B;  3VSF A;  4MZG B;  3KMV A;  4IY9 A;  3MPP G;  4I4Q A;  3CQA A;  4JAW A;  4DEP A;  2XOA A;  1FV2 A;  4GOV A;  5BOW A;  2AQZ A;  3FJK A;  2KKI A;  3D7W B;  4USP A;  4AN6 A;  2QN4 A;  1HWN B;  3O49 A;  1QQK A;  3BAV A;  2RQ9 A;  1ISY A;  2VUA A;  1BLD A;  4EFQ A;  1HCD A;  4P6A A;  1ABR B;  2HWA A;  5D61 A;  4XKI A;  4PC4 A;  1AVX B;  3IM5 A;  1PUU B;  4J2Y A;  1RG8 A;  2NVH A;  3V0B A;  1R8O A;  3SNV A;  1BFC A;  1DFC A;  4I7I A;  5DSS B;  3AKG A;  4P0K A;  3HSM A;  1FMZ A;  1YF8 B;  3O4D A;  2M49 A;  1EYL A;  3A23 A;  4G9M A;  4QBC A;  4X37 A;  1QQL A;  4JQ0 A;  2DRY A;  3ILA A;  3OGF A;  3TC2 A;  4HR6 C;  4LO7 B;  1IRP A;  1HIB A;  2E4M A;  2AAI B;  1YXW A;  3NBD A;  1IRA X;  1JT5 A;  3A21 A;  4IZE A;  1WD4 A;  1V6W A;  5DZU A;  3WO2 A;  4QC4 A;  4G9N A;  1XG6 A;  4Z8S B;  4ZFY B;  3R4S A;  3FGM A;  2E4M C;  3A22 A;  1JTC A;  1S0E A;  3H6S E;  4F34 A;  4JKX B;  4OUJ A;  3WIN C;  5F8W A;  3FJE A;  1FMM S;  1FN0 A;  3Q7X A;  1F31 A;  2D7I A;  3IIR A;  4I4V A;  1N4K A;  3LLP A;  4XFS A;  1V6V A;  3HBW A;  3N7M A;  3WO3 A;  3NBN A;  4X38 A;  2ZR1 B;  1AVW B;  2ZQN A;  2P23 A;  3NBE A;  1ISZ A;  1AF9 A;  4XFT A;  4G6M A;  1EV2 A;  1DZC A;  4IQP A;  1S0C A;  21BI A;  3RSJ A;  1TP0 A;  4I4X A;  1DIW A;  3WA1 A;  3RMY A;  2IHO A;  4I0Y A;  3BX1 C;  4J2K A;  4GP0 A;  3CA4 A;  1Q04 A;  3AJ6 A;  5BP5 A;  3BAD A;  3ZC9 A;  1NZK A;  3O4O A;  5BXS A;  1AXM A;  4OWJ A;  4HJJ A;  5F8S A;  4H75 A;  1Q1U A;  1CVS A;  1Z4S A;  3JRR A;  5BP5 C;  3AH4 A;  3FJA A;  1DLL A;  2NP0 A;  2VLC A;  2UUS A;  2Z49 A;  2HW9 A;  4EFP A;  1TFM B;  1RY7 A;  5FZU A;  2HZ9 A;  1HWM B;  3S8K A;  2FFU A;  2MC2 A;  4Q9G A;  3ZC8 A;  1DZD A;  3FJB A;  4DCK C;  2I1B A;  5EG6 C;  4F83 A;  4LO7 C;  1FGA A;  4G6J A;  3H6R A;  1JY0 A;  3AKH A;  3S8J A;  2Z48 A;  3AH1 A;  4FGF A;  4QD2 C;  2DS0 A;  1WBA A;  4D8H A;  3FUQ A;  3H6Q A;  4ZOT A;  1SR4 A;  4DEN A;  1TIE A;  3LTQ A;  1TWM A;  3FUO A;  2AFG A;  4KBB A;  2ESU A;  2GZB A;  1ISV A;  3AKF A;  2FO1 A;  1DQG A;  3OBR A;  1W3F A;  3BAH A;  2VXR A;  4LO1 C;  3FJC A;  1S0L A;  4LO8 B;  1G9C A;  4JKQ A;  1V6X A;  1W3G A;  1SR4 C;  4EB2 B;  3ZXG A;  2ZQO A;  5D63 A;  3F62 B;  3FJ9 A;  1I1B A;  2NM1 A;  4Q9P A;  3BRD A;  3R4U A;  1G9A A;  3PME A;  3CRH A;  4QAL A;  3BTA A;  4XFU A;  3BAU A;  3BRF A;  3VSZ A;  3FFZ A;  4I4O A;  3P6J A;  3VEQ A;  3F1R A;  4EEE B;  31BI A;  3A07 A;  5FNX A;  3N7J A;  2ERM A;  3N7K A;  2DRE A;  3Q7Y A;  3CRI A;  4QD2 B;  1JQZ A;  3N7L A;  5EC5 A;  1ONK B;  3HOM A;  3WIN A;  4END A;  2VSE A;  4I4R A;  3AH2 A;  4I4U A;  3IM7 A;  3H6R B;  1V6U A;  1Q03 A;  3CAH A;  1MC9 A;  3O44 A;  2R9K B;  1IIL A;  2Y9G A;  2Y9X E;  3W9T A;  7I1B A;  1Z2V A;  3PHZ A;  3I2A A;  4Q91 A;  2WBC A;  5I1B A;  4QKS A;  1HWO B;  4JRA A;  2D23 A;  3FJJ A;  3VT2 A;  1IT0 A;  4OWL A;  41BI A;  3AZW A;  4I3N A;  1FQ9 A;  4AN7 B;  3BRG C;  3ZX7 A;  4ZGR B;  1OQL B;  2DRZ A;  3BA5 A;  3OJ2 A;  1BFG A;  5BXP A;  4MZF B;  4A7Y A;  1SZ6 B;  4A7Z A;  3N0K A;  4H9W A;  4Z9W B;  3WMV A;  4I4S A;  1M2T B;  1T9F A;  3VWC A;  1PZZ A;  5F90 A;  2LIE A;  4R6U B;  1D0H A;  2KLL A;  3VT0 A;  1M16 A;  5BXT A;  1DJS B;  5E24 E;  1CE7 B;  2X2S A;  3CA1 A;  1JLX A;  4FVV A;  1G9D A;  4GOY A;  1BFB A;  3P53 A;  1E0O A;  4X39 A;  3CA3 A;  4GP3 A;  1YYN A;  2FFV A;  4QKR A;  1WBC A;  2D43 A;  5JMC A;  1P63 A;  4I96 A;  1G9B A;  4D0Z A;  3UD7 A;  3OJM A; 
#chains in the Genus database with same CATH homology
 3FJH A;  1TWE A;  3HN1 A;  4HA2 A;  4OEE A;  3WMU A;  4QBV A;  2NTD A;  3UJ0 A;  1FV3 A;  1RML A;  4L4H A;  3FJD A;  1BA7 A;  3RMX A;  3V0A B;  3E8L C;  3PUB A;  4OW4 A;  1PC8 B;  1ISX A;  5DUY A;  2NYY A;  4GAI A;  4OEG A;  4LO1 A;  1TTU A;  2D7R A;  3O4B A;  4J2X A;  1II4 A;  2LIQ A;  4ZKT B;  3FJI A;  4H04 A;  4QO3 A;  1PWA A;  3OGG A;  3NJ5 A;  5BXR A;  1VCL A;  3EF2 A;  2ET2 A;  1EVT A;  3UJ4 A;  5G00 A;  2Q9X A;  5FNW A;  5B2H A;  1L2H A;  1DQO A;  2D20 A;  1RZO B;  3OBT A;  2FGF A;  4OEF A;  1AVA C;  5EHA A;  1I1E A;  2F8X C;  4ISQ A;  3IM6 A;  3BB2 A;  4J2S A;  3Q7W A;  4IHZ A;  4ZBV B;  3CRG A;  3O4C A;  4EKX B;  1DFQ A;  3CA6 A;  2MLL B;  4JP0 A;  2D1Z A;  3CA5 A;  4CJM A;  1BAS A;  4X3A A;  4YOL A;  2YUG A;  4KC3 A;  3K1X A;  2NZ9 A;  4I37 A;  4J23 B;  4G1R A;  2RST A;  1IJT A;  2RG9 B;  2VXT I;  3BA7 A;  1JT7 A;  2Q3N B;  2BEB A;  4TLP A;  3C9Z A;  4ION A;  3AKI A;  2K43 A;  2NS2 A;  3RTJ B;  1S0G A;  1QXM A;  3QYD A;  3CU1 B;  2QYI B;  4LO0 A;  4KEJ A;  4UY4 A;  1W3A A;  3OJV A;  3PG0 A;  2F2F A;  5BQU A;  2AXM A;  5F8Y A;  2KI6 B;  1YTO A;  1BFF A;  2D24 A;  4WBC A;  3RTI B;  1Z0H A;  2X2T A;  5FZY A;  4KEK A;  1K5V A;  2WRY A;  4KEI A;  4ZFU B;  4LO0 C;  1ISW A;  4LO3 A;  3V0A A;  3BAQ A;  5JLV A;  3I2X A;  1S0D A;  2K4A B;  5BQU C;  2F2F C;  1ILR 1;  2VU9 A;  3UD9 A;  4OWK A;  4IZX A;  3ZXD A;  3FJF A;  1IOB A;  1G82 A;  3WO4 A;  3MAL A;  1R8N A;  2J3P A;  4LO3 C;  5BVP I;  2Y9W C;  2K8R A;  1YBI A;  3VUO A;  3T8S A;  1NUN A;  4ZA3 B;  5FZZ A;  1TOO A;  2MIB A;  3JUT A;  3O3Q A;  3IAG C;  3CA0 A;  2GO2 A;  6I1B A;  1JLY A;  3I29 B;  1EPW A;  3AJ5 A;  1MD6 A;  1AVU A;  3V79 C;  4A7K A;  4MZH A;  1IHK A;  3P6I A;  4I1B A;  1XYF A;  1GGP B;  5DVH A;  3AZV A;  2BFH A;  1WD3 A;  3V0B B;  4ZLB B;  4GAF A;  3QR5 A;  2FDB M;  1S0B A;  2HWM A;  3POK A;  2KH2 A;  2BEA A;  2D44 A;  4IY8 A;  3VT1 A;  4LO2 A;  4I6I A;  3UDA A;  3BAO A;  2VSA A;  1KNM A;  3B9U A;  3HAL A;  4JPZ A;  3HMY A;  1K5U A;  1PUM B;  1XHB A;  3FJ8 A;  3O4A A;  1JT4 A;  4P0L A;  1UPS A;  3O5W B;  4I2S A;  5D62 A;  2IWT B;  4II0 A;  5GAQ A;  4LO2 C;  1A8D A;  9ILB A;  3BA4 A;  4I4Y A;  4I8M A;  1AFC A;  2L5X A;  1T4Q A;  2D22 A;  1JT3 A;  4IYB A;  4EFR A;  1BAR A;  1HKN A;  2KI4 A;  8I1B A;  3UD8 A;  2Y9F A;  3BAG A;  4I4P A;  4ISR A;  4L4I A;  5HPZ A;  4D0T A;  1XZZ A;  4USO A;  4P0J A;  1S0F A;  1HCE A;  3NBC A;  2P39 A;  1BLA A;  1ITB A;  1FWV A;  1FWU A;  1J0S A;  4I1E A;  1HWP B;  4ZFW B;  3VSF A;  4MZG B;  3KMV A;  4IY9 A;  3MPP G;  4I4Q A;  3CQA A;  4JAW A;  4DEP A;  2XOA A;  1FV2 A;  4GOV A;  5BOW A;  2AQZ A;  3FJK A;  2KKI A;  3D7W B;  4USP A;  4AN6 A;  2QN4 A;  1HWN B;  3O49 A;  1QQK A;  3BAV A;  2RQ9 A;  1ISY A;  2VUA A;  1BLD A;  4EFQ A;  1HCD A;  4P6A A;  1ABR B;  2HWA A;  5D61 A;  4XKI A;  4PC4 A;  1AVX B;  3IM5 A;  1PUU B;  4J2Y A;  1RG8 A;  2NVH A;  3V0B A;  1R8O A;  3SNV A;  1BFC A;  1DFC A;  4I7I A;  5DSS B;  3AKG A;  4P0K A;  3HSM A;  1FMZ A;  1YF8 B;  3O4D A;  2M49 A;  1EYL A;  3A23 A;  4G9M A;  4QBC A;  4X37 A;  1QQL A;  4JQ0 A;  2DRY A;  3ILA A;  3OGF A;  3TC2 A;  4HR6 C;  4LO7 B;  1IRP A;  1HIB A;  2E4M A;  2AAI B;  1YXW A;  3NBD A;  1IRA X;  1JT5 A;  3A21 A;  4IZE A;  1WD4 A;  1V6W A;  5DZU A;  3WO2 A;  4QC4 A;  4G9N A;  1XG6 A;  4Z8S B;  4ZFY B;  3R4S A;  3FGM A;  2E4M C;  3A22 A;  1JTC A;  1S0E A;  3H6S E;  4F34 A;  4JKX B;  4OUJ A;  3WIN C;  5F8W A;  3FJE A;  1FMM S;  1FN0 A;  3Q7X A;  1F31 A;  2D7I A;  3IIR A;  4I4V A;  1N4K A;  3LLP A;  4XFS A;  1V6V A;  3HBW A;  3N7M A;  3WO3 A;  3NBN A;  4X38 A;  2ZR1 B;  1AVW B;  2ZQN A;  2P23 A;  3NBE A;  1ISZ A;  1AF9 A;  4XFT A;  4G6M A;  1EV2 A;  1DZC A;  4IQP A;  1S0C A;  21BI A;  3RSJ A;  1TP0 A;  4I4X A;  1DIW A;  3WA1 A;  3RMY A;  2IHO A;  4I0Y A;  3BX1 C;  4J2K A;  4GP0 A;  3CA4 A;  1Q04 A;  3AJ6 A;  5BP5 A;  3BAD A;  3ZC9 A;  1NZK A;  3O4O A;  5BXS A;  1AXM A;  4OWJ A;  4HJJ A;  5F8S A;  4H75 A;  1Q1U A;  1CVS A;  1Z4S A;  3JRR A;  5BP5 C;  3AH4 A;  3FJA A;  1DLL A;  2NP0 A;  2VLC A;  2UUS A;  2Z49 A;  2HW9 A;  4EFP A;  1TFM B;  1RY7 A;  5FZU A;  2HZ9 A;  1HWM B;  3S8K A;  2FFU A;  2MC2 A;  4Q9G A;  3ZC8 A;  1DZD A;  3FJB A;  4DCK C;  2I1B A;  5EG6 C;  4F83 A;  4LO7 C;  1FGA A;  4G6J A;  3H6R A;  1JY0 A;  3AKH A;  3S8J A;  2Z48 A;  3AH1 A;  4FGF A;  4QD2 C;  2DS0 A;  1WBA A;  4D8H A;  3FUQ A;  3H6Q A;  4ZOT A;  1SR4 A;  4DEN A;  1TIE A;  3LTQ A;  1TWM A;  3FUO A;  2AFG A;  4KBB A;  2ESU A;  2GZB A;  1ISV A;  3AKF A;  2FO1 A;  1DQG A;  3OBR A;  1W3F A;  3BAH A;  2VXR A;  4LO1 C;  3FJC A;  1S0L A;  4LO8 B;  1G9C A;  4JKQ A;  1V6X A;  1W3G A;  1SR4 C;  4EB2 B;  3ZXG A;  2ZQO A;  5D63 A;  3F62 B;  3FJ9 A;  1I1B A;  2NM1 A;  4Q9P A;  3BRD A;  3R4U A;  1G9A A;  3PME A;  3CRH A;  4QAL A;  3BTA A;  4XFU A;  3BAU A;  3BRF A;  3VSZ A;  3FFZ A;  4I4O A;  3P6J A;  3VEQ A;  3F1R A;  4EEE B;  31BI A;  3A07 A;  5FNX A;  3N7J A;  2ERM A;  3N7K A;  2DRE A;  3Q7Y A;  3CRI A;  4QD2 B;  1JQZ A;  3N7L A;  5EC5 A;  1ONK B;  3HOM A;  3WIN A;  4END A;  2VSE A;  4I4R A;  3AH2 A;  4I4U A;  3IM7 A;  3H6R B;  1V6U A;  1Q03 A;  3CAH A;  1MC9 A;  3O44 A;  2R9K B;  1IIL A;  2Y9G A;  2Y9X E;  3W9T A;  7I1B A;  1Z2V A;  3PHZ A;  3I2A A;  4Q91 A;  2WBC A;  5I1B A;  4QKS A;  1HWO B;  4JRA A;  2D23 A;  3FJJ A;  3VT2 A;  1IT0 A;  4OWL A;  41BI A;  3AZW A;  4I3N A;  1FQ9 A;  4AN7 B;  3BRG C;  3ZX7 A;  4ZGR B;  1OQL B;  2DRZ A;  3BA5 A;  3OJ2 A;  1BFG A;  5BXP A;  4MZF B;  4A7Y A;  1SZ6 B;  4A7Z A;  3N0K A;  4H9W A;  4Z9W B;  3WMV A;  4I4S A;  1M2T B;  1T9F A;  3VWC A;  1PZZ A;  5F90 A;  2LIE A;  4R6U B;  1D0H A;  2KLL A;  3VT0 A;  1M16 A;  5BXT A;  1DJS B;  5E24 E;  1CE7 B;  2X2S A;  3CA1 A;  1JLX A;  4FVV A;  1G9D A;  4GOY A;  1BFB A;  3P53 A;  1E0O A;  4X39 A;  3CA3 A;  4GP3 A;  1YYN A;  2FFV A;  4QKR A;  1WBC A;  2D43 A;  5JMC A;  1P63 A;  4I96 A;  1G9B A;  4D0Z A;  3UD7 A;  3OJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...