3BA5A

Crystal structure of d28a mutant of human acidic fibroblast growth factor
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPAGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title A logical OR redundancy within the Asx-Pro-Asx-Gly type I beta-turn motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 38
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ba5A00
4JP0A 3HALA 1M2TB 1BLDA 4QKRA 1HKNA 2Y9FA 2L5XA 4LO8B 1PUMB 4I0YA 1FWVA 1S0LA 2D43A 4LO3C 5BXTA 3NBDA 4H04A 3RSJA 3FJIA 1JTCA 1FGAA 4F34A 1FMZA 1G82A 1MD6A 3P6IA 5BOWA 7I1BA 4OEFA 4DCKC 2BEAA 4OW4A 1DZDA 1L2HA 2HZ9A 4OWJA 3EF2A 4D8HA 3CA0A 2VSEA 3AZWA 4F83A 4I4SA 3FJEA 2ESUA 1P63A 2KH2A 2QYIB 3AH4A 1Z2VA 3VT2A 3FFZA 2HW9A 4ZFYB 4JKQA 4JPZA 5BVPI 1YF8B 1S0EA 1W3GA 3BB2A 3N7LA 1ONKB 4LO1C 3CA3A 3AZVA 2KI4A 3O44A 4P0LA 4AN7B 2AAIB 3CA1A 4JKXB 3UD7A 2D20A 4P0KA 2HWAA 5DSSB 2KKIA 1WBAA 3KMVA 5D63A 1WD4A 3W9TA 3V79C 4QD2B 1RG8A 4I37A 4I3NA 3A07A 4YOLA 1PWAA 2NTDA 3FJKA 5BQUC 5F8SA 1HWMB 4HR6C 2DRYA 4TLPA 1TIEA 4USPA 4LO0C 1BARA 1EV2A 1JY0A 3IM6A 4ISQA 1HWNB 2Q9XA 3AH1A 3VT1A 4OWLA 4LO7C 4I8MA 3FJFA 3RMXA 4I4VA 2VXTI 2E4MC 3I2AA 41BIA 4WBCA 5F90A 2R9KB 4LO2C 4OUJA 1V6VA 1FN0A 4G6MA 4IYBA 1BFFA 4KC3A 1PZZA 2VUAA 3WINC 1JT4A 3D7WB 3V0AA 4FVVA 2MIBA 1M16A 3VWCA 4Z8SB 1TP0A 2Y9GA 1YTOA 3C9ZA 2GZBA 2LIEA 4I1EA 4R6UB 1BFCA 3CQAA 1JLYA 4QC4A 1ISVA 3FJJA 3HOMA 1EPWA 3RTJB 1I1BA 3FJ8A 3BAHA 3I2XA 3RMYA 1D0HA 2FO1A 4CJMA 3ZC9A 2DREA 4ISRA 3H6RA 1QXMA 3UD9A 4J2XA 1HCDA 5D62A 2K4AB 2YUGA 3OJ2A 3AH2A 3UJ0A 1IJTA 2HWMA 2MLLB 4L4HA 3S8JA 1ISXA 1Q03A 3F1RA 1Z4SA 3IM7A 3F62B 4ZOTA 2QN4A 4G9NA 5GAQA 4ZFWB 5DUYA 3N7JA 4X38A 3ZXGA 4I4RA 5BP5A 3FJ9A 4DENA 1FQ9A 3SNVA 1RZOB 3V0BA 2ZQOA 4IZEA 4OEGA 1QQLA 4DEPA 3I29B 1G9CA 3HBWA 4JRAA 4ENDA 1R8OA 1RY7A 4A7ZA 1S0BA 4ZA3B 2F2FA 3R4SA 1ISYA 1II4A 3NBNA 3A22A 4ZGRB 1JQZA 1V6XA 1T4QA 1IOBA 3JUTA 3ZXDA 2NYYA 4ZBVB 5FNWA 1JT3A 1XZZA 4IY8A 3BA4A 2IWTB 4X39A 3O4OA 1FV2A 6I1BA 4I1BA 4KEJA 2ERMA 3VT0A 4FGFA 4I4UA 1MC9A 3Q7XA 1AXMA 3UDAA 1V6UA 4AN6A 2AQZA 4I4YA 4Q9PA 4XKIA 1KNMA 3BRDA 1IRPA 2D7IA 5E24E 1JT5A 1ABRB 2BEBA 1SR4A 1ISZA 4L4IA 3AJ6A 1CE7B 3OJVA 1AVWB 4I4XA 1AVAC 1DLLA 1ILR1 1AVUA 5BXPA 2J3PA 2X2TA 1S0CA 1RMLA 4X3AA 1DJSB 4II0A 1SZ6B 3IAGC 3BX1C 1CVSA 3N0KA 4QD2C 4J2SA 1AVXB 2AFGA 3ILAA 3OBRA 4IONA 4J2KA 3CRIA 2D1ZA 1Z0HA 1WBCA 4D0ZA 3P6JA 2Y9WC 4QALA 1QQKA 4QO3A 4XFTA 2WBCA 4Q91A 3UJ4A 3BRGC 4Z9WB 4LO0A 4H9WA 3Q7YA 1YXWA 1NZKA 2WRYA 1IHKA 5FNXA 1XG6A 1ITBA 4ZLBB 3R4UA 2IHOA 3BAQA 4GOYA 3CRGA 4HA2A 3N7KA 5D61A 1N4KA 1T9FA 3H6QA 1R8NA 5FZYA 3BAOA 3AKFA 3BTAA 3FUOA 3FGMA 3V0AB 3BADA 3ZX7A 3LLPA 3BA5A 3MALA 3NBEA 1W3FA 4IZXA 3HMYA 4KEIA 1S0GA 2FFUA 4I4QA 3TC2A 2KI6B 4KEKA 4OEEA 1XHBA 3H6RB 1JLXA 1DQGA 5G00A 3O4AA 1Q04A 5DZUA 2FGFA 3IM5A 1TOOA 2NP0A 3H6SE 3VUOA 4G1RA 1FWUA 2P23A 3AKHA 4KBBA 1S0FA 5EC5A 3WO4A 1Q1UA 2P39A 2FDBM 5JMCA 4X37A 3N7MA 3PUBA 3HN1A 1TTUA 3BAUA 1GGPB 4GP0A 3WMVA 1UPSA 2DS0A 3FJHA 1J0SA 2ZQNA 5BP5C 3BA7A 3V0BB 4I7IA 4QKSA 3O5WB 3WO2A 3VSZA 1G9DA 3ZC8A 4GOVA 8I1BA 3LTQA 4LO3A 1TWEA 3CA4A 1BLAA 2I1BA 2RSTA 2ZR1B 2F2FC 4GAFA 1EVTA 1E0OA 3PG0A 1IRAX 3O4BA 2MC2A 1BASA 3O4DA 1HCEA 3JRRA 3RTIB 3VSFA 3OBTA 4D0TA 4PC4A 2D22A 4P0JA 1VCLA 1FMMS 4QBVA 2GO2A 3CRHA 2X2SA 2Z49A 3P53A 3B9UA 4GP3A 3HSMA 3BAGA 1JT7A 5HPZA 4A7YA 2VU9A 1SR4C 3O49A 3A23A 3OGFA 4G6JA 3PMEA 4LO1A 2F8XC 4EB2B 4P6AA 4A7KA 3AKIA 4ZKTB 3NBCA 1HWPB 3S8KA 1K5VA 1DQOA 2LIQA 2Y9XE 3FJBA 1TWMA 3AJ5A 4JQ0A 1YBIA 5BXSA 2BFHA 3WO3A 2Q3NB 1BFGA 1NUNA 4EFRA 2NM1A 5BQUA 3FJCA 3BRFA 4ZFUB 3POKA 3AKGA 3BAVA 4I6IA 1DZCA 2NVHA 3Q7WA 3O3QA 3O4CA 3A21A 1HWOB 1W3AA 2AXMA 3VEQA 2K8RA 1K5UA 3CA5A 4HJJA 2FFVA 4QBCA 4Q9GA 4USOA 1OQLB 1IT0A 2Z48A 3UD8A 2M49A 2E4MA 2VXRA 3WA1A 4LO7B 2D44A 2RQ9A 5B2HA 5EHAA 1V6WA 3IIRA 4LO2A 3OGGA 1A8DA 1PC8B 1EYLA 1IILA 4IY9A 2KLLA 3MPPG 4EFQA 2VSAA 3QR5A 4XFSA 1G9BA 2D24A 3WINA 2XOAA 4OWKA 3PHZA 2D23A 1YYNA 2ET2A 2DRZA 4J23B 4EKXB 3E8LC 9ILBA 1FV3A 5DVHA 4EFPA 3CAHA 1S0DA 4JAWA 3CU1B 4I4PA 3FJDA 1AFCA 5JLVA 3WMUA 1AF9A 3NJ5A 1ISWA 4GAIA 5BXRA 1BFBA 3K1XA 4G9MA 3FJAA 3T8SA 1G9AA 4J2YA 4EEEB 4I2SA 1BA7A 1HIBA 4IHZA 3QYDA 2UUSA 2D7RA 5F8WA 3OJMA 2K43A 21BIA 4I96A 5FZZA 3CA6A 2VLCA 5EG6C 1DFQA 1DFCA 5F8YA 4I4OA 1TFMB 31BIA 5I1BA 2NZ9A 1I1EA 1WD3A 1DIWA 2RG9B 4IQPA 1F31A 3FUQA 1PUUB 4XFUA 5FZUA 1XYFA
chains in the Genus database with same CATH superfamily
4JP0A 3HALA 1M2TB 1BLDA 4QKRA 1HKNA 2Y9FA 2L5XA 4LO8B 1PUMB 4I0YA 1FWVA 1S0LA 2D43A 4LO3C 5BXTA 3NBDA 4H04A 3RSJA 3FJIA 1JTCA 1FGAA 4F34A 1FMZA 1G82A 1MD6A 3P6IA 5BOWA 7I1BA 4OEFA 4DCKC 2BEAA 4OW4A 1DZDA 1L2HA 2HZ9A 4OWJA 3EF2A 4D8HA 3CA0A 2VSEA 3AZWA 4F83A 4I4SA 3FJEA 4MZHA 2ESUA 1P63A 2KH2A 2QYIB 3AH4A 1Z2VA 3VT2A 3FFZA 2HW9A 4ZFYB 4JKQA 4JPZA 5BVPI 1YF8B 1S0EA 1W3GA 3BB2A 3N7LA 1ONKB 4LO1C 3CA3A 3AZVA 2KI4A 3O44A 4P0LA 4AN7B 2AAIB 3CA1A 4JKXB 3UD7A 2D20A 4P0KA 2HWAA 5DSSB 2KKIA 1WBAA 3KMVA 5D63A 1WD4A 3W9TA 3V79C 4QD2B 1RG8A 4I37A 4I3NA 3A07A 4YOLA 1PWAA 2NTDA 3FJKA 5BQUC 5F8SA 1HWMB 4HR6C 2DRYA 4TLPA 1TIEA 4USPA 4LO0C 1BARA 1EV2A 4MZFB 1JY0A 3IM6A 4ISQA 1HWNB 2Q9XA 3AH1A 3VT1A 4OWLA 4LO7C 4I8MA 3FJFA 3RMXA 4I4VA 2VXTI 2E4MC 3I2AA 41BIA 4WBCA 5F90A 2R9KB 4LO2C 4OUJA 1V6VA 1FN0A 4G6MA 4IYBA 1BFFA 4KC3A 1PZZA 2VUAA 3WINC 1JT4A 3D7WB 3V0AA 4FVVA 2MIBA 1M16A 3VWCA 4Z8SB 1TP0A 2Y9GA 1YTOA 3C9ZA 2GZBA 2LIEA 4I1EA 4R6UB 1BFCA 3CQAA 1JLYA 4QC4A 1ISVA 3FJJA 3HOMA 1EPWA 3RTJB 1I1BA 3FJ8A 3BAHA 3I2XA 4MZGB 1D0HA 3RMYA 2FO1A 4CJMA 3ZC9A 2DREA 4ISRA 3H6RA 1QXMA 3UD9A 4J2XA 1HCDA 5D62A 2K4AB 2YUGA 3OJ2A 3AH2A 3UJ0A 1IJTA 2HWMA 2MLLB 4L4HA 3S8JA 1ISXA 1Q03A 3F1RA 1Z4SA 3IM7A 3F62B 4ZOTA 2QN4A 4G9NA 5GAQA 4ZFWB 5DUYA 3N7JA 4X38A 3ZXGA 4I4RA 5BP5A 3FJ9A 4DENA 1FQ9A 3SNVA 1RZOB 3V0BA 2ZQOA 4IZEA 4OEGA 1QQLA 4DEPA 3I29B 1G9CA 3HBWA 4JRAA 4ENDA 1R8OA 1RY7A 4A7ZA 1S0BA 4ZA3B 2F2FA 3R4SA 1ISYA 1II4A 3NBNA 3A22A 4ZGRB 1JQZA 1V6XA 1T4QA 1IOBA 3JUTA 3ZXDA 2NYYA 4ZBVB 5FNWA 1JT3A 1XZZA 4IY8A 3BA4A 2IWTB 4X39A 3O4OA 1FV2A 6I1BA 4I1BA 4KEJA 2ERMA 3VT0A 4FGFA 4I4UA 1MC9A 3Q7XA 1AXMA 3UDAA 1V6UA 4AN6A 2AQZA 4I4YA 4Q9PA 4XKIA 1KNMA 3BRDA 1IRPA 2D7IA 5E24E 1JT5A 1ABRB 2BEBA 1SR4A 1ISZA 4L4IA 4UY4A 3AJ6A 1CE7B 3OJVA 1AVWB 4I4XA 1AVAC 1DLLA 1ILR1 1AVUA 5BXPA 2J3PA 2X2TA 1S0CA 1RMLA 4X3AA 1DJSB 4II0A 1SZ6B 3IAGC 3BX1C 1CVSA 3N0KA 4QD2C 4J2SA 1AVXB 2AFGA 3ILAA 3OBRA 4IONA 4J2KA 3CRIA 2D1ZA 1Z0HA 1WBCA 4D0ZA 3P6JA 2Y9WC 4QALA 1QQKA 4QO3A 4XFTA 2WBCA 4Q91A 3UJ4A 3BRGC 4Z9WB 4LO0A 4H9WA 3Q7YA 1YXWA 1NZKA 2WRYA 1IHKA 5FNXA 1XG6A 1ITBA 4ZLBB 3R4UA 2IHOA 3BAQA 4GOYA 3CRGA 4HA2A 3N7KA 5D61A 1N4KA 1T9FA 3H6QA 1R8NA 5FZYA 3BAOA 3AKFA 3BTAA 3FUOA 3FGMA 3V0AB 3BADA 3ZX7A 3LLPA 3BA5A 3MALA 3NBEA 1W3FA 4IZXA 3HMYA 4KEIA 1S0GA 2FFUA 4I4QA 3TC2A 2KI6B 4KEKA 4OEEA 1XHBA 3H6RB 1JLXA 1DQGA 5G00A 3O4AA 1Q04A 5DZUA 2FGFA 3IM5A 1TOOA 2NP0A 3H6SE 3VUOA 4G1RA 1FWUA 2P23A 3AKHA 4KBBA 1S0FA 5EC5A 3WO4A 1Q1UA 2P39A 2FDBM 5JMCA 4X37A 3N7MA 3PUBA 3HN1A 1TTUA 3BAUA 1GGPB 4GP0A 3WMVA 2NS2A 1UPSA 2DS0A 3FJHA 1J0SA 2ZQNA 5BP5C 3BA7A 3V0BB 4I7IA 4QKSA 3O5WB 3WO2A 3VSZA 1G9DA 3ZC8A 4GOVA 8I1BA 3LTQA 4LO3A 1TWEA 3CA4A 1BLAA 2I1BA 2RSTA 2ZR1B 2F2FC 4GAFA 1EVTA 1E0OA 3PG0A 1IRAX 3O4BA 2MC2A 1BASA 3O4DA 1HCEA 3JRRA 3RTIB 3VSFA 3OBTA 4D0TA 4PC4A 2D22A 4P0JA 1VCLA 1FMMS 4QBVA 2GO2A 3CRHA 2X2SA 2Z49A 3P53A 3B9UA 4GP3A 3HSMA 3BAGA 1JT7A 5HPZA 4A7YA 2VU9A 1SR4C 3O49A 3A23A 3OGFA 4G6JA 3PMEA 4LO1A 2F8XC 4EB2B 4P6AA 4A7KA 3AKIA 4ZKTB 3NBCA 1HWPB 3S8KA 1K5VA 1DQOA 2LIQA 2Y9XE 3FJBA 1TWMA 3AJ5A 4JQ0A 1YBIA 5BXSA 2BFHA 3WO3A 2Q3NB 1BFGA 1NUNA 4EFRA 2NM1A 5BQUA 3FJCA 3BRFA 4ZFUB 3POKA 3AKGA 3BAVA 4I6IA 1DZCA 2NVHA 3Q7WA 3O3QA 3O4CA 3A21A 1HWOB 1W3AA 2AXMA 3VEQA 2K8RA 1K5UA 3CA5A 4HJJA 2FFVA 4QBCA 4Q9GA 4USOA 1OQLB 1IT0A 2Z48A 3UD8A 2M49A 2E4MA 2VXRA 3WA1A 4LO7B 2D44A 2RQ9A 5B2HA 4H75A 1V6WA 5EHAA 3IIRA 4LO2A 3OGGA 1A8DA 1PC8B 1EYLA 1IILA 4IY9A 2KLLA 3MPPG 4EFQA 2VSAA 3QR5A 4XFSA 1G9BA 2D24A 3WINA 2XOAA 4OWKA 3PHZA 2D23A 1YYNA 2ET2A 2DRZA 4J23B 4EKXB 3E8LC 9ILBA 1FV3A 5DVHA 4EFPA 3CAHA 1S0DA 4JAWA 3CU1B 4I4PA 3FJDA 1AFCA 5JLVA 3WMUA 1AF9A 3NJ5A 1ISWA 4GAIA 5BXRA 1BFBA 3K1XA 4G9MA 3FJAA 3T8SA 1G9AA 4J2YA 4EEEB 4I2SA 1BA7A 1HIBA 4IHZA 3QYDA 2UUSA 2D7RA 5F8WA 3OJMA 2K43A 21BIA 4I96A 5FZZA 3CA6A 2VLCA 5EG6C 1DFQA 1DFCA 5F8YA 4I4OA 1TFMB 31BIA 5I1BA 2NZ9A 1I1EA 1WD3A 1DIWA 2RG9B 4IQPA 1F31A 3FUQA 1PUUB 4XFUA 5FZUA 1XYFA
chains in the Genus database with same CATH topology
4JP0A 3HALA 1M2TB 1BLDA 4QKRA 1HKNA 2Y9FA 2L5XA 4LO8B 1PUMB 4I0YA 1FWVA 1S0LA 2D43A 4LO3C 5BXTA 3NBDA 4H04A 3RSJA 3FJIA 1JTCA 1FGAA 4F34A 1FMZA 1G82A 1MD6A 3P6IA 5BOWA 7I1BA 4OEFA 4DCKC 2BEAA 4OW4A 1DZDA 1L2HA 2HZ9A 4OWJA 3EF2A 4D8HA 3CA0A 2VSEA 3AZWA 4F83A 4I4SA 3FJEA 4MZHA 2ESUA 1P63A 2KH2A 2QYIB 3AH4A 1Z2VA 3VT2A 3FFZA 2HW9A 4ZFYB 4JKQA 4JPZA 5BVPI 1YF8B 1S0EA 1W3GA 3BB2A 3N7LA 1ONKB 4LO1C 3CA3A 3AZVA 2KI4A 3O44A 4P0LA 4AN7B 2AAIB 3CA1A 4JKXB 3UD7A 2D20A 4P0KA 2HWAA 5DSSB 2KKIA 1WBAA 3KMVA 5D63A 1WD4A 3W9TA 3V79C 4QD2B 1RG8A 4I37A 4I3NA 3A07A 4YOLA 1PWAA 2NTDA 3FJKA 5BQUC 5F8SA 1HWMB 4HR6C 2DRYA 4TLPA 1TIEA 4USPA 4LO0C 1BARA 1EV2A 4MZFB 1JY0A 3IM6A 4ISQA 1HWNB 2Q9XA 3AH1A 3VT1A 4OWLA 4LO7C 4I8MA 3FJFA 3RMXA 4I4VA 2VXTI 2E4MC 3I2AA 41BIA 4WBCA 5F90A 2R9KB 4LO2C 4OUJA 1V6VA 1FN0A 4G6MA 4IYBA 1BFFA 4KC3A 1PZZA 2VUAA 3WINC 1JT4A 3D7WB 3V0AA 4FVVA 2MIBA 1M16A 3VWCA 4Z8SB 1TP0A 2Y9GA 1YTOA 3C9ZA 2GZBA 2LIEA 4I1EA 4R6UB 1BFCA 3CQAA 1JLYA 4QC4A 1ISVA 3FJJA 3HOMA 1EPWA 3RTJB 1I1BA 3FJ8A 3BAHA 3I2XA 4MZGB 1D0HA 3RMYA 2FO1A 4CJMA 3ZC9A 2DREA 4ISRA 3H6RA 1QXMA 3UD9A 4J2XA 1HCDA 5D62A 2K4AB 2YUGA 3OJ2A 3AH2A 3UJ0A 1IJTA 2HWMA 2MLLB 4L4HA 3S8JA 1ISXA 1Q03A 3F1RA 1Z4SA 3IM7A 3F62B 4ZOTA 2QN4A 4G9NA 5GAQA 4ZFWB 5DUYA 3N7JA 4X38A 3ZXGA 4I4RA 5BP5A 3FJ9A 4DENA 1FQ9A 3SNVA 1RZOB 3V0BA 2ZQOA 4IZEA 4OEGA 1QQLA 4DEPA 3I29B 1G9CA 3HBWA 4JRAA 4ENDA 1R8OA 1RY7A 4A7ZA 1S0BA 4ZA3B 2F2FA 3R4SA 1ISYA 1II4A 3NBNA 3A22A 4ZGRB 1JQZA 1V6XA 1T4QA 1IOBA 3JUTA 3ZXDA 2NYYA 4ZBVB 5FNWA 1JT3A 1XZZA 4IY8A 3BA4A 2IWTB 4X39A 3O4OA 1FV2A 6I1BA 4I1BA 4KEJA 2ERMA 3VT0A 4FGFA 4I4UA 1MC9A 3Q7XA 1AXMA 3UDAA 1V6UA 4AN6A 2AQZA 4I4YA 4Q9PA 4XKIA 1KNMA 3BRDA 1IRPA 2D7IA 5E24E 1JT5A 1ABRB 2BEBA 1SR4A 1ISZA 4L4IA 4UY4A 3AJ6A 1CE7B 3OJVA 1AVWB 4I4XA 1AVAC 1DLLA 1ILR1 1AVUA 5BXPA 2J3PA 2X2TA 1S0CA 1RMLA 4X3AA 1DJSB 4II0A 1SZ6B 3IAGC 3BX1C 1CVSA 3N0KA 4QD2C 4J2SA 1AVXB 2AFGA 3ILAA 3OBRA 4IONA 4J2KA 3CRIA 2D1ZA 1Z0HA 1WBCA 4D0ZA 3P6JA 2Y9WC 4QALA 1QQKA 4QO3A 4XFTA 2WBCA 4Q91A 3UJ4A 3BRGC 4Z9WB 4LO0A 4H9WA 3Q7YA 1YXWA 1NZKA 2WRYA 1IHKA 5FNXA 1XG6A 1ITBA 4ZLBB 3R4UA 2IHOA 3BAQA 4GOYA 3CRGA 4HA2A 3N7KA 5D61A 1N4KA 1T9FA 3H6QA 1R8NA 5FZYA 3BAOA 3AKFA 3BTAA 3FUOA 3FGMA 3V0AB 3BADA 3ZX7A 3LLPA 3BA5A 3MALA 3NBEA 1W3FA 4IZXA 3HMYA 4KEIA 1S0GA 2FFUA 4I4QA 3TC2A 2KI6B 4KEKA 4OEEA 1XHBA 3H6RB 1JLXA 1DQGA 5G00A 3O4AA 1Q04A 5DZUA 2FGFA 3IM5A 1TOOA 2NP0A 3H6SE 3VUOA 4G1RA 1FWUA 2P23A 3AKHA 4KBBA 1S0FA 5EC5A 3WO4A 1Q1UA 2P39A 2FDBM 5JMCA 4X37A 3N7MA 3PUBA 3HN1A 1TTUA 3BAUA 1GGPB 4GP0A 3WMVA 2NS2A 1UPSA 2DS0A 3FJHA 1J0SA 2ZQNA 5BP5C 3BA7A 3V0BB 4I7IA 4QKSA 3O5WB 3WO2A 3VSZA 1G9DA 3ZC8A 4GOVA 8I1BA 3LTQA 4LO3A 1TWEA 3CA4A 1BLAA 2I1BA 2RSTA 2ZR1B 2F2FC 4GAFA 1EVTA 1E0OA 3PG0A 1IRAX 3O4BA 2MC2A 1BASA 3O4DA 1HCEA 3JRRA 3RTIB 3VSFA 3OBTA 4D0TA 4PC4A 2D22A 4P0JA 1VCLA 1FMMS 4QBVA 2GO2A 3CRHA 2X2SA 2Z49A 3P53A 3B9UA 4GP3A 3HSMA 3BAGA 1JT7A 5HPZA 4A7YA 2VU9A 1SR4C 3O49A 3A23A 3OGFA 4G6JA 3PMEA 4LO1A 2F8XC 4EB2B 4P6AA 4A7KA 3AKIA 4ZKTB 3NBCA 1HWPB 3S8KA 1K5VA 1DQOA 2LIQA 2Y9XE 3FJBA 1TWMA 3AJ5A 4JQ0A 1YBIA 5BXSA 2BFHA 3WO3A 2Q3NB 1BFGA 1NUNA 4EFRA 2NM1A 5BQUA 3FJCA 3BRFA 4ZFUB 3POKA 3AKGA 3BAVA 4I6IA 1DZCA 2NVHA 3Q7WA 3O3QA 3O4CA 3A21A 1HWOB 1W3AA 2AXMA 3VEQA 2K8RA 1K5UA 3CA5A 4HJJA 2FFVA 4QBCA 4Q9GA 4USOA 1OQLB 1IT0A 2Z48A 3UD8A 2M49A 2E4MA 2VXRA 3WA1A 4LO7B 2D44A 2RQ9A 5B2HA 4H75A 1V6WA 5EHAA 3IIRA 4LO2A 3OGGA 1A8DA 1PC8B 1EYLA 1IILA 4IY9A 2KLLA 3MPPG 4EFQA 2VSAA 3QR5A 4XFSA 1G9BA 2D24A 3WINA 2XOAA 4OWKA 3PHZA 2D23A 1YYNA 2ET2A 2DRZA 4J23B 4EKXB 3E8LC 9ILBA 1FV3A 5DVHA 4EFPA 3CAHA 1S0DA 4JAWA 3CU1B 4I4PA 3FJDA 1AFCA 5JLVA 3WMUA 1AF9A 3NJ5A 1ISWA 4GAIA 5BXRA 1BFBA 3K1XA 4G9MA 3FJAA 3T8SA 1G9AA 4J2YA 4EEEB 4I2SA 1BA7A 1HIBA 4IHZA 3QYDA 2UUSA 2D7RA 5F8WA 3OJMA 2K43A 21BIA 4I96A 5FZZA 3CA6A 2VLCA 5EG6C 1DFQA 1DFCA 5F8YA 4I4OA 1TFMB 31BIA 5I1BA 2NZ9A 1I1EA 1WD3A 1DIWA 2RG9B 4IQPA 1F31A 3FUQA 1PUUB 4XFUA 5FZUA 1XYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JP0 A;  3HAL A;  1M2T B;  1BLD A;  4QKR A;  1HKN A;  2Y9F A;  2L5X A;  4LO8 B;  1PUM B;  4I0Y A;  1FWV A;  1S0L A;  2D43 A;  4LO3 C;  5BXT A;  3NBD A;  4H04 A;  3RSJ A;  3FJI A;  1JTC A;  1FGA A;  4F34 A;  1FMZ A;  1G82 A;  1MD6 A;  3P6I A;  5BOW A;  7I1B A;  4OEF A;  4DCK C;  2BEA A;  4OW4 A;  1DZD A;  1L2H A;  2HZ9 A;  4OWJ A;  3EF2 A;  4D8H A;  3CA0 A;  2VSE A;  3AZW A;  4F83 A;  4I4S A;  3FJE A;  2ESU A;  1P63 A;  2KH2 A;  2QYI B;  3AH4 A;  1Z2V A;  3VT2 A;  3FFZ A;  2HW9 A;  4ZFY B;  4JKQ A;  4JPZ A;  5BVP I;  1YF8 B;  1S0E A;  1W3G A;  3BB2 A;  3N7L A;  1ONK B;  4LO1 C;  3CA3 A;  3AZV A;  2KI4 A;  3O44 A;  4P0L A;  4AN7 B;  2AAI B;  3CA1 A;  4JKX B;  3UD7 A;  2D20 A;  4P0K A;  2HWA A;  5DSS B;  2KKI A;  1WBA A;  3KMV A;  5D63 A;  1WD4 A;  3W9T A;  3V79 C;  4QD2 B;  1RG8 A;  4I37 A;  4I3N A;  3A07 A;  4YOL A;  1PWA A;  2NTD A;  3FJK A;  5BQU C;  5F8S A;  1HWM B;  4HR6 C;  2DRY A;  4TLP A;  1TIE A;  4USP A;  4LO0 C;  1BAR A;  1EV2 A;  1JY0 A;  3IM6 A;  4ISQ A;  1HWN B;  2Q9X A;  3AH1 A;  3VT1 A;  4OWL A;  4LO7 C;  4I8M A;  3FJF A;  3RMX A;  4I4V A;  2VXT I;  2E4M C;  3I2A A;  41BI A;  4WBC A;  5F90 A;  2R9K B;  4LO2 C;  4OUJ A;  1V6V A;  1FN0 A;  4G6M A;  4IYB A;  1BFF A;  4KC3 A;  1PZZ A;  2VUA A;  3WIN C;  1JT4 A;  3D7W B;  3V0A A;  4FVV A;  2MIB A;  1M16 A;  3VWC A;  4Z8S B;  1TP0 A;  2Y9G A;  1YTO A;  3C9Z A;  2GZB A;  2LIE A;  4I1E A;  4R6U B;  1BFC A;  3CQA A;  1JLY A;  4QC4 A;  1ISV A;  3FJJ A;  3HOM A;  1EPW A;  3RTJ B;  1I1B A;  3FJ8 A;  3BAH A;  3I2X A;  3RMY A;  1D0H A;  2FO1 A;  4CJM A;  3ZC9 A;  2DRE A;  4ISR A;  3H6R A;  1QXM A;  3UD9 A;  4J2X A;  1HCD A;  5D62 A;  2K4A B;  2YUG A;  3OJ2 A;  3AH2 A;  3UJ0 A;  1IJT A;  2HWM A;  2MLL B;  4L4H A;  3S8J A;  1ISX A;  1Q03 A;  3F1R A;  1Z4S A;  3IM7 A;  3F62 B;  4ZOT A;  2QN4 A;  4G9N A;  5GAQ A;  4ZFW B;  5DUY A;  3N7J A;  4X38 A;  3ZXG A;  4I4R A;  5BP5 A;  3FJ9 A;  4DEN A;  1FQ9 A;  3SNV A;  1RZO B;  3V0B A;  2ZQO A;  4IZE A;  4OEG A;  1QQL A;  4DEP A;  3I29 B;  1G9C A;  3HBW A;  4JRA A;  4END A;  1R8O A;  1RY7 A;  4A7Z A;  1S0B A;  4ZA3 B;  2F2F A;  3R4S A;  1ISY A;  1II4 A;  3NBN A;  3A22 A;  4ZGR B;  1JQZ A;  1V6X A;  1T4Q A;  1IOB A;  3JUT A;  3ZXD A;  2NYY A;  4ZBV B;  5FNW A;  1JT3 A;  1XZZ A;  4IY8 A;  3BA4 A;  2IWT B;  4X39 A;  3O4O A;  1FV2 A;  6I1B A;  4I1B A;  4KEJ A;  2ERM A;  3VT0 A;  4FGF A;  4I4U A;  1MC9 A;  3Q7X A;  1AXM A;  3UDA A;  1V6U A;  4AN6 A;  2AQZ A;  4I4Y A;  4Q9P A;  4XKI A;  1KNM A;  3BRD A;  1IRP A;  2D7I A;  5E24 E;  1JT5 A;  1ABR B;  2BEB A;  1SR4 A;  1ISZ A;  4L4I A;  3AJ6 A;  1CE7 B;  3OJV A;  1AVW B;  4I4X A;  1AVA C;  1DLL A;  1ILR 1;  1AVU A;  5BXP A;  2J3P A;  2X2T A;  1S0C A;  1RML A;  4X3A A;  1DJS B;  4II0 A;  1SZ6 B;  3IAG C;  3BX1 C;  1CVS A;  3N0K A;  4QD2 C;  4J2S A;  1AVX B;  2AFG A;  3ILA A;  3OBR A;  4ION A;  4J2K A;  3CRI A;  2D1Z A;  1Z0H A;  1WBC A;  4D0Z A;  3P6J A;  2Y9W C;  4QAL A;  1QQK A;  4QO3 A;  4XFT A;  2WBC A;  4Q91 A;  3UJ4 A;  3BRG C;  4Z9W B;  4LO0 A;  4H9W A;  3Q7Y A;  1YXW A;  1NZK A;  2WRY A;  1IHK A;  5FNX A;  1XG6 A;  1ITB A;  4ZLB B;  3R4U A;  2IHO A;  3BAQ A;  4GOY A;  3CRG A;  4HA2 A;  3N7K A;  5D61 A;  1N4K A;  1T9F A;  3H6Q A;  1R8N A;  5FZY A;  3BAO A;  3AKF A;  3BTA A;  3FUO A;  3FGM A;  3V0A B;  3BAD A;  3ZX7 A;  3LLP A;  3BA5 A;  3MAL A;  3NBE A;  1W3F A;  4IZX A;  3HMY A;  4KEI A;  1S0G A;  2FFU A;  4I4Q A;  3TC2 A;  2KI6 B;  4KEK A;  4OEE A;  1XHB A;  3H6R B;  1JLX A;  1DQG A;  5G00 A;  3O4A A;  1Q04 A;  5DZU A;  2FGF A;  3IM5 A;  1TOO A;  2NP0 A;  3H6S E;  3VUO A;  4G1R A;  1FWU A;  2P23 A;  3AKH A;  4KBB A;  1S0F A;  5EC5 A;  3WO4 A;  1Q1U A;  2P39 A;  2FDB M;  5JMC A;  4X37 A;  3N7M A;  3PUB A;  3HN1 A;  1TTU A;  3BAU A;  1GGP B;  4GP0 A;  3WMV A;  1UPS A;  2DS0 A;  3FJH A;  1J0S A;  2ZQN A;  5BP5 C;  3BA7 A;  3V0B B;  4I7I A;  4QKS A;  3O5W B;  3WO2 A;  3VSZ A;  1G9D A;  3ZC8 A;  4GOV A;  8I1B A;  3LTQ A;  4LO3 A;  1TWE A;  3CA4 A;  1BLA A;  2I1B A;  2RST A;  2ZR1 B;  2F2F C;  4GAF A;  1EVT A;  1E0O A;  3PG0 A;  1IRA X;  3O4B A;  2MC2 A;  1BAS A;  3O4D A;  1HCE A;  3JRR A;  3RTI B;  3VSF A;  3OBT A;  4D0T A;  4PC4 A;  2D22 A;  4P0J A;  1VCL A;  1FMM S;  4QBV A;  2GO2 A;  3CRH A;  2X2S A;  2Z49 A;  3P53 A;  3B9U A;  4GP3 A;  3HSM A;  3BAG A;  1JT7 A;  5HPZ A;  4A7Y A;  2VU9 A;  1SR4 C;  3O49 A;  3A23 A;  3OGF A;  4G6J A;  3PME A;  4LO1 A;  2F8X C;  4EB2 B;  4P6A A;  4A7K A;  3AKI A;  4ZKT B;  3NBC A;  1HWP B;  3S8K A;  1K5V A;  1DQO A;  2LIQ A;  2Y9X E;  3FJB A;  1TWM A;  3AJ5 A;  4JQ0 A;  1YBI A;  5BXS A;  2BFH A;  3WO3 A;  2Q3N B;  1BFG A;  1NUN A;  4EFR A;  2NM1 A;  5BQU A;  3FJC A;  3BRF A;  4ZFU B;  3POK A;  3AKG A;  3BAV A;  4I6I A;  1DZC A;  2NVH A;  3Q7W A;  3O3Q A;  3O4C A;  3A21 A;  1HWO B;  1W3A A;  2AXM A;  3VEQ A;  2K8R A;  1K5U A;  3CA5 A;  4HJJ A;  2FFV A;  4QBC A;  4Q9G A;  4USO A;  1OQL B;  1IT0 A;  2Z48 A;  3UD8 A;  2M49 A;  2E4M A;  2VXR A;  3WA1 A;  4LO7 B;  2D44 A;  2RQ9 A;  5B2H A;  5EHA A;  1V6W A;  3IIR A;  4LO2 A;  3OGG A;  1A8D A;  1PC8 B;  1EYL A;  1IIL A;  4IY9 A;  2KLL A;  3MPP G;  4EFQ A;  2VSA A;  3QR5 A;  4XFS A;  1G9B A;  2D24 A;  3WIN A;  2XOA A;  4OWK A;  3PHZ A;  2D23 A;  1YYN A;  2ET2 A;  2DRZ A;  4J23 B;  4EKX B;  3E8L C;  9ILB A;  1FV3 A;  5DVH A;  4EFP A;  3CAH A;  1S0D A;  4JAW A;  3CU1 B;  4I4P A;  3FJD A;  1AFC A;  5JLV A;  3WMU A;  1AF9 A;  3NJ5 A;  1ISW A;  4GAI A;  5BXR A;  1BFB A;  3K1X A;  4G9M A;  3FJA A;  3T8S A;  1G9A A;  4J2Y A;  4EEE B;  4I2S A;  1BA7 A;  1HIB A;  4IHZ A;  3QYD A;  2UUS A;  2D7R A;  5F8W A;  3OJM A;  2K43 A;  21BI A;  4I96 A;  5FZZ A;  3CA6 A;  2VLC A;  5EG6 C;  1DFQ A;  1DFC A;  5F8Y A;  4I4O A;  1TFM B;  31BI A;  5I1B A;  2NZ9 A;  1I1E A;  1WD3 A;  1DIW A;  2RG9 B;  4IQP A;  1F31 A;  3FUQ A;  1PUU B;  4XFU A;  5FZU A;  1XYF A; 
#chains in the Genus database with same CATH topology
 4JP0 A;  3HAL A;  1M2T B;  1BLD A;  4QKR A;  1HKN A;  2Y9F A;  2L5X A;  4LO8 B;  1PUM B;  4I0Y A;  1FWV A;  1S0L A;  2D43 A;  4LO3 C;  5BXT A;  3NBD A;  4H04 A;  3RSJ A;  3FJI A;  1JTC A;  1FGA A;  4F34 A;  1FMZ A;  1G82 A;  1MD6 A;  3P6I A;  5BOW A;  7I1B A;  4OEF A;  4DCK C;  2BEA A;  4OW4 A;  1DZD A;  1L2H A;  2HZ9 A;  4OWJ A;  3EF2 A;  4D8H A;  3CA0 A;  2VSE A;  3AZW A;  4F83 A;  4I4S A;  3FJE A;  4MZH A;  2ESU A;  1P63 A;  2KH2 A;  2QYI B;  3AH4 A;  1Z2V A;  3VT2 A;  3FFZ A;  2HW9 A;  4ZFY B;  4JKQ A;  4JPZ A;  5BVP I;  1YF8 B;  1S0E A;  1W3G A;  3BB2 A;  3N7L A;  1ONK B;  4LO1 C;  3CA3 A;  3AZV A;  2KI4 A;  3O44 A;  4P0L A;  4AN7 B;  2AAI B;  3CA1 A;  4JKX B;  3UD7 A;  2D20 A;  4P0K A;  2HWA A;  5DSS B;  2KKI A;  1WBA A;  3KMV A;  5D63 A;  1WD4 A;  3W9T A;  3V79 C;  4QD2 B;  1RG8 A;  4I37 A;  4I3N A;  3A07 A;  4YOL A;  1PWA A;  2NTD A;  3FJK A;  5BQU C;  5F8S A;  1HWM B;  4HR6 C;  2DRY A;  4TLP A;  1TIE A;  4USP A;  4LO0 C;  1BAR A;  1EV2 A;  4MZF B;  1JY0 A;  3IM6 A;  4ISQ A;  1HWN B;  2Q9X A;  3AH1 A;  3VT1 A;  4OWL A;  4LO7 C;  4I8M A;  3FJF A;  3RMX A;  4I4V A;  2VXT I;  2E4M C;  3I2A A;  41BI A;  4WBC A;  5F90 A;  2R9K B;  4LO2 C;  4OUJ A;  1V6V A;  1FN0 A;  4G6M A;  4IYB A;  1BFF A;  4KC3 A;  1PZZ A;  2VUA A;  3WIN C;  1JT4 A;  3D7W B;  3V0A A;  4FVV A;  2MIB A;  1M16 A;  3VWC A;  4Z8S B;  1TP0 A;  2Y9G A;  1YTO A;  3C9Z A;  2GZB A;  2LIE A;  4I1E A;  4R6U B;  1BFC A;  3CQA A;  1JLY A;  4QC4 A;  1ISV A;  3FJJ A;  3HOM A;  1EPW A;  3RTJ B;  1I1B A;  3FJ8 A;  3BAH A;  3I2X A;  4MZG B;  1D0H A;  3RMY A;  2FO1 A;  4CJM A;  3ZC9 A;  2DRE A;  4ISR A;  3H6R A;  1QXM A;  3UD9 A;  4J2X A;  1HCD A;  5D62 A;  2K4A B;  2YUG A;  3OJ2 A;  3AH2 A;  3UJ0 A;  1IJT A;  2HWM A;  2MLL B;  4L4H A;  3S8J A;  1ISX A;  1Q03 A;  3F1R A;  1Z4S A;  3IM7 A;  3F62 B;  4ZOT A;  2QN4 A;  4G9N A;  5GAQ A;  4ZFW B;  5DUY A;  3N7J A;  4X38 A;  3ZXG A;  4I4R A;  5BP5 A;  3FJ9 A;  4DEN A;  1FQ9 A;  3SNV A;  1RZO B;  3V0B A;  2ZQO A;  4IZE A;  4OEG A;  1QQL A;  4DEP A;  3I29 B;  1G9C A;  3HBW A;  4JRA A;  4END A;  1R8O A;  1RY7 A;  4A7Z A;  1S0B A;  4ZA3 B;  2F2F A;  3R4S A;  1ISY A;  1II4 A;  3NBN A;  3A22 A;  4ZGR B;  1JQZ A;  1V6X A;  1T4Q A;  1IOB A;  3JUT A;  3ZXD A;  2NYY A;  4ZBV B;  5FNW A;  1JT3 A;  1XZZ A;  4IY8 A;  3BA4 A;  2IWT B;  4X39 A;  3O4O A;  1FV2 A;  6I1B A;  4I1B A;  4KEJ A;  2ERM A;  3VT0 A;  4FGF A;  4I4U A;  1MC9 A;  3Q7X A;  1AXM A;  3UDA A;  1V6U A;  4AN6 A;  2AQZ A;  4I4Y A;  4Q9P A;  4XKI A;  1KNM A;  3BRD A;  1IRP A;  2D7I A;  5E24 E;  1JT5 A;  1ABR B;  2BEB A;  1SR4 A;  1ISZ A;  4L4I A;  4UY4 A;  3AJ6 A;  1CE7 B;  3OJV A;  1AVW B;  4I4X A;  1AVA C;  1DLL A;  1ILR 1;  1AVU A;  5BXP A;  2J3P A;  2X2T A;  1S0C A;  1RML A;  4X3A A;  1DJS B;  4II0 A;  1SZ6 B;  3IAG C;  3BX1 C;  1CVS A;  3N0K A;  4QD2 C;  4J2S A;  1AVX B;  2AFG A;  3ILA A;  3OBR A;  4ION A;  4J2K A;  3CRI A;  2D1Z A;  1Z0H A;  1WBC A;  4D0Z A;  3P6J A;  2Y9W C;  4QAL A;  1QQK A;  4QO3 A;  4XFT A;  2WBC A;  4Q91 A;  3UJ4 A;  3BRG C;  4Z9W B;  4LO0 A;  4H9W A;  3Q7Y A;  1YXW A;  1NZK A;  2WRY A;  1IHK A;  5FNX A;  1XG6 A;  1ITB A;  4ZLB B;  3R4U A;  2IHO A;  3BAQ A;  4GOY A;  3CRG A;  4HA2 A;  3N7K A;  5D61 A;  1N4K A;  1T9F A;  3H6Q A;  1R8N A;  5FZY A;  3BAO A;  3AKF A;  3BTA A;  3FUO A;  3FGM A;  3V0A B;  3BAD A;  3ZX7 A;  3LLP A;  3BA5 A;  3MAL A;  3NBE A;  1W3F A;  4IZX A;  3HMY A;  4KEI A;  1S0G A;  2FFU A;  4I4Q A;  3TC2 A;  2KI6 B;  4KEK A;  4OEE A;  1XHB A;  3H6R B;  1JLX A;  1DQG A;  5G00 A;  3O4A A;  1Q04 A;  5DZU A;  2FGF A;  3IM5 A;  1TOO A;  2NP0 A;  3H6S E;  3VUO A;  4G1R A;  1FWU A;  2P23 A;  3AKH A;  4KBB A;  1S0F A;  5EC5 A;  3WO4 A;  1Q1U A;  2P39 A;  2FDB M;  5JMC A;  4X37 A;  3N7M A;  3PUB A;  3HN1 A;  1TTU A;  3BAU A;  1GGP B;  4GP0 A;  3WMV A;  2NS2 A;  1UPS A;  2DS0 A;  3FJH A;  1J0S A;  2ZQN A;  5BP5 C;  3BA7 A;  3V0B B;  4I7I A;  4QKS A;  3O5W B;  3WO2 A;  3VSZ A;  1G9D A;  3ZC8 A;  4GOV A;  8I1B A;  3LTQ A;  4LO3 A;  1TWE A;  3CA4 A;  1BLA A;  2I1B A;  2RST A;  2ZR1 B;  2F2F C;  4GAF A;  1EVT A;  1E0O A;  3PG0 A;  1IRA X;  3O4B A;  2MC2 A;  1BAS A;  3O4D A;  1HCE A;  3JRR A;  3RTI B;  3VSF A;  3OBT A;  4D0T A;  4PC4 A;  2D22 A;  4P0J A;  1VCL A;  1FMM S;  4QBV A;  2GO2 A;  3CRH A;  2X2S A;  2Z49 A;  3P53 A;  3B9U A;  4GP3 A;  3HSM A;  3BAG A;  1JT7 A;  5HPZ A;  4A7Y A;  2VU9 A;  1SR4 C;  3O49 A;  3A23 A;  3OGF A;  4G6J A;  3PME A;  4LO1 A;  2F8X C;  4EB2 B;  4P6A A;  4A7K A;  3AKI A;  4ZKT B;  3NBC A;  1HWP B;  3S8K A;  1K5V A;  1DQO A;  2LIQ A;  2Y9X E;  3FJB A;  1TWM A;  3AJ5 A;  4JQ0 A;  1YBI A;  5BXS A;  2BFH A;  3WO3 A;  2Q3N B;  1BFG A;  1NUN A;  4EFR A;  2NM1 A;  5BQU A;  3FJC A;  3BRF A;  4ZFU B;  3POK A;  3AKG A;  3BAV A;  4I6I A;  1DZC A;  2NVH A;  3Q7W A;  3O3Q A;  3O4C A;  3A21 A;  1HWO B;  1W3A A;  2AXM A;  3VEQ A;  2K8R A;  1K5U A;  3CA5 A;  4HJJ A;  2FFV A;  4QBC A;  4Q9G A;  4USO A;  1OQL B;  1IT0 A;  2Z48 A;  3UD8 A;  2M49 A;  2E4M A;  2VXR A;  3WA1 A;  4LO7 B;  2D44 A;  2RQ9 A;  5B2H A;  4H75 A;  1V6W A;  5EHA A;  3IIR A;  4LO2 A;  3OGG A;  1A8D A;  1PC8 B;  1EYL A;  1IIL A;  4IY9 A;  2KLL A;  3MPP G;  4EFQ A;  2VSA A;  3QR5 A;  4XFS A;  1G9B A;  2D24 A;  3WIN A;  2XOA A;  4OWK A;  3PHZ A;  2D23 A;  1YYN A;  2ET2 A;  2DRZ A;  4J23 B;  4EKX B;  3E8L C;  9ILB A;  1FV3 A;  5DVH A;  4EFP A;  3CAH A;  1S0D A;  4JAW A;  3CU1 B;  4I4P A;  3FJD A;  1AFC A;  5JLV A;  3WMU A;  1AF9 A;  3NJ5 A;  1ISW A;  4GAI A;  5BXR A;  1BFB A;  3K1X A;  4G9M A;  3FJA A;  3T8S A;  1G9A A;  4J2Y A;  4EEE B;  4I2S A;  1BA7 A;  1HIB A;  4IHZ A;  3QYD A;  2UUS A;  2D7R A;  5F8W A;  3OJM A;  2K43 A;  21BI A;  4I96 A;  5FZZ A;  3CA6 A;  2VLC A;  5EG6 C;  1DFQ A;  1DFC A;  5F8Y A;  4I4O A;  1TFM B;  31BI A;  5I1B A;  2NZ9 A;  1I1E A;  1WD3 A;  1DIW A;  2RG9 B;  4IQP A;  1F31 A;  3FUQ A;  1PUU B;  4XFU A;  5FZU A;  1XYF A; 
#chains in the Genus database with same CATH homology
 4JP0 A;  3HAL A;  1M2T B;  1BLD A;  4QKR A;  1HKN A;  2Y9F A;  2L5X A;  4LO8 B;  1PUM B;  4I0Y A;  1FWV A;  1S0L A;  2D43 A;  4LO3 C;  5BXT A;  3NBD A;  4H04 A;  3RSJ A;  3FJI A;  1JTC A;  1FGA A;  4F34 A;  1FMZ A;  1G82 A;  1MD6 A;  3P6I A;  5BOW A;  7I1B A;  4OEF A;  4DCK C;  2BEA A;  4OW4 A;  1DZD A;  1L2H A;  2HZ9 A;  4OWJ A;  3EF2 A;  4D8H A;  3CA0 A;  2VSE A;  3AZW A;  4F83 A;  4I4S A;  3FJE A;  4MZH A;  2ESU A;  1P63 A;  2KH2 A;  2QYI B;  3AH4 A;  1Z2V A;  3VT2 A;  3FFZ A;  2HW9 A;  4ZFY B;  4JKQ A;  4JPZ A;  5BVP I;  1YF8 B;  1S0E A;  1W3G A;  3BB2 A;  3N7L A;  1ONK B;  4LO1 C;  3CA3 A;  3AZV A;  2KI4 A;  3O44 A;  4P0L A;  4AN7 B;  2AAI B;  3CA1 A;  4JKX B;  3UD7 A;  2D20 A;  4P0K A;  2HWA A;  5DSS B;  2KKI A;  1WBA A;  3KMV A;  5D63 A;  1WD4 A;  3W9T A;  3V79 C;  4QD2 B;  1RG8 A;  4I37 A;  4I3N A;  3A07 A;  4YOL A;  1PWA A;  2NTD A;  3FJK A;  5BQU C;  5F8S A;  1HWM B;  4HR6 C;  2DRY A;  4TLP A;  1TIE A;  4USP A;  4LO0 C;  1BAR A;  1EV2 A;  4MZF B;  1JY0 A;  3IM6 A;  4ISQ A;  1HWN B;  2Q9X A;  3AH1 A;  3VT1 A;  4OWL A;  4LO7 C;  4I8M A;  3FJF A;  3RMX A;  4I4V A;  2VXT I;  2E4M C;  3I2A A;  41BI A;  4WBC A;  5F90 A;  2R9K B;  4LO2 C;  4OUJ A;  1V6V A;  1FN0 A;  4G6M A;  4IYB A;  1BFF A;  4KC3 A;  1PZZ A;  2VUA A;  3WIN C;  1JT4 A;  3D7W B;  3V0A A;  4FVV A;  2MIB A;  1M16 A;  3VWC A;  4Z8S B;  1TP0 A;  2Y9G A;  1YTO A;  3C9Z A;  2GZB A;  2LIE A;  4I1E A;  4R6U B;  1BFC A;  3CQA A;  1JLY A;  4QC4 A;  1ISV A;  3FJJ A;  3HOM A;  1EPW A;  3RTJ B;  1I1B A;  3FJ8 A;  3BAH A;  3I2X A;  4MZG B;  1D0H A;  3RMY A;  2FO1 A;  4CJM A;  3ZC9 A;  2DRE A;  4ISR A;  3H6R A;  1QXM A;  3UD9 A;  4J2X A;  1HCD A;  5D62 A;  2K4A B;  2YUG A;  3OJ2 A;  3AH2 A;  3UJ0 A;  1IJT A;  2HWM A;  2MLL B;  4L4H A;  3S8J A;  1ISX A;  1Q03 A;  3F1R A;  1Z4S A;  3IM7 A;  3F62 B;  4ZOT A;  2QN4 A;  4G9N A;  5GAQ A;  4ZFW B;  5DUY A;  3N7J A;  4X38 A;  3ZXG A;  4I4R A;  5BP5 A;  3FJ9 A;  4DEN A;  1FQ9 A;  3SNV A;  1RZO B;  3V0B A;  2ZQO A;  4IZE A;  4OEG A;  1QQL A;  4DEP A;  3I29 B;  1G9C A;  3HBW A;  4JRA A;  4END A;  1R8O A;  1RY7 A;  4A7Z A;  1S0B A;  4ZA3 B;  2F2F A;  3R4S A;  1ISY A;  1II4 A;  3NBN A;  3A22 A;  4ZGR B;  1JQZ A;  1V6X A;  1T4Q A;  1IOB A;  3JUT A;  3ZXD A;  2NYY A;  4ZBV B;  5FNW A;  1JT3 A;  1XZZ A;  4IY8 A;  3BA4 A;  2IWT B;  4X39 A;  3O4O A;  1FV2 A;  6I1B A;  4I1B A;  4KEJ A;  2ERM A;  3VT0 A;  4FGF A;  4I4U A;  1MC9 A;  3Q7X A;  1AXM A;  3UDA A;  1V6U A;  4AN6 A;  2AQZ A;  4I4Y A;  4Q9P A;  4XKI A;  1KNM A;  3BRD A;  1IRP A;  2D7I A;  5E24 E;  1JT5 A;  1ABR B;  2BEB A;  1SR4 A;  1ISZ A;  4L4I A;  4UY4 A;  3AJ6 A;  1CE7 B;  3OJV A;  1AVW B;  4I4X A;  1AVA C;  1DLL A;  1ILR 1;  1AVU A;  5BXP A;  2J3P A;  2X2T A;  1S0C A;  1RML A;  4X3A A;  1DJS B;  4II0 A;  1SZ6 B;  3IAG C;  3BX1 C;  1CVS A;  3N0K A;  4QD2 C;  4J2S A;  1AVX B;  2AFG A;  3ILA A;  3OBR A;  4ION A;  4J2K A;  3CRI A;  2D1Z A;  1Z0H A;  1WBC A;  4D0Z A;  3P6J A;  2Y9W C;  4QAL A;  1QQK A;  4QO3 A;  4XFT A;  2WBC A;  4Q91 A;  3UJ4 A;  3BRG C;  4Z9W B;  4LO0 A;  4H9W A;  3Q7Y A;  1YXW A;  1NZK A;  2WRY A;  1IHK A;  5FNX A;  1XG6 A;  1ITB A;  4ZLB B;  3R4U A;  2IHO A;  3BAQ A;  4GOY A;  3CRG A;  4HA2 A;  3N7K A;  5D61 A;  1N4K A;  1T9F A;  3H6Q A;  1R8N A;  5FZY A;  3BAO A;  3AKF A;  3BTA A;  3FUO A;  3FGM A;  3V0A B;  3BAD A;  3ZX7 A;  3LLP A;  3BA5 A;  3MAL A;  3NBE A;  1W3F A;  4IZX A;  3HMY A;  4KEI A;  1S0G A;  2FFU A;  4I4Q A;  3TC2 A;  2KI6 B;  4KEK A;  4OEE A;  1XHB A;  3H6R B;  1JLX A;  1DQG A;  5G00 A;  3O4A A;  1Q04 A;  5DZU A;  2FGF A;  3IM5 A;  1TOO A;  2NP0 A;  3H6S E;  3VUO A;  4G1R A;  1FWU A;  2P23 A;  3AKH A;  4KBB A;  1S0F A;  5EC5 A;  3WO4 A;  1Q1U A;  2P39 A;  2FDB M;  5JMC A;  4X37 A;  3N7M A;  3PUB A;  3HN1 A;  1TTU A;  3BAU A;  1GGP B;  4GP0 A;  3WMV A;  2NS2 A;  1UPS A;  2DS0 A;  3FJH A;  1J0S A;  2ZQN A;  5BP5 C;  3BA7 A;  3V0B B;  4I7I A;  4QKS A;  3O5W B;  3WO2 A;  3VSZ A;  1G9D A;  3ZC8 A;  4GOV A;  8I1B A;  3LTQ A;  4LO3 A;  1TWE A;  3CA4 A;  1BLA A;  2I1B A;  2RST A;  2ZR1 B;  2F2F C;  4GAF A;  1EVT A;  1E0O A;  3PG0 A;  1IRA X;  3O4B A;  2MC2 A;  1BAS A;  3O4D A;  1HCE A;  3JRR A;  3RTI B;  3VSF A;  3OBT A;  4D0T A;  4PC4 A;  2D22 A;  4P0J A;  1VCL A;  1FMM S;  4QBV A;  2GO2 A;  3CRH A;  2X2S A;  2Z49 A;  3P53 A;  3B9U A;  4GP3 A;  3HSM A;  3BAG A;  1JT7 A;  5HPZ A;  4A7Y A;  2VU9 A;  1SR4 C;  3O49 A;  3A23 A;  3OGF A;  4G6J A;  3PME A;  4LO1 A;  2F8X C;  4EB2 B;  4P6A A;  4A7K A;  3AKI A;  4ZKT B;  3NBC A;  1HWP B;  3S8K A;  1K5V A;  1DQO A;  2LIQ A;  2Y9X E;  3FJB A;  1TWM A;  3AJ5 A;  4JQ0 A;  1YBI A;  5BXS A;  2BFH A;  3WO3 A;  2Q3N B;  1BFG A;  1NUN A;  4EFR A;  2NM1 A;  5BQU A;  3FJC A;  3BRF A;  4ZFU B;  3POK A;  3AKG A;  3BAV A;  4I6I A;  1DZC A;  2NVH A;  3Q7W A;  3O3Q A;  3O4C A;  3A21 A;  1HWO B;  1W3A A;  2AXM A;  3VEQ A;  2K8R A;  1K5U A;  3CA5 A;  4HJJ A;  2FFV A;  4QBC A;  4Q9G A;  4USO A;  1OQL B;  1IT0 A;  2Z48 A;  3UD8 A;  2M49 A;  2E4M A;  2VXR A;  3WA1 A;  4LO7 B;  2D44 A;  2RQ9 A;  5B2H A;  4H75 A;  1V6W A;  5EHA A;  3IIR A;  4LO2 A;  3OGG A;  1A8D A;  1PC8 B;  1EYL A;  1IIL A;  4IY9 A;  2KLL A;  3MPP G;  4EFQ A;  2VSA A;  3QR5 A;  4XFS A;  1G9B A;  2D24 A;  3WIN A;  2XOA A;  4OWK A;  3PHZ A;  2D23 A;  1YYN A;  2ET2 A;  2DRZ A;  4J23 B;  4EKX B;  3E8L C;  9ILB A;  1FV3 A;  5DVH A;  4EFP A;  3CAH A;  1S0D A;  4JAW A;  3CU1 B;  4I4P A;  3FJD A;  1AFC A;  5JLV A;  3WMU A;  1AF9 A;  3NJ5 A;  1ISW A;  4GAI A;  5BXR A;  1BFB A;  3K1X A;  4G9M A;  3FJA A;  3T8S A;  1G9A A;  4J2Y A;  4EEE B;  4I2S A;  1BA7 A;  1HIB A;  4IHZ A;  3QYD A;  2UUS A;  2D7R A;  5F8W A;  3OJM A;  2K43 A;  21BI A;  4I96 A;  5FZZ A;  3CA6 A;  2VLC A;  5EG6 C;  1DFQ A;  1DFC A;  5F8Y A;  4I4O A;  1TFM B;  31BI A;  5I1B A;  2NZ9 A;  1I1E A;  1WD3 A;  1DIW A;  2RG9 B;  4IQP A;  1F31 A;  3FUQ A;  1PUU B;  4XFU A;  5FZU A;  1XYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...