3BA9A

Structural basis for inhbition of nad-dependent ligase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
313
structure length
313
Chain Sequence
b'PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
molecule tags Ligase
source organism Enterococcus faecalis
publication title Structural Basis for Inhbition of NAD-Dependent Ligase
rcsb
total genus 102
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3ba9A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3ba9A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3ba9A02
3NC0B 1N33B 4UCVA 4PZ6A 4X64B 5LMNB 4LF5B 4DV4B 1FJGB 4UCUA 4UCOA 1P16A 4JI3B 4JI7B 4PZ8A 4AQYB 3TY9A 4B3RB 2ZM6B 3TY5A 4LF6B 1IBLB 4UCRA 4LF8B 2UUBB 4CC5A 1I94B 4LF7B 4OX9B 4KHPB 1DGSA 4LH6A 1HNXB 2UXCB 3JSNA 3RTXA 3NBZB 4JI4B 5FPRA 2Q2UA 5DISC 5IWAB 4EEQA 4DUZB 4X65B 2HIXA 4JI6B 4K0KB 2CFMA 3GDEA 4X66B 2HVRA 4B3TB 5D1PA 1XMQB 4GKJB 3RR5A 3W5OA 4DV3B 3S24A 2UUCB 4LF9B 1CKNB 1XMOB 2UXDB 1XDNA 4UFZA 3OTOB 1HNZB 4LF4B 1CKOA 4DV6B 1ZAUA 4JV5B 1N32B 4NXNB 1TA8A 4UCSA 4LFBB 2UUAB 1X9NA 4DUYB 4JI5B 4TOIA 4YHHB 1S68A 2VUGA 2HIVA 1P8LA 4JI1B 1CKNA 1XNQB 5D1OA 2F4VB 4EQ5A 1N34B 1B04A 1TAEA 4LFCB 3JSLA 3BA8A 4DR5B 3BABA 3GJXB 2Q2TA 4DR3B 4YY3B 2E5LB 4GLXA 1FVIA 4DV0B 1J5EB 4B3MB 4LFAB 4B3SB 4JYAB 2VQFB 4DV5B 2UU9B 2UXBB 4DR4B 2VQEB 5D1OB 4UCTA 2OWOA 4PZ7A 4DV7B 1XK5A 2HHHB 4DRFA 4NXMB 3T1YB 4JI2B 1CKMA 3TY8A 5FPOA 1A0IA 3SGIA 3W1GA 4X62B 4GKKB 4JI8B 5LMUB 3UQ8A 4JI0B 4CC6A 1IBKB 3NBYB 5BR8B 3GB8B 3KYHC 4DR2B 1N36B 3VNNA 4EFEA 1HR0B 1XNRB 1HNWB 4DR1B 1VS0A 1V9PA 3T1HB 4E6NA 4DR7B 1IBMB 3L2PA 3PN1A 3BAAA 4DR6B 4DV1B 3QWUA 3W1BA 2HVSA 4EFBA 4LH7A 3BA9A 4DV2B 2HVQA
chains in the Genus database with same CATH superfamily
1N33B 4UCVA 5FJ8G 1FJGB 1K5SA 2R93G 1E4EB 1FD9A 1WPXA 2LW7A 4JI7B 2ZM6O 2ZM6B 4MTXA 2UUAH 2ZE5A 2P5OA 3CE2A 5H5NA 3K5HA 4Q4DA 5BWVA 5IYCO 5KFDA 3JAMN 3N40P 3HB3B 3QVNA 1FFXA 3MR3A 4IRDA 1JIHA 3RYIA 3C90A 3VMMA 2UXCB 2ZE7A 4MS2A 3JSNA 2F43G 2UXCO 2DPJA 5CN0A 5LOVA 2JA5A 3ABMB 1E1RG 4MTEA 2RNBA 2EULA 5IWAH 2UXXA 4KHPH 3AK1A 2XGPA 4BY7G 4WBNA 4ED6A 3VQVA 4K0KB 3KZIZ 2COIA 4X1KB 3TGUH 4YAKB 2BE3A 3EYYA 4FGRA 3TXQA 4UVCA 2J6TA 3ETEA 1XDNA 4FFKA 3K04A 5E79Z 5A9GA 3RUPA 1EBOA 2HG5C 2D2CB 1K4DC 3F5TA 1VAJA 4E4EA 3PJSK 4O3PA 3T5JA 2CW8A 5BR8H 4J10A 3JARA 3ZIAG 4Z1MG 2ZIMA 3BCCH 3UM7A 4DR3O 4LFBH 4NXNO 3MDSA 4JTDB 2UVUA 2DAAA 3K03A 1TAEA 2UUBH 3L73H 2C2RA 3JZIA 1SFOA 4LMYA 4EG0A 5KFPA 4MTDA 2ETNA 3CX5F 3PO3G 1N0NA 4JGSA 3UZOA 1T94A 2R87A 2GTSA 2E76B 1ET0A 1V54C 3ASNC 2W7OA 3APOA 2QM4A 4X66O 4O2BB 2W6PA 5J2TF 1M6VA 3T4DA 2AW9A 2HG8A 3ASOB 4RQFA 5EIBD 3GIMA 2X6AA 5F2VO 2YXHA 4AILC 4TV9F 1A0IA 1R3JC 3K79A 4HQ6A 1WA8A 1TWAA 2QR4A 2R8GA 1HP8A 1JFFB 1F51A 1BSMA 1EKVA 4I7ZB 4O4HB 1QNMA 2R82A 2DLNA 1M0WA 4TQRA 1TUEB 5LYJF 1TWHA 2GUZA 1JA8A 1N36O 2W6MA 4ED3A 1XNRB 3JD4A 3UCSC 1HNWB 4ECQA 3V6KA 3BY6A 4DR7O 2Q7GA 1WJZA 1FXKB 2HHFB 3RVYA 4U3JA 3Q8PB 5LMNO 1IX9A 4I50B 3KHRA 3FAVA 2E3CA 4FVMA 1SA0B 5AG2A 5DG8A 1S97A 4X64B 5KG7A 2IH1C 4DR2H 5KFJA 1SQBH 3SR2C 1H2MA 1JX4A 4FLTA 3NGDA 3D36C 4YIOA 3SJAC 5L1IA 1XNQO 1GKFA 4DV0O 5IYZA 3RWRD 1R3LC 4CKCA 3A2FA 4YJ2A 4X1IB 4I4TF 3JCUZ 3C0FB 1BQZA 5L1KA 1N56A 4JI4B 4C5CA 4A2AA 1VF6A 2LQTA 1XMQH 1IZ3A 3A0RA 3DGEA 3CRCA 3BQ2A 2N74A 1GTOA 3R66A 5D1PA 3EHBB 1DV2A 1R3IC 1W93A 3RJ0A 4Q8FA 2BOBC 5C44G 1FPOA 5BMVF 1VIBA 4DV3B 2VQDA 2RDIA 4O7LA 3T9AA 4TM5A 4MW8A 1XMOO 4UFZA 1SQPH 1QVFU 2CKZB 2OIEA 3CCRV 5IJ9A 3JZ6A 3B8NA 2FKXA 2R9IA 1W0KG 4JYYA 4O7TA 4FK5C 3Q8RB 4UB6Z 4F6RA 4O4LF 4B3TH 1I5XA 1KUQA 3V6HA 1KJ9A 1L1FA 4J7KA 4QWCA 5I5TA 3DSQA 4X65H 3E86A 5KT3A 3NUAA 3OMAB 4NXMH 4I50F 2ZE8A 1RM1C 1D5AA 3ZMTA 1NJIW 4JYAO 3AG2C 3OEHG 5F9LA 1Q6IA 2IU3A 1E79G 1NZ6A 1AROP 4FMTA 4QW9A 3K9AA 1KJIA 5BWWA 4FBUA 1MOFA 4RB0A 4DIMA 1BT8A 3E8HA 4ED8A 1QR9A 1JKJB 1Y14B 4X1IA 1WCMG 1JOYA 2R7MA 2JEJA 3CEBA 1S76D 2OWOA 3ABTA 3GTOA 4DV7B 2B9ZA 2E2HA 5EWFA 1BXRA 1JVMA 4EYHB 5LGNA 4GKKO 3V4SA 4NZMA 5JH7F 4O7VA 3UQ8A 3N41B 4ED0A 2Z0AA 3LDCA 3JZFA 5EBMC 1N8RW 5EC1C 3ZMUA 4EB6B 1HW7A 1HR0B 4YBZB 4TV9A 4DK0A 1PL4A 4OX9H 4ZI7A 5LOVB 1Q82W 1A0GA 4FJCC 1V55C 3VPBA 3KKYA 4G27B 4JAAA 5IYZF 1Q8IA 1Z2NX 2O03A 2EINB 3T7AA 4O3QA 1GSOA 2Q69A 2ZCEA 2VS0A 3CCMV 2YCHA 4B3MH 3E8BA 2AZ2A 4UCUA 3DAAA 3RB3A 1KBHA 1XNQH 4NKGB 1K8AW 4DL5A 2PI4A 2EINC 4ASUG 4CC5A 2Y4UA 4FLVA 3T54A 4JZGA 2OCCB 5IE9A 3FYEB 1RPOA 2YW2A 4KHPO 5CA1A 5H2FZ 5KG5A 3D3QA 1Z2GA 3PW5A 1BE3H 5BPFA 4NZOA 4CBCA 3CPWU 2HGWA 2R6FA 4QWAA 4ZOLB 3CD6V 5K2MA 2JK5C 3BACA 1S5HC 2YICA 3K5IA 1Y1VA 2CFMA 3W7UA 2W6IG 1AN7A 2GDSA 4MV4A 3GIPA 4JV1A 2JEUA 3DC5A 5B1BC 1PX2A 3QO5A 2IH3C 1HNXH 1N32B 2W7PA 3TIIA 4DV6O 4OGQB 2X7RB 2CZGA 2Z5UA 2JA5G 3CP1A 1K7DA 2XNDG 3E35A 5KT5A 1AI7A 5JH7A 3UFXB 4KP4A 4O2AB 3UZBA 2B1GA 2O57A 5E1AC 3DTGA 5BYBA 4O86A 1I0HA 1SKVA 2R9RB 3QZ7A 3J7AK 2XCLA 4B3MO 3IAYA 1KUTA 4P2ZA 1VKZA 3SYAA 1V4YA 5KT4A 1QVGU 2Q7EA 5LGUA 3CSXA 1PP9H 1FVIA 4F4WA 1M56C 2BSKA 2K9PA 3BEHA 1VBGA 5KFEA 2W8KA 2CE4A 3AG1B 2C35B 4O4HF 2VQFB 2J9GA 5L3EA 2YYAA 2AU0A 4B3TO 2UXBB 3RYIB 2CGNA 3A0HZ 4FLXA 1MNGA 2ASJA 5IWAO 4G2KA 4CH4A 1S0VA 3ORRA 5KG3A 3TY8A 1YCIA 4W4KA 2DN9A 3N6RA 4YJ3B 3ABMC 4QWBA 1P7BA 1IOVA 1M93A 2PMZE 3HKZA 2Q0AA 5CB4A 4D6TH 3LP8A 3U9SA 1GM8A 1FS0G 5DLGA 3RYCA 4CS3A 4A3GG 1S0MA 2JDIG 2IW5A 4IIJF 5BWTA 4GUNA 4X89A 5BMVA 3T1YH 4GX1A 1KJJA 2PMZA 3LMLA 3BA9A 3SYCA 4PA9A 3ZHUA 2FL4A 1AJNA 4TT3G 3E89A 1DLBA 3ABLC 4TQDA 4J0MA 2Y0IA 5KT2A 5BPHA 3OSPA 3T5LA 5KHHA 5J2UF 4O2AF 1BS3A 1HNWH 3C3SA 1WP7A 4BR6A 4UCRA 1GGOA 4JF3A 2Y4RA 5B5EZ 4FFMA 2HHHO 4JPRA 1MSWD 1FJGO 3GTJA 3BHPA 4J9PA 4EEYA 3OHBA 2R7KA 1PD3A 2ZDGA 1K83A 1JJ2U 5DG9A 4DV2H 3MHHC 3WNZA 2XGQA 4I55B 1DV1A 5KFXA 2NR5A 5B3SB 3J81N 2Q0OC 4DXWA 1KQSU 3GQCA 1D2DA 1XMQB 3E8FA 3M8AA 1C30A 2HP8A 1YJNV 3W5OA 3FKSG 3JAMW 4HN2A 1ZHQA 1NU1H 4UVBA 3T4ZA 5C4XG 4YJ3F 2OCHA 4HNTA 4DV4H 4BY1G 3KAKA 4MVQA 2XAJA 1G4YB 4JI3O 1AR4A 4I0XA 5CBGA 2R7ZG 2CTRA 2UU9H 1Y66A 2R8JA 4QIWF 4A5UB 3GV8B 1Z5WA 1UNNC 1K4CC 4EQ5A 2IA6A 3HR0A 5ITZB 1FAFA 5KFYA 1I7NA 1U96A 2YL2A 4TUYA 5CB4B 2V7QG 1X4TA 3G6YA 4FIPC 4MV9A 2F66C 5B1AB 1RYSA 4MTGA 2FK1A 3HKCB 3OMIB 4DRFA 5F9NA 3AK2A 4NXMB 4J9OA 2DZDA 4UUGA 5DQIA 3W1GA 1MMMA 3RV4A 4DR5H 1A32A 3U9TA 1S0OA 3SYPA 1SC5B 2IM9A 4LWSA 5EIBC 1RM1B 1SCUB 2Y0SE 4L8JA 5LYJA 4K35A 2YI9A 1I7LA 4ZOLA 3CYOA 3JASA 4DR7B 1KJ8A 3LDEA 2P06A 1IVSA 3CS5A 4FLUA 1JDEA 4DR6H 1CP9A 3OD4A 2Y69B 4J9ZB 1GM7A 4HBNA 2GSMB 3DTUB 4RQEA 2PYLA 1NR7A 5I5UA 2WLIB 2UUBO 3F8NA 3GIKA 4O2AA 3C3TA 1FKAH 2B63A 2CTWA 1OBDA 4LF5B 3DXRB 1VQNV 3CRQA 4DR3H 1URFA 1M57B 1WB8A 3U10A 4C7UA 2Q9LA 4QJFB 2YS6A 4NTWA 5CA0A 2IJHA 2E5LO 1MZBA 4A3BG 4F50A 3KG2A 3QTCA 4FFBA 3TQ1A 5KUKA 3I56V 1XMOH 2N04A 2DPIA 2VA3A 2ZNJA 3CHXA 1K1QA 2R70A 4B08A 4IZOA 3HKZE 1AUVA 3MFIA 2YEVB 3UYYA 3SPJA 4EEQA 2HKOA 3ETHA 3PR4A 3APQA 2DWEC 3FB7C 2UUCO 3STLC 4KL1A 2P0AA 2EILB 5LA6B 4FFPA 1PPJH 1JPXA 2JJ1G 3BFRA 3RR5A 2EBOA 2BTQB 2JIZG 4JV0A 4ZI7F 3D3IA 1B6QA 4R7CA 3RGZA 1VP7A 2P6JA 2CW7A 3H1KH 3CJHB 1I50A 2I80A 3HOWG 2KG7B 4J41A 2BOCC 4N23A 2ZGIA 1J5EH 2UUAB 4ZIBA 4EGQA 5KX5F 3GTLA 2UXBH 1F7YA 2ZIOA 4A2BA 4A93G 1KJQA 3CSWA 5EDWA 1MABG 2YC0A 3FFQA 4Q8EA 3B77A 4LFCO 4LFCB 3BA8A 1ZSPA 4RUFA 5JVDF 2L35A 4G28B 2Q5ZA 1N33O 1T3NA 2DMXA 2XASA 5T14A 5L1JA 2YRXA 2QEXV 4ECZA 3HOXG 1MSDA 4JYAB 1U97A 1GAXA 4O7SA 1ZHSA 1L0LH 2J6UA 4P9OA 4W4LA 5KT6A 4DR2O 1XL4A 2R86A 2WTFA 4IIJB 3T9EA 2LO1A 4FM0A 3OTOO 4GKKH 2D3OW 2GBOA 4JI0B 1IBKB 3L9DA 4BBRG 4DV7O 2IMWP 4O83A 2VPSA 3G8CA 3LSQA 2RDJA 2VQFH 3WWJA 4PBCA 3T1HO 3T1HB 4X20A 5CA1F 3GWOA 3PO2G 4K6NA 4N21A 4ZI7B 4DR6B 4DV3H 4L1KA 5L1LA 3ML0A 4DV2B 1EN4A 4BWSC 3IC9A 3RGXA 4EYIB 4NXNH 5IYDG 4DQNA 3R5XA 2QE7G 4PWQA 2WLJA 4QGPA 1GN6A 1Y76A 4JI3B 2NU6B 5KX5B 4I55F 5TISZ 2K1EA 3JALA 4LF8B 5L3CA 1I94O 1NVPD 3VOUA 3EFFK 2CAZC 3ABKC 5C1OA 5JQGA 2R7ZA 5I5YA 1GO3F 2FB9A 4PJ0Z 2EIKB 4A3JG 2KQXA 5JVDB 3NBZB 2WDTA 3RYFB 3WB2A 3RYHA 1JX9A 2Y0SA 4GYCB 3H01A 4HZ3A 4X65B 3AEIA 3L74H 3RYHB 1WCMA 2G38A 4JAUA 3T1HH 4X66B 2MCTA 1VQ9V 5JQGB 1B33N 3CCQV 3X2QB 3ZN0A 1KB9F 3LDDA 5B1OA 2EX3A 4XYMB 5FR9A 3S24A 3M9NB 4A3MG 1L8DA 4LF4H 4F6RB 5I5XA 4FLYA 2W6OA 4DW1A 3BG5A 2V58A 2JS5A 4HNVA 2CH7B 2IJIA 3AW8A 3AG4B 4OXSA 2WB1E 3K3WA 4DO2A 4QPKA 2QTSA 3SYQA 5KHGA 4JI1B 4ECSA 4HAMA 1SETA 5BYAA 4Q44A 2QM8A 3CCUV 2FPPB 1RJRA 5B3SC 5KT7A 2R72A 2FLPA 5I5SA 1US6A 2YXLA 4P30A 3RAQA 1PK8A 3JSLA 1FXKA 2DABA 2OYQA 3AG4C 5C8YA 4FFRA 1K3EA 1NH2D 5CE8A 2QKCA 4LFAB 3PW2A 4JI6O 2X6BA 3P3PA 3SJCC 3RN4A 2LGQA 2VQEB 2YDEA 4PZ7A 2EJ0A 4NTYA 5K1PA 2YZNA 3JRXA 2FPIB 1KKDA 4IRCA 1N48A 3O9OA 2QTOA 4X62B 5CR5A 4JI8O 1RYRA 1WLEA 2ABJA 4Q20A 2DYSB 3Q8SB 4KFMA 1JXLA 3FX7A 3AX6A 2QKAA 5DGIA 3M7MX 1YF2A 1XILA 3WU2Z 1HNWO 1T36A 2M6YA 2L6LA 1Y67A 3G80A 1I6UA 1XEQA 1GYFA 5JQGF 4Q4CA 4JI2H 1SQGA 5J9PC 1H2LA 4IWYA 2HVSA 1KMIZ 2Q6AA 1SRYA 5LHHA 4PDVA 3OR7C 4JI0H 1W2BU 1OV9A 3JARB 2AGOA 4JI7H 2PUSA 3T2MA 1TUBA 2H8PC 4IYIA 4ZHQB 2DQ0A 2KG7A 5BWUA 4AYBA 4A3EG 4O2BF 3TY5A 4LF6B 3U55A 1NVPB 4EKWA 2FYUH 1QCEA 2E75B 2M05A 5IT9W 4YY3O 1VQ6V 1S77D 4O2BA 2RN9A 3ZMVA 4JI4O 4FFLA 3ZBHA 3NR7A 5KUMA 4GX2A 5LHGA 4RCNA 1XHXA 3BQ1A 5LYJB 4J11A 4DL7A 4CMFA 4ABMA 3G6BA 3H1IH 1JMKC 5I60A 5DQHA 2VOBA 4FLWA 3F5WC 3AG2B 1FXVA 2XCPA 2IP4A 2GQSA 3I4MG 4YR2A 1XMOB 1M57C 1AJPA 1YTFB 3OTOB 2UXDO 3L71H 2LW1A 4DL3A 4RAYA 2DW4A 3WO1A 4O4HA 1R9TA 4YP3A 1T5EA 3K06A 4DL2A 3VQWA 2WWWA 3SPGA 4CMDA 4B7EA 3EPGA 1HR0O 4O4IA 3QO8A 4RUAA 1CKNA 1Q6UA 2XHBA 1K34A 5IJ0A 1GO3E 1LNQA 1N34B 1WRVA 2Y69C 4HNAA 4JI7O 1Z2OX 5D5PA 1TWCA 3N27A 4I4TB 5LA6A 3HT5A 3ZHSA 1OCZB 2EZOA 3PFFA 2VPQA 4ZHQF 1O75A 1I2KA 1R6NA 3G71V 3TW7A 5LP6C 5KLVH 2OTJV 3CCEV 3GV5B 2EJ2A 1G6UA 1V55B 3P3NA 4PA7A 1FFXB 1AILA 3GIQA 4TV8A 5KHKA 2KSWA 1PNMA 5KFZA 1I08A 3QZ8A 2CNVA 2V4RA 3TXSA 1LR1A 4DV6H 3SGIA 5LMUB 1YITV 3R65A 3LUTB 2W8LA 4J9LA 4MV3A 4X9QA 4TWKA 2XAHA 2XUMA 1XREA 4O4LB 2W9BA 3FMAA 5EYPB 4JI6H 1C3OA 1WNSA 4BWAA 4O4JF 2RJZA 3E8GA 2Q68A 3KCXA 5GTHZ 4R8UA 2YIDA 1AP6A 3JATB 1R3KC 1H38A 4EFBA 2A0LA 5DGHA 3H9VA 2JA7G 3HOZG 1PNKA 2DWDC 3ORQA 2DYRB 3A8TA 3H40A 3ZRVA 1YIJV 1KT8A 2RF4A 4ECXA 2NNUA 4JV5H 1I1LA 1I1KA 1I94H 1P16A 3RGBA 5EZYA 2LP7A 1H2SB 3TY9A 4LF6H 1H2GA 2QK4A 1I7FA 2Q7HA 2WA4A 2PI5A 1AI6A 3HKCA 3CC7V 5FNVB 4OPAA 4NYEA 3ABKB 5GW7A 4WFAV 3FB5C 3DXRA 3HKBA 1D5NA 4XYLB 3WFVA 4X8AA 4BBSG 4TUYB 1R6TA 2WPDG 1AB3A 4JI6B 4K0KH 1RPRA 1P49A 2JRIA 4R50A 1R6KA 4NYKA 3TCUA 2IBKA 2VQEO 4ECYA 1HDJA 1ZTEA 5BR8O 5KMGA 3GVMA 3KCYA 2KB1A 2ASLA 1XNRO 5KG4A 1HNZH 3RFRA 1TVKA 3AG1C 5KFWA 2W0XA 4DV3O 1X9NA 1ENVA 3T99A 5EC2C 1CQIB 1VQ7V 3RBDA 4MVOA 1VBHA 2RGRA 5LP6A 1KTAA 4C5AA 2WLNA 3UT5B 3Q4HA 4JYCA 4HNAB 2A7WA 5KFRA 5B1NA 5H6RA 4CKEA 1RP3B 2PGGA 4Y8VB 2WLKA 2R8HA 3PZPA 5IYDO 2JEXA 4O4LA 4J9SA 2YI8A 1OCCC 3K3VA 1SQFA 1A48A 2XC9A 5B66Z 1YVWA 3Q4HB 4Q45A 2ZM6H 3JRWA 4A3CG 2JJ2G 1W96A 5IT9N 5JVLA 4YIPA 1MG1A 2XT9A 4DLKA 2A1HA 2QF7A 2UXNA 4PDLA 4PELA 4ZQIA 3NBYB 2PBZA 4DV0H 1KYOF 1S10A 1KECA 2LGWA 3LQSA 3QG5A 5E25A 3JAWA 4IHJB 1AI5A 2HR3A 4E6NA 2ILMA 5EWGA 1IBMB 3K5OA 3L2PA 4F4YA 2B63G 3AG3B 2YWVA 2YIBA 5HFMA 3CMEV 4QW8A 3I4NG 4AQYO 3OFNG 3WO0A 4J9QA 2PYJA 1Q43A 4FM1A 2EIMC 5IYBO 3VQYA 3RB0A 2JGDA 2JVDA 4JI1H 2HJWA 5KFFA 1N34O 1PV0A 2F23A 4B3RB 4JI5H 3N2GA 4EBCA 2Q4PA 3G8DA 3R23A 2V1DA 1JLLB 5HFLA 3J80W 4RNOA 2FMLA 4O81A 3GWKC 1KP3A 1HNXB 2ZDQA 1SERA 1Q6HA 4DUZH 3T5KA 3PW0A 4WD3A 2Q2UA 1RSOB 1K1SA 2VQEH 3O65A 3UKMA 4GT1A 4MVSA 3CCSV 4RU9A 3MD0A 3LNMB 1AUXA 4I9QA 3K9SA 3N8DA 2PVPA 4DV1H 5DLFA 2IBZH 4O7NA 4R8UB 3J80N 2W9BB 3JD1A 4IYHA 4AHCA 4MA0A 3GTGA 3GTPA 2GQRA 3HXLA 4WFHA 4PHZA 2WLMA 5HV6A 4DR1H 4IAJA 4QPJA 1TUBB 5B1AC 4MV8A 2VUGA 5A2QW 1AVMA 2CTPA 2UVVA 3GB7C 4LF8O 4XBFA 5DGBA 4YAJB 2NVYA 1BCCH 2XTAA 1VQ8V 3NXSA 4F4ZA 2ATLA 3OT7A 5IYCG 1ROPA 4RUEA 4CKBA 1DK1A 3GJXB 4TV9B 1LUVA 4P9PA 1UFIA 3SE7A 1JDBB 1SQVH 2QWOB 2R8KA 1WB7A 2A9HA 1AR5A 1CXZB 4ME6A 1EFRG 3GILA 4A3FG 5JCOA 1EZVH 4YB8B 3VA7A 4JI3H 4UCTA 1XK5A 1UPGA 4E4TA 4DUZO 3OAAG 1N4CA 3FKIG 4O4JB 4J80A 1GH6A 3OUFA 3RBEA 3V4ZA 3IN5A 1K73W 3Q8QB 3LWBA 2GTAA 2JA6G 5BR8B 1H8HG 5JQWA 5BWRA 1E1QG 2W57A 4JTAB 3TIGA 1Y74B 1VF6C 1BJTA 1V9PA 1OCZC 2YZLA 3CWBH 2WE6A 1LUWA 3N44B 2ZQMA 3BAAA 2GV9A 5FLMG 4YJ2B 2UVWA 5B1BB 3ZMSA 5L3FA 1Q86W 5L3BA 2HVQA 3NC0B 3K5LA 4MVZA 3L72H 2PN1A 4LF5H 3SYOA 1L0NH 4TUYF 3H4BA 4CHIA 3JD2A 2OT5A 3R9RA 1M5IA 2PF4E 4Q43A 1I3QA 4YQWA 1VQMV 4O82A 3PW7A 1SF9A 3GIJA 1DGSA 1RFYA 4I50A 4ED1A 2UXDH 3MAQA 3AYHB 3LSSA 3RTXA 4DL6A 3T9FA 5IWAB 4GLWA 3VPCA 5LMNH 4QSHA 4LF9O 2HIXA 2WYOA 2ZT9B 1S5LZ 3SPHA 1BGYH 2HVRA 3CXHF 5L3GA 3HKDB 3OUSA 2MW2B 1GN2A 2CNQA 4IIJA 4O4JA 4UXNA 1EYZA 1NBMG 2ODTX 2W70A 3GV7B 3ZHVA 5IP7G 1MZFA 1CKOA 4LFAH 3I55V 4QNHB 5JWPA 2EIYA 3G6VA 4UCSA 4BIUA 4QE7A 5IYBG 2A79B 2Z04A 3ETJA 4DAAA 4C5BA 1PNLA 4TOIA 3Q2OA 3PR5B 4JTCB 5HBRB 4YJ2F 4GX0A 5DECA 4GC6A 3JCZA 5J2UA 4O84A 5KFIA 2NLJC 4MTOA 4X20B 4RWUA 4JI4H 1RK6A 1GSAA 2Q2TA 1Y74A 4TQFA 1EN5A 5C8YB 1VQ4V 2VRZA 1EKPA 3L4JA 4LF7O 1VQOV 1NQTA 5KFNA 5JVDA 4ECTA 4J7ZA 1KBLA 4DV5O 5LA6F 2UU9B 5EWEA 4DR4B 3CCJV 1XMQO 2LFSA 5LL6Y 4MV6A 5FLXN 4RO2A 1F23A 4IHJF 1QLNA 3T1YB 3T9CA 1OCOB 3UO2A 2FLLA 4HYOA 2NU7B 3WWIA 4GKKB 5FD5A 4JI0O 3X2QC 1BQ0A 4JV2A 3GB8B 2DOSA 5LXTF 4DR6O 2HVKC 4M0JA 5H80A 4G3IA 3ZRSA 2AZ0A 1OCOC 2Y0PA 2P90A 4JV5O 1Y6XA 3TEKA 1EZJA 2GLTA 3KALA 5DMXA 4FE2A 2WLLB 4I5SA 1YTFD 3ZRWA 3MR2A 2BQRA 1ORQC 2BCCH 5I47A 2Y48A 1QLEB 1Q90D 4LFCH 4J9MA 3N2GB 2QKSA 3U0ZA 2F4VO 3IG0A 1YEWA 1FYJA 1PKXA 5LOVF 2VWJA 4YHHH 4L87A 3KXYT 4O3SA 1IBLO 5IYZB 2AQ4A 4MA5A 1SEIA 4Z1VA 4LF5O 3QFFA 1DIKA 3JALB 2QA4V 4DV4O 4OX9B 5KFHA 2W6ZA 4O4IF 5I5VA 3QF7A 4KHPB 4I7HA 2PY5A 4EBDA 5LMUO 1K33A 1GMGA 5CM0A 4X88A 4A3KG 1S9FA 4DYLA 4IR9A 2Q7DA 4DR7H 3OSNA 2F95B 1XL6A 5KFOA 2QWRB 2NN4A 2V4QA 4DUZB 1YDXA 2YEVA 4O3OA 3MR5A 1KD1W 1MA1A 3L70H 3ZN1A 1SZXA 3E22B 4LC1A 3JAKA 1NTMH 1G2WA 2UUCB 4GCZA 2MK3A 2WAMA 2P4KA 2YSUB 4D7SA 4ZOLF 5I5WA 3K58A 4X62O 3GLKA 3HKEB 4ICGA 5A2QN 4DV6B 2PZSA 1Z2PX 1N32O 2HVJC 1TA8A 4D7TA 3OMNB 2EIJB 2HJDA 4LFBB 1WPBA 5KHJA 1JFFA 2C22A 1M4UA 4YHHB 1BMFG 3J81W 2ARHA 1P8LA 1ZL8A 2RCVA 5IY5B 2CK3G 5ITZA 2BTQA 2ZR3A 2F4VH 2HEPA 1DF4A 1B04A 2WA3A 1OWTA 3RF2A 4HR7A 1YI2V 4BW9A 1H8EG 4K3AA 3B2EE 1F4MA 4JYAH 4A3LG 5JJJB 1DAAA 2WLHA 3M9OB 4DV0B 4LSXA 3MFHA 4O3RA 1HWYA 2N05A 2HHHH 5KFTA 5BWXA 1X59A 5KFUA 2YUAA 1NH2B 4F6EA 5D1OB 3H3VH 4WFGA 4DV7H 3KAJA 4DW0A 1XHZA 1I1MA 5EK0A 4LF7H 1FKAO 2AXTZ 5BZBA 5KMGB 4XZ3B 1HNZO 2V9WA 3WWHA 1K9MW 4TSFG 1XNRH 1DTOA 4CC6A 3CCLV 5EOYA 4A3DG 1K92A 1CQJB 4DR2B 2UUAO 2QWQB 4FFOA 3VNNA 1VS0A 1WR2A 2QM7A 4DV5H 3R5FA 2X0SA 1NS1A 4DRXA 3QQMA 3ZRXA 3OEEG 3LULA 3U54A 3W1BA 1L2ZA 3T9DA 2FLNA 2C2AA 4JZ2A 2R7LA 2UXCH 4LNUA 5JCOC 4J9YB 4R8CA 1AJQA 2CDYA 3CRRA 4UCOA 4YXWG 4J9NA 2R85A 4PZ8A 4FFBB 5GONB 1J95A 5K3WA 1ZX3A 3OGIB 2JA6A 4QJFA 3I5DA 3L75H 2J6SA 4LF7B 1ULZA 1Y1WG 5LGTA 5KFSA 3VBBA 4QE9A 2YU9A 1R1BA 1F4NA 1SQXH 3W7SA 2W9CB 1JQ0A 5FPRA 4BW5A 3OUZA 4NTXA 4X1YA 2JEGA 4XDKA 2A06H 5LBQA 5LHIA 2OCCC 4O7YA 4R7RA 5LXTA 1NTKH 4QWDA 1YSCA 3CXCU 1E4FT 1Y1WA 3P30A 3GDEA 2W9CA 2B5UA 5J2TB 2ZJTA 2UU9O 4J9KA 1EUDB 1YZBA 4J7JA 4YJ3A 1IURA 4FU0A 2R93A 1NR1A 3UO3A 1Y4MA 2H94A 5FL7G 3SDLA 2ADPA 2UXDB 4DV2O 3S3WA 2Z3YA 5K1XA 4JV5B 1P4RA 2E5LH 3B8MA 4PI2A 4LBEC 1VMGA 1SYXB 1IBLH 4DUYB 1XUQA 5C8YF 4DUYO 3FDSA 2EJ7A 4X66H 2YZGA 2Z02A 4F4XA 4H33A 4XDLA 4I4TA 2RQ6A 3JATA 4NZNA 4TV8F 2F4VB 2UUCH 3WB0A 1ZUQA 5H6QA 4FS2A 1Q81W 4FBTA 1P84F 1PL0A 2ASDA 2AGAA 5IJ0B 5KA6A 3BABA 1XI1A 1WAZA 3MWDA 4FZ0A 3L4KA 2QWPB 3T1YO 4I55A 2QYZA 4B3SB 3F7YC 3HKBB 4CH3A 4K0KO 3B4SA 1S0NA 2P4VA 1I2LA 5FNVA 5KFCA 3G67A 5KS8A 5C3EG 3BPZA 3QNEA 2FKLA 1ZQ7A 2IJJA 4Z2WA 3D36A 1Q7YW 1V51A 3JAKB 4ETSA 5GONA 1SZTA 3W7XA 4BAYA 1TVKB 5C1PA 5IDJA 3ABUA 3I12A 3RFCA 4J9RA 2Y4TA 3HOUG 1VEWA 2XD4A 2YXYA 1EHIA 2VR1A 4NVPA 1JJOA 3IJ4A 4B3SH 1HR0H 5BMVB 3JD3A 1NT2B 3B09A 5GTIZ 1VQPV 3G6XA 3MJFA 2HFEC 3CCVV 5EYPA 2W0FC 2XIGA 3FYIB 4PDMA 4DR1O 3AG7A 1GK9A 4DR5O 3EXAA 2CGOA 2QSAA 1M56B 4O4IB 3LNNA 3RB6A 4X1YB 1SESA 3SPIA 3RB4A 4TVIA 1WH2A 4MTFA 2KSDA 4PDRA 3ZMZA 4ZHQA 1I5YA 3RIZA 4XDJA 3J7AU 3RT3C 2GHYA 4RB3C 1GN4A 1OCCB 2SCUB 3HOVG 5CA3A 2FTKA 4MVMA 4TV8B 1P7GA 3E22A 4LH6A 3E2EA 5KFQA 3VPDA 5EBWC 2B1IA 3MWMA 2QJ1A 1IYEA 3H1JH 3OHAA 1CPYA 1B6RA 1KC7A 3ASOC 1AR1B 2BTOA 3ZS8C 3KREA 4NR1A 5KAFZ 1ZLZA 2HGSA 4B3TB 2UXBO 4DRXB 2VA2A 4WFEA 4KUMA 2HJFC 1IXBA 3M4IA 3K5NA 1N34H 1CKNB 3PVXA 2NVXA 3SI8A 1HNZB 3K3PA 3KHLA 5JH7B 5BXZA 4HNUA 1FJGH 3ABLB 4PA3A 4ECRA 2HLDG 1FXKC 4BIOA 2P22C 2DYSC 2FP4B 1M7JA 2EIJC 4YR3A 2EIMB 2ADQB 4JI5B 1S68A 4B3RH 3JD0A 1VQLV 1B3QA 3K0GA 3TETA 2LJ2A 3HOYG 2W6JG 4RAZA 5IY5C 4FLZA 5CA0F 5D1OA 1A9XA 5KA5A 4LF9H 2WLLA 5DN6G 3MWEA 4PD4F 4CS2A 3WB1A 4J42A 3B40A 3OM3B 2YZMA 1EUCB 4JI8H 4YY3B 3N2KB 4EBEA 4UV9A 3DF7A 4R6ZA 5KFMA 2QWNB 4DK1A 3CB2A 5KFAA 4DV5B 5CAEB 2WAQA 2IU0A 2FMAA 3BQ0A 2ALZA 1OZ0A 3H0GA 1O9GA 4FPPA 1NKDA 2HHHB 4MV7A 3CEIA 5KG2A 1J5EO 4JI2B 1Q5OA 4B7KA 3M99B 4CS4A 1THZA 5DM6V 4LF4O 2V4DA 2XOKG 2ZDIA 1IBMO 1K5QA 1IOWA 3T5HA 3SJBC 2XAQA 5BY1A 4UB8Z 3WG7B 4EFEA 5D5QA 5JJEB 3Q1KA 4LSAA 4IRKA 3H1HH 2DQ3A 3RYFA 3PN1A 1GM9A 3CRMA 3STZC 3CC4V 1UC9A 4FM2A 5GONF 1AI4A 1RJPA 3FKIA 4IT5A 2UVRA 2ZXWC 4O7RA 4GZRB 5D8DA 5KHIA 4ZBMA 1KKCA 4PZ6A 2ZINA 2CH7A 1S72V 2OTLV 3T9BA 3K0DA 5IJ9B 4A3IG 2ITDC 5CA1B 1ZETA 5DQGA 4FS1A 2E74B 5JUMA 4WF9V 1UJWB 4RNNA 1OJHA 2ZXWB 2EZPA 1SA0A 3ZX6A 1I94B 4RUCA 1EM1A 1IYDA 2P7TC 3DC6A 3FAVB 2X0LA 1O9HA 4I9WA 4WCEV 1WSCA 1BNCA 5JJNB 4GC7A 3F7VC 4ZKIA 3E5NA 4M7EA 2CTQA 4CZZA 3W7TA 5C5JA 4NXMO 1FFTB 3G4SV 4PA6A 3N42B 4B3SO 4X65O 3ICXA 1BL8A 3ZRWB 1XOUA 1B6SA 4ECWA 4GKJB 1H2KA 2JEIA 3RBZA 4U3FH 1M9NA 2HGXA 2OIGA 3TINA 1IBMH 4CH6A 3AK3A 4RB2C 4EB6A 3OTOH 1OCRB 4RZRA 3TW6A 2ITCC 1Y76B 3HPLC 1YJWV 4NXNB 3MR6A 5DGAA 2M7WA 3R5HA 4YHHO 3G6EV 4MT8A 2ZNIA 4JI1O 2V5AA 4MVUA 3THOA 4AI8A 3M9MB 3HKDA 2Q73A 4LCUC 4U7NA 2W71A 4FM9A 4RAIA 5EZYF 4U7CA 1BZKA 2AHYA 1G8MA 2Q67A 3GIDA 4CH5A 4F4LA 4DR5B 4BIZA 4GLXA 2E5LB 5KG1A 4RNMA 3KHHA 3BVOA 1VF5B 4B3MB 3IC7A 2CNUA 2Q8VA 3CQZA 1QBZA 5J2UB 3K57A 2DIKA 2P67A 1H2NA 3ZHTA 2IJKA 3EPIA 1S5JA 4JI8B 1N33H 1XQ8A 2DE0X 4AQYH 1QHTA 2JA8G 3KYHC 3DTFA 1N36B 1M0TA 2W6NA 3N2KA 2RMKB 1BHBA 2EJ3A 4DR1B 3TJTA 4NB5A 4MW3A 4H37A 3JYCA 3QO7A 5LL6b 4Q6GA 2W6QA 4KXRA 2FPGB 1BGWA 5DEDA 2DYRC 2F93B 1KP2A 2HHFA 4K8ZA 4MSWC 2V59A 3QWUA 3P32A 1A3GA 4LH7A 2I8CA 1GN3A 4UVAA 2GUZB 4WBNF 4DL4A 4X64H 3E83A 4OPHA 1SS3A 1B06A 2VWKA 2F1MA 3T1CA 1E4EA 1VARA 2DWCA 2VQFO 2WAQE 2A3QA 2JGDB 4AQYB 2FK2A 4UUJC 3ZCCA 2WLIA 1TWFA 4RZQA 1Z5VA 1M90W 2ZKOA 4JUZA 2OH2A 3GTQA 2RGVA 5KX5A 5CMUA 1XDCA 4PA4A 2NUAB 5KG6A 2QB5A 1YHQV 1EZ1A 4HYKA 4PV1B 3RVZA 3N43B 4M9UA 3ZEDA 4XX0B 4JI2O 5CBHA 1CS0A 5CB4F 2AGPA 4K8XA 1JCHA 1RSOA 2AHZA 1IBKH 2EIKC 2BQUA 2C2EA 4GX5A 5KFKA 5KAIZ 1IBKO 4U3JB 5C93A 2YS8A 1OBGA 3BJYA 4MV1A 3CMAV 5CBFA 1RK5A 4FZ1A 2X5RA 1YXBA 4ED2A 2YRWA 1N0JA 1DF5A 5CA0B 3PW4A 1S03G 4LF4B 2FK3A 3BRCA 3TK1A 2NU8B 4JAVA 1EKFA 1PM9A 2ZR2A 2AGQA 4H44B 3U0GA 3VQXA 2ATKC 1QLEC 1WA8B 1QR8A 3OR6C 4DV1O 3CC2V 2GPWA 4B3RO 3KHGA 2R84A 2HIVA 2VUMA 1FXHA 1VQKV 1ZWIC 1E4GT 1HNXO 3ETGA 1G1XB 3JASB 2XAFA 3OGCC 2PTMA 2C00A 4WBNB 4DR3B 4H0LB 1NI8A 3GTMA 1J5EB 4I0XB 3OUUA 1V54B 3ASNB 5KFBA 1MZEA 5HNEA 2C2DA 3CRAA 2LFRA 4AYBE 4UV8A 2ZE6A 3H1LH 1GLVA 4PI0A 3W7WA 3ZJZA 3IGAC 1KC8W 5FPOA 1N32H 3K59A 3K08A 2XAGA 4X62H 4TQSA 3RW0A 4ECVA 1W59A 5L3DA 3HB9A 3A0BZ 3RV3A 1K97A 1CE8A 3AG3C 3CJHA 2JS3A 4JASA 1KEEA 5KFLA 4C2MA 4IR1A 4CE5A 1VQ5V 3U11A 4GKJO 4WHXA 1R73A 3HO8A 3V6JA 4X1KA 3TQTA 4LP8A 2R7NA 4LR3A 4APMA 4IHJA 1OHHG 4O3NA 2QGNA 4U7OA 5IP9G 4O7ZA 5FNVF 5LMNB 2WSSG 2JGUA 2R9AA 4DV4B 4OX9O 4LFBO 2R8IA 1IXMA 2EJRA 3IFXA 1IBLB 4MVRA 1RJQA 2UUBB 1W0JG 3N6XA 4QWEA 1YJ9V 5LP6F 2R92A 2ZDIC 2HDKA 2X6CA 2COJA 2JEFA 3OE7G 3ETQA 2KKWA 3OTFA 1EN6A 2H3OA 4EGJA 5KFGA 4PDBA 2FB5A 3ETDA 2FJZA 4WFFA 5DISC 3MHSC 2FE3A 5LXTB 5EBLC 3RYCB 2R92G 2ODMA 3H20A 2OLSA 1KU9A 2BQ3A 4LF8H 3ZHQA 2ZDHA 2XCAA 1Q3EA 3FB8C 4LF9B 2NU9B 3LSUA 4WFBV 3JAWB 1VF7A 5FLXW 4LWSB 4ECUA 5KKNB 1ZAUA 3K5MA 1TGOA 4YR0A 5DG7A 5EZYB 2JA7A 3SPCA 3FB6C 4YY3H 2W9AA 4Q0YA 3EVKA 4QIWE 3WG7C 1WN7A 4JI5O 4E2LA 2YS7A 3KTMA 3GIIA 3H4DA 2CQYA 1XNQB 5KG0A 4O7WA 4X64O 4LFAO 2QDOA 1QQCA 1GSHA 1QU7A 5J2TA 3SNOA 4QIWA 2COGA 2WB1A 3SJQC 5H9CA 2RDCA 4JYBA 1S3JA 2ZD9A 2CUGA 4U6PA 1JR9A 3CVZA 4H13B 4JXUA 5L9XA 2GPSA 4ED7A 3S3XA 1OCRC 1SQQH 4LF6O 1IDSA 3HKEA 4DUYH 2E2IA 3UT5A 2YIAA 4IL6Z 5LP6B 3FD9A 1NTZH 5DAAA 1BHAA 1CKMA 4DR4H 3VOTA 3RAXA 4RB1A 2DJVA 4DR4O 2EILC 1GRJA 4FFNA 4IGGA 4BXXG 3HBLA 4LNUB 1M1KW 2BSKB 4IWXA 4GKJH 1WP8A 4MAMA 1CEZA 3ZHRA 1Y1VG 2VUMG 5KFVA 3GTKA 1N36H 1UC8A 4NLGA 3OW2U 1COWG 3D8CA 1AP5A 1TWGA 1XBLA 2C28A 4DV1B 2YIBD 5FD6A 2I87A 5LMUH 2BR0A 1ZL8B 3H0GG
chains in the Genus database with same CATH topology
1N33B 3F8NA 4O4IB 4O2AA 4UCVA 3LNNA 3VQYA 4X1YB 1FKAH 4LF5B 2JVDA 1WH2A 1FJGB 4JI1H 4DR3H 4JI7B 4ZHQA 4B3RB 3RIZA 3U10A 3N2GA 2ZM6B 4JI5H 2UUAH 2P5OA 4RB3C 5CA0A 1MZBA 4TV8B 3N40P 3QTCA 3J80W 1FFXA 4FFBA 3E22A 3RYIA 4LH6A 1HNXB 1XMOH 2UXCB 3JSNA 2ZNJA 4DUZH 3CHXA 5LOVA 3MWMA 2QJ1A 2R70A 4B08A 2Q2UA 4MTEA 5IWAH 4EEQA 4KHPH 2BTOA 2VQEH 3ZS8C 4WBNA 4KL1A 3VQVA 4K0KB 5LA6B 2HGSA 4B3TB 4X1KB 4DRXB 4I9QA 3RR5A 4DV1H 3EYYA 2BTQB 3M4IA 3K5NA 1N34H 1CKNB 4AHCA 3RGZA 2CW7A 1XDNA 1HNZB 5JH7B 1FJGH 3HXLA 4PHZA 4DR1H 4IAJA 1J5EH 2P22C 1TUBB 2UUAB 4ZIBA 4JI5B 1S68A 2VUGA 2CW8A 5A2QW 5BR8H 3JARA 4B3RH 2ZIMA 2UXBH 2ZIOA 4A2BA 4LFBH 4RAZA 4FLZA 3FFQA 5D1OA 4LF9H 1TAEA 4LFCB 3WB1A 4CS2A 2UUBH 3BA8A 4LMYA 3GJXB 4JI8H 4TV9B 4YY3B 4MTDA 3N2KB 3DF7A 4DK1A 3CB2A 4JYAB 5JCOA 2QM4A 4O2BB 4DV5B 4JI3H 4UCTA 1ZHSA 1O9GA 5EIBD 1XK5A 2HHHB 4MV7A 4JI2B 1Q5OA 4AILC 4O4JB 1A0IA 4IIJB 4CS4A 4FM0A 1JFFB 4GKKH 2V4DA 4JI0B 1IBKB 4O4HB 5BR8B 1M0WA 3SJBC 2VPSA 2W57A 4LSAA 4EFEA 5JJEB 5D5QA 1HNWB 1XNRB 1BJTA 2VQFH 1V9PA 2Q7GA 3T1HB 4X20A 3RYFA 3PN1A 2WE6A 3N44B 4U3JA 3BAAA 2GV9A 4FM2A 4I50B 4YJ2B 4ZI7B 4DR6B 4DV3H 2E3CA 4FVMA 4DV2B 2HVQA 1SA0B 4BWSC 3NC0B 5KHIA 3RGXA 3K5LA 4PZ6A 4X64B 2ZINA 4NXNH 4LF5H 5IJ9B 4DR2H 5CA1B 3SR2C 4JI3B 5KX5B 3JALA 4FLTA 4LF8B 3SJAC 1SA0A 1I94B 1M5IA 5IYZA 3RWRD 2CAZC 5JQGA 1O9HA 1DGSA 3A2FA 4I50A 4X1IB 4YJ2A 3MAQA 2UXDH 5JJNB 3RTXA 3C0FB 5JVDB 3NBZB 2WDTA 4JI4B 3RYFB 3WB2A 4A2AA 3RYHA 5IWAB 4M7EA 5LMNH 4GYCB 1XMQH 2HIXA 4X65B 3RYHB 2WYOA 3N42B 3ICXA 3T1HH 4X66B 2HVRA 2MCTA 5D1PA 3HKDB 4GKJB 5JQGB 3RJ0A 4IIJA 4DV3B 4O4JA 3S24A 2EX3A 1IBMH 1L8DA 4CH6A 4RB2C 4EB6A 4UFZA 3OTOH 4F6RB 4LF4H 4FLYA 1CKOA 4LFAH 4NXNB 4UCSA 2JS5A 5IJ9A 4TOIA 4F6RA 4B3TH 5KHGA 4JI1B 2ZNIA 3DSQA 4X65H 3THOA 4NXMH 2R72A 1D5AA 3HKDA 4FM9A 2YXLA 5J2UA 3JSLA 4X20B 4CH5A 4JI4H 4DR5B 2OYQA 2Q2TA 4TQFA 5C8YB 5C8YA 4GLXA 2E5LB 3L4JA 4B3MB 4RB0A 4LFAB 2PYJA 5JVDA 3SJCC 5J2UB 4X1IA 3K57A 2UU9B 4DR4B 2VQEB 2OWOA 4PZ7A 4DV7B 3T1YB 5K1PA 1S5JA 4X62B 4GKKB 4JI8B 5FD5A 1N33H 1XQ8A 3UQ8A 3N41B 4AQYH 1QHTA 3GB8B 3KYHC 3M7MX 4EB6B 1N36B 1M0TA 3N2KA 1HW7A 1HR0B 4TV9A 4DK0A 4DR1B 4OX9H 5LL6b 1I6UA 4Q6GA 1GYFA 4ZI7A 5LOVB 1BGWA 3KALA 4JI2H 1SQGA 2F93B 4K8ZA 3QWUA 2HVSA 1Q8IA 1Z2NX 1KMIZ 2O03A 4LH7A 2ZCEA 4JI0H 4JI7H 3JARB 4LFCH 2YCHA 4X64H 3N2GB 2PUSA 3U0ZA 3IG0A 1TUBA 4ZHQB 4B3MH 2VWKA 1YEWA 2F1MA 4UCUA 1XNQH 2VWJA 4AQYB 4YHHH 3TY5A 4LF6B 3KXYT 5IYZB 5IT9W 4CC5A 1SEIA 4RZQA 4FLVA 1Z5VA 3JALB 4OX9B 2RGVA 5KX5A 3QF7A 4KHPB 4I7HA 4O2BA 5CA1A 2PY5A 3N43B 2F95B 4ZOLB 3ZEDA 1XHXA 5LYJB 4DUZB 4K8XA 1RSOA 1IBKH 2CFMA 1JMKC 1AN7A 2VOBA 4U3JB 4FLWA 3E22B 3JAKA 2UUCB 4D7SA 5CA0B 1XMOB 1HNXH 1S03G 3OTOB 3K58A 4LF4B 3BRCA 3HKEB 1Z2PX 4DV6B 2PZSA 1N32B 4RAYA 4O4HA 1TA8A 4D7TA 1T5EA 3VQXA 4LFBB 1WPBA 3VQWA 5KHJA 1JFFA 1M4UA 4YHHB 5JH7A 4O2AB 4O4IA 3J81W 2HIVA 1P8LA 1CKNA 2XHBA 5ITZA 1SKVA 2BTQA 5IJ0A 3J7AK 2F4VH 2HEPA 3IAYA 1N34B 1B04A 4HNAA 1E4GT 3RF2A 1Z2OX 5D5PA 4BW9A 5LA6A 4I4TB 3JASB 3B2EE 2Q7EA 2PTMA 4JYAH 4WBNB 4DR3B 5JJJB 3CSXA 1FVIA 4DV0B 4LSXA 1J5EB 1O75A 5LP6C 2HHHH 2VQFB 2UXBB 4FM1A 3RYIB 1G6UA 5D1OB 4FLXA 1FFXB 4TV8A 4CH4A 5KHKA 4DV7H 2KSWA 3KAJA 4PI0A 1XHZA 3TY8A 4LF7H 5FPOA 4DV6H 1N32H 3SGIA 3K59A 5KMGB 4X62H 4YJ3B 5LMUB 1XNRH 4CC6A 5EOYA 1M93A 2Q0AA 5CB4A 4DR2B 3RYCA 4CS3A 1VS0A 3VNNA 4O4LB 4DV5H 3U11A 5EYPB 3FMAA 4JI6H 1WNSA 4BWAA 4DR7H 2RJZA 5BMVA 3T1YH 4X1KA 4DRXA 3JATB 4LR3A 3W1BA 4EFBA 4APMA 1L2ZA 3LMLA 4IHJA 3BA9A 2UXCH 4LNUA 5JCOC 5LMNB 2JGUA 2R9AA 4DV4B 4JV5H 4TQDA 4UCOA 4J0MA 1I94H 5KHHA 3RGBA 5EZYA 1P16A 4PZ8A 1H2SB 3TY9A 4FFBB 5GONB 1HNWH 4LF6H 1IBLB 4UCRA 1I7FA 2Q7HA 2UUBB 3N6XA 4LF7B 3HKCA 3BHPA 5FNVB 3ETQA 2KKWA 3OTFA 4PDBA 4DV2H 3HKBA 5FPRA 4X1YA 4I55B 4TUYB 5DISC 2FE3A 5LXTB 4R7RA 3RYCB 5LXTA 1E4FT 4JI6B 4K0KH 3GDEA 1P49A 5J2TB 2ZJTA 1KU9A 3H20A 4LF8H 1XMQB 4YJ3A 1Q3EA 5KMGA 3W5OA 3JAMW 4LF9B 3JAWB 2UXDB 1VF7A 1ZHQA 5FLXW 1HNZH 3RFRA 1ZAUA 5K1XA 3K5MA 1TGOA 4JV5B 4DV4H 5EZYB 1TVKA 2E5LH 4PI2A 3KAKA 4YY3H 4Q0YA 1SYXB 1X9NA 1IBLH 4DUYB 1WN7A 4X66H 2UU9H 2RGRA 5LP6A 1XNQB 3UT5B 4I4TA 1Z5WA 2RQ6A 3JATA 2F4VB 4EQ5A 2UUCH 4HNAB 3WB0A 1QQCA 5J2TA 5IJ0B 2PGGA 5ITZB 3BABA 1XI1A 4O4LA 3L4KA 2YI8A 4TUYA 4I55A 5CB4B 3K3VA 1SQFA 1X4TA 3CVZA 4B3SB 3HKBB 4CH3A 4MV9A 2F66C 5FNVA 3HKCB 3HKEA 4DUYH 3UT5A 2ZM6H 2YIAA 4DRFA 3BPZA 5LP6B 4NXMB 1CKMA 4DR4H 3JAKB 4ETSA 3W1GA 5GONA 4RB1A 4DR5H 3NBYB 1TVKB 4DV0H 2IM9A 4LNUB 5EIBC 3QG5A 3JAWA 4L8JA 5LYJA 4GKJH 2YI9A 4IHJB 4ZOLA 4E6NA 3JASA 4DR7B 4NVPA 1IBMB 1JJOA 3K5OA 3L2PA 1N36H 4B3SH 1HR0H 5BMVB 1NT2B 2YIBA 4FLUA 4DR6H 4DV1B 5EYPA 4HBNA 2XIGA 2YIBD 5FD6A 5LMUH 2PYLA 1Q43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NC0 B;  1N33 B;  4UCV A;  4PZ6 A;  4X64 B;  5LMN B;  4LF5 B;  4DV4 B;  1FJG B;  4UCU A;  4UCO A;  1P16 A;  4JI3 B;  4JI7 B;  4PZ8 A;  4AQY B;  3TY9 A;  4B3R B;  2ZM6 B;  3TY5 A;  4LF6 B;  1IBL B;  4UCR A;  4LF8 B;  2UUB B;  4CC5 A;  1I94 B;  4LF7 B;  4OX9 B;  4KHP B;  1DGS A;  4LH6 A;  1HNX B;  2UXC B;  3JSN A;  3RTX A;  3NBZ B;  4JI4 B;  5FPR A;  2Q2U A;  5DIS C;  5IWA B;  4EEQ A;  4DUZ B;  4X65 B;  2HIX A;  4JI6 B;  4K0K B;  2CFM A;  3GDE A;  4X66 B;  2HVR A;  4B3T B;  5D1P A;  1XMQ B;  4GKJ B;  3RR5 A;  3W5O A;  4DV3 B;  3S24 A;  2UUC B;  4LF9 B;  1CKN B;  1XMO B;  2UXD B;  1XDN A;  4UFZ A;  3OTO B;  1HNZ B;  4LF4 B;  1CKO A;  4DV6 B;  1ZAU A;  4JV5 B;  1N32 B;  4NXN B;  1TA8 A;  4UCS A;  4LFB B;  2UUA B;  1X9N A;  4DUY B;  4JI5 B;  4TOI A;  4YHH B;  1S68 A;  2VUG A;  2HIV A;  1P8L A;  4JI1 B;  1CKN A;  1XNQ B;  5D1O A;  2F4V B;  4EQ5 A;  1N34 B;  1B04 A;  1TAE A;  4LFC B;  3JSL A;  3BA8 A;  4DR5 B;  3BAB A;  3GJX B;  2Q2T A;  4DR3 B;  4YY3 B;  2E5L B;  4GLX A;  1FVI A;  4DV0 B;  1J5E B;  4B3M B;  4LFA B;  4B3S B;  4JYA B;  2VQF B;  4DV5 B;  2UU9 B;  2UXB B;  4DR4 B;  2VQE B;  5D1O B;  4UCT A;  2OWO A;  4PZ7 A;  4DV7 B;  1XK5 A;  2HHH B;  4DRF A;  4NXM B;  3T1Y B;  4JI2 B;  1CKM A;  3TY8 A;  5FPO A;  1A0I A;  3SGI A;  3W1G A;  4X62 B;  4GKK B;  4JI8 B;  5LMU B;  3UQ8 A;  4JI0 B;  4CC6 A;  1IBK B;  3NBY B;  5BR8 B;  3GB8 B;  3KYH C;  4DR2 B;  1N36 B;  3VNN A;  4EFE A;  1HR0 B;  1XNR B;  1HNW B;  4DR1 B;  1VS0 A;  1V9P A;  3T1H B;  4E6N A;  4DR7 B;  1IBM B;  3L2P A;  3PN1 A;  3BAA A;  4DR6 B;  4DV1 B;  3QWU A;  3W1B A;  2HVS A;  4EFB A;  4LH7 A;  3BA9 A;  4DV2 B;  2HVQ A; 
#chains in the Genus database with same CATH topology
 1N33 B;  4UCV A;  5FJ8 G;  1FJG B;  1K5S A;  2R93 G;  1E4E B;  1FD9 A;  1WPX A;  2LW7 A;  4JI7 B;  2ZM6 O;  2ZM6 B;  4MTX A;  2UUA H;  2ZE5 A;  2P5O A;  3CE2 A;  5H5N A;  3K5H A;  4Q4D A;  5BWV A;  5IYC O;  5KFD A;  3JAM N;  3N40 P;  3HB3 B;  3QVN A;  1FFX A;  3MR3 A;  4IRD A;  1JIH A;  3RYI A;  3C90 A;  3VMM A;  2UXC B;  2ZE7 A;  4MS2 A;  3JSN A;  2F43 G;  2UXC O;  2DPJ A;  5CN0 A;  5LOV A;  2JA5 A;  3ABM B;  1E1R G;  4MTE A;  2RNB A;  2EUL A;  5IWA H;  2UXX A;  4KHP H;  3AK1 A;  2XGP A;  4BY7 G;  4WBN A;  4ED6 A;  3VQV A;  4K0K B;  3KZI Z;  2COI A;  4X1K B;  3TGU H;  4YAK B;  2BE3 A;  3EYY A;  4FGR A;  3TXQ A;  4UVC A;  2J6T A;  3ETE A;  1XDN A;  4FFK A;  3K04 A;  5E79 Z;  5A9G A;  3RUP A;  1EBO A;  2HG5 C;  2D2C B;  1K4D C;  3F5T A;  1VAJ A;  4E4E A;  3PJS K;  4O3P A;  3T5J A;  2CW8 A;  5BR8 H;  4J10 A;  3JAR A;  3ZIA G;  4Z1M G;  2ZIM A;  3BCC H;  3UM7 A;  4DR3 O;  4LFB H;  4NXN O;  3MDS A;  4JTD B;  2UVU A;  2DAA A;  3K03 A;  1TAE A;  2UUB H;  3L73 H;  2C2R A;  3JZI A;  1SFO A;  4LMY A;  4EG0 A;  5KFP A;  4MTD A;  2ETN A;  3CX5 F;  3PO3 G;  1N0N A;  4JGS A;  3UZO A;  1T94 A;  2R87 A;  2GTS A;  2E76 B;  1ET0 A;  1V54 C;  3ASN C;  2W7O A;  3APO A;  2QM4 A;  4X66 O;  4O2B B;  2W6P A;  5J2T F;  1M6V A;  3T4D A;  2AW9 A;  2HG8 A;  3ASO B;  4RQF A;  5EIB D;  3GIM A;  2X6A A;  5F2V O;  2YXH A;  4AIL C;  4TV9 F;  1A0I A;  1R3J C;  3K79 A;  4HQ6 A;  1WA8 A;  1TWA A;  2QR4 A;  2R8G A;  1HP8 A;  1JFF B;  1F51 A;  1BSM A;  1EKV A;  4I7Z B;  4O4H B;  1QNM A;  2R82 A;  2DLN A;  1M0W A;  4TQR A;  1TUE B;  5LYJ F;  1TWH A;  2GUZ A;  1JA8 A;  1N36 O;  2W6M A;  4ED3 A;  1XNR B;  3JD4 A;  3UCS C;  1HNW B;  4ECQ A;  3V6K A;  3BY6 A;  4DR7 O;  2Q7G A;  1WJZ A;  1FXK B;  2HHF B;  3RVY A;  4U3J A;  3Q8P B;  5LMN O;  1IX9 A;  4I50 B;  3KHR A;  3FAV A;  2E3C A;  4FVM A;  1SA0 B;  5AG2 A;  5DG8 A;  1S97 A;  4X64 B;  5KG7 A;  2IH1 C;  4DR2 H;  5KFJ A;  1SQB H;  3SR2 C;  1H2M A;  1JX4 A;  4FLT A;  3NGD A;  3D36 C;  4YIO A;  3SJA C;  5L1I A;  1XNQ O;  1GKF A;  4DV0 O;  5IYZ A;  3RWR D;  1R3L C;  4CKC A;  3A2F A;  4YJ2 A;  4X1I B;  4I4T F;  3JCU Z;  3C0F B;  1BQZ A;  5L1K A;  1N56 A;  4JI4 B;  4C5C A;  4A2A A;  1VF6 A;  2LQT A;  1XMQ H;  1IZ3 A;  3A0R A;  3DGE A;  3CRC A;  3BQ2 A;  2N74 A;  1GTO A;  3R66 A;  5D1P A;  3EHB B;  1DV2 A;  1R3I C;  1W93 A;  3RJ0 A;  4Q8F A;  2BOB C;  5C44 G;  1FPO A;  5BMV F;  1VIB A;  4DV3 B;  2VQD A;  2RDI A;  4O7L A;  3T9A A;  4TM5 A;  4MW8 A;  1XMO O;  4UFZ A;  1SQP H;  1QVF U;  2CKZ B;  2OIE A;  3CCR V;  5IJ9 A;  3JZ6 A;  3B8N A;  2FKX A;  2R9I A;  1W0K G;  4JYY A;  4O7T A;  4FK5 C;  3Q8R B;  4UB6 Z;  4F6R A;  4O4L F;  4B3T H;  1I5X A;  1KUQ A;  3V6H A;  1KJ9 A;  1L1F A;  4J7K A;  4QWC A;  5I5T A;  3DSQ A;  4X65 H;  3E86 A;  5KT3 A;  3NUA A;  3OMA B;  4NXM H;  4I50 F;  2ZE8 A;  1RM1 C;  1D5A A;  3ZMT A;  1NJI W;  4JYA O;  3AG2 C;  3OEH G;  5F9L A;  1Q6I A;  2IU3 A;  1E79 G;  1NZ6 A;  1ARO P;  4FMT A;  4QW9 A;  3K9A A;  1KJI A;  5BWW A;  4FBU A;  1MOF A;  4RB0 A;  4DIM A;  1BT8 A;  3E8H A;  4ED8 A;  1QR9 A;  1JKJ B;  1Y14 B;  4X1I A;  1WCM G;  1JOY A;  2R7M A;  2JEJ A;  3CEB A;  1S76 D;  2OWO A;  3ABT A;  3GTO A;  4DV7 B;  2B9Z A;  2E2H A;  5EWF A;  1BXR A;  1JVM A;  4EYH B;  5LGN A;  4GKK O;  3V4S A;  4NZM A;  5JH7 F;  4O7V A;  3UQ8 A;  3N41 B;  4ED0 A;  2Z0A A;  3LDC A;  3JZF A;  5EBM C;  1N8R W;  5EC1 C;  3ZMU A;  4EB6 B;  1HW7 A;  1HR0 B;  4YBZ B;  4TV9 A;  4DK0 A;  1PL4 A;  4OX9 H;  4ZI7 A;  5LOV B;  1Q82 W;  1A0G A;  4FJC C;  1V55 C;  3VPB A;  3KKY A;  4G27 B;  4JAA A;  5IYZ F;  1Q8I A;  1Z2N X;  2O03 A;  2EIN B;  3T7A A;  4O3Q A;  1GSO A;  2Q69 A;  2ZCE A;  2VS0 A;  3CCM V;  2YCH A;  4B3M H;  3E8B A;  2AZ2 A;  4UCU A;  3DAA A;  3RB3 A;  1KBH A;  1XNQ H;  4NKG B;  1K8A W;  4DL5 A;  2PI4 A;  2EIN C;  4ASU G;  4CC5 A;  2Y4U A;  4FLV A;  3T54 A;  4JZG A;  2OCC B;  5IE9 A;  3FYE B;  1RPO A;  2YW2 A;  4KHP O;  5CA1 A;  5H2F Z;  5KG5 A;  3D3Q A;  1Z2G A;  3PW5 A;  1BE3 H;  5BPF A;  4NZO A;  4CBC A;  3CPW U;  2HGW A;  2R6F A;  4QWA A;  4ZOL B;  3CD6 V;  5K2M A;  2JK5 C;  3BAC A;  1S5H C;  2YIC A;  3K5I A;  1Y1V A;  2CFM A;  3W7U A;  2W6I G;  1AN7 A;  2GDS A;  4MV4 A;  3GIP A;  4JV1 A;  2JEU A;  3DC5 A;  5B1B C;  1PX2 A;  3QO5 A;  2IH3 C;  1HNX H;  1N32 B;  2W7P A;  3TII A;  4DV6 O;  4OGQ B;  2X7R B;  2CZG A;  2Z5U A;  2JA5 G;  3CP1 A;  1K7D A;  2XND G;  3E35 A;  5KT5 A;  1AI7 A;  5JH7 A;  3UFX B;  4KP4 A;  4O2A B;  3UZB A;  2B1G A;  2O57 A;  5E1A C;  3DTG A;  5BYB A;  4O86 A;  1I0H A;  1SKV A;  2R9R B;  3QZ7 A;  3J7A K;  2XCL A;  4B3M O;  3IAY A;  1KUT A;  4P2Z A;  1VKZ A;  3SYA A;  1V4Y A;  5KT4 A;  1QVG U;  2Q7E A;  5LGU A;  3CSX A;  1PP9 H;  1FVI A;  4F4W A;  1M56 C;  2BSK A;  2K9P A;  3BEH A;  1VBG A;  5KFE A;  2W8K A;  2CE4 A;  3AG1 B;  2C35 B;  4O4H F;  2VQF B;  2J9G A;  5L3E A;  2YYA A;  2AU0 A;  4B3T O;  2UXB B;  3RYI B;  2CGN A;  3A0H Z;  4FLX A;  1MNG A;  2ASJ A;  5IWA O;  4G2K A;  4CH4 A;  1S0V A;  3ORR A;  5KG3 A;  3TY8 A;  1YCI A;  4W4K A;  2DN9 A;  3N6R A;  4YJ3 B;  3ABM C;  4QWB A;  1P7B A;  1IOV A;  1M93 A;  2PMZ E;  3HKZ A;  2Q0A A;  5CB4 A;  4D6T H;  3LP8 A;  3U9S A;  1GM8 A;  1FS0 G;  5DLG A;  3RYC A;  4CS3 A;  4A3G G;  1S0M A;  2JDI G;  2IW5 A;  4IIJ F;  5BWT A;  4GUN A;  4X89 A;  5BMV A;  3T1Y H;  4GX1 A;  1KJJ A;  2PMZ A;  3LML A;  3BA9 A;  3SYC A;  4PA9 A;  3ZHU A;  2FL4 A;  1AJN A;  4TT3 G;  3E89 A;  1DLB A;  3ABL C;  4TQD A;  4J0M A;  2Y0I A;  5KT2 A;  5BPH A;  3OSP A;  3T5L A;  5KHH A;  5J2U F;  4O2A F;  1BS3 A;  1HNW H;  3C3S A;  1WP7 A;  4BR6 A;  4UCR A;  1GGO A;  4JF3 A;  2Y4R A;  5B5E Z;  4FFM A;  2HHH O;  4JPR A;  1MSW D;  1FJG O;  3GTJ A;  3BHP A;  4J9P A;  4EEY A;  3OHB A;  2R7K A;  1PD3 A;  2ZDG A;  1K83 A;  1JJ2 U;  5DG9 A;  4DV2 H;  3MHH C;  3WNZ A;  2XGQ A;  4I55 B;  1DV1 A;  5KFX A;  2NR5 A;  5B3S B;  3J81 N;  2Q0O C;  4DXW A;  1KQS U;  3GQC A;  1D2D A;  1XMQ B;  3E8F A;  3M8A A;  1C30 A;  2HP8 A;  1YJN V;  3W5O A;  3FKS G;  3JAM W;  4HN2 A;  1ZHQ A;  1NU1 H;  4UVB A;  3T4Z A;  5C4X G;  4YJ3 F;  2OCH A;  4HNT A;  4DV4 H;  4BY1 G;  3KAK A;  4MVQ A;  2XAJ A;  1G4Y B;  4JI3 O;  1AR4 A;  4I0X A;  5CBG A;  2R7Z G;  2CTR A;  2UU9 H;  1Y66 A;  2R8J A;  4QIW F;  4A5U B;  3GV8 B;  1Z5W A;  1UNN C;  1K4C C;  4EQ5 A;  2IA6 A;  3HR0 A;  5ITZ B;  1FAF A;  5KFY A;  1I7N A;  1U96 A;  2YL2 A;  4TUY A;  5CB4 B;  2V7Q G;  1X4T A;  3G6Y A;  4FIP C;  4MV9 A;  2F66 C;  5B1A B;  1RYS A;  4MTG A;  2FK1 A;  3HKC B;  3OMI B;  4DRF A;  5F9N A;  3AK2 A;  4NXM B;  4J9O A;  2DZD A;  4UUG A;  5DQI A;  3W1G A;  1MMM A;  3RV4 A;  4DR5 H;  1A32 A;  3U9T A;  1S0O A;  3SYP A;  1SC5 B;  2IM9 A;  4LWS A;  5EIB C;  1RM1 B;  1SCU B;  2Y0S E;  4L8J A;  5LYJ A;  4K35 A;  2YI9 A;  1I7L A;  4ZOL A;  3CYO A;  3JAS A;  4DR7 B;  1KJ8 A;  3LDE A;  2P06 A;  1IVS A;  3CS5 A;  4FLU A;  1JDE A;  4DR6 H;  1CP9 A;  3OD4 A;  2Y69 B;  4J9Z B;  1GM7 A;  4HBN A;  2GSM B;  3DTU B;  4RQE A;  2PYL A;  1NR7 A;  5I5U A;  2WLI B;  2UUB O;  3F8N A;  3GIK A;  4O2A A;  3C3T A;  1FKA H;  2B63 A;  2CTW A;  1OBD A;  4LF5 B;  3DXR B;  1VQN V;  3CRQ A;  4DR3 H;  1URF A;  1M57 B;  1WB8 A;  3U10 A;  4C7U A;  2Q9L A;  4QJF B;  2YS6 A;  4NTW A;  5CA0 A;  2IJH A;  2E5L O;  1MZB A;  4A3B G;  4F50 A;  3KG2 A;  3QTC A;  4FFB A;  3TQ1 A;  5KUK A;  3I56 V;  1XMO H;  2N04 A;  2DPI A;  2VA3 A;  2ZNJ A;  3CHX A;  1K1Q A;  2R70 A;  4B08 A;  4IZO A;  3HKZ E;  1AUV A;  3MFI A;  2YEV B;  3UYY A;  3SPJ A;  4EEQ A;  2HKO A;  3ETH A;  3PR4 A;  3APQ A;  2DWE C;  3FB7 C;  2UUC O;  3STL C;  4KL1 A;  2P0A A;  2EIL B;  5LA6 B;  4FFP A;  1PPJ H;  1JPX A;  2JJ1 G;  3BFR A;  3RR5 A;  2EBO A;  2BTQ B;  2JIZ G;  4JV0 A;  4ZI7 F;  3D3I A;  1B6Q A;  4R7C A;  3RGZ A;  1VP7 A;  2P6J A;  2CW7 A;  3H1K H;  3CJH B;  1I50 A;  2I80 A;  3HOW G;  2KG7 B;  4J41 A;  2BOC C;  4N23 A;  2ZGI A;  1J5E H;  2UUA B;  4ZIB A;  4EGQ A;  5KX5 F;  3GTL A;  2UXB H;  1F7Y A;  2ZIO A;  4A2B A;  4A93 G;  1KJQ A;  3CSW A;  5EDW A;  1MAB G;  2YC0 A;  3FFQ A;  4Q8E A;  3B77 A;  4LFC O;  4LFC B;  3BA8 A;  1ZSP A;  4RUF A;  5JVD F;  2L35 A;  4G28 B;  2Q5Z A;  1N33 O;  1T3N A;  2DMX A;  2XAS A;  5T14 A;  5L1J A;  2YRX A;  2QEX V;  4ECZ A;  3HOX G;  1MSD A;  4JYA B;  1U97 A;  1GAX A;  4O7S A;  1ZHS A;  1L0L H;  2J6U A;  4P9O A;  4W4L A;  5KT6 A;  4DR2 O;  1XL4 A;  2R86 A;  2WTF A;  4IIJ B;  3T9E A;  2LO1 A;  4FM0 A;  3OTO O;  4GKK H;  2D3O W;  2GBO A;  4JI0 B;  1IBK B;  3L9D A;  4BBR G;  4DV7 O;  2IMW P;  4O83 A;  2VPS A;  3G8C A;  3LSQ A;  2RDJ A;  2VQF H;  3WWJ A;  4PBC A;  3T1H O;  3T1H B;  4X20 A;  5CA1 F;  3GWO A;  3PO2 G;  4K6N A;  4N21 A;  4ZI7 B;  4DR6 B;  4DV3 H;  4L1K A;  5L1L A;  3ML0 A;  4DV2 B;  1EN4 A;  4BWS C;  3IC9 A;  3RGX A;  4EYI B;  4NXN H;  5IYD G;  4DQN A;  3R5X A;  2QE7 G;  4PWQ A;  2WLJ A;  4QGP A;  1GN6 A;  1Y76 A;  4JI3 B;  2NU6 B;  5KX5 B;  4I55 F;  5TIS Z;  2K1E A;  3JAL A;  4LF8 B;  5L3C A;  1I94 O;  1NVP D;  3VOU A;  3EFF K;  2CAZ C;  3ABK C;  5C1O A;  5JQG A;  2R7Z A;  5I5Y A;  1GO3 F;  2FB9 A;  4PJ0 Z;  2EIK B;  4A3J G;  2KQX A;  5JVD B;  3NBZ B;  2WDT A;  3RYF B;  3WB2 A;  3RYH A;  1JX9 A;  2Y0S A;  4GYC B;  3H01 A;  4HZ3 A;  4X65 B;  3AEI A;  3L74 H;  3RYH B;  1WCM A;  2G38 A;  4JAU A;  3T1H H;  4X66 B;  2MCT A;  1VQ9 V;  5JQG B;  1B33 N;  3CCQ V;  3X2Q B;  3ZN0 A;  1KB9 F;  3LDD A;  5B1O A;  2EX3 A;  4XYM B;  5FR9 A;  3S24 A;  3M9N B;  4A3M G;  1L8D A;  4LF4 H;  4F6R B;  5I5X A;  4FLY A;  2W6O A;  4DW1 A;  3BG5 A;  2V58 A;  2JS5 A;  4HNV A;  2CH7 B;  2IJI A;  3AW8 A;  3AG4 B;  4OXS A;  2WB1 E;  3K3W A;  4DO2 A;  4QPK A;  2QTS A;  3SYQ A;  5KHG A;  4JI1 B;  4ECS A;  4HAM A;  1SET A;  5BYA A;  4Q44 A;  2QM8 A;  3CCU V;  2FPP B;  1RJR A;  5B3S C;  5KT7 A;  2R72 A;  2FLP A;  5I5S A;  1US6 A;  2YXL A;  4P30 A;  3RAQ A;  1PK8 A;  3JSL A;  1FXK A;  2DAB A;  2OYQ A;  3AG4 C;  5C8Y A;  4FFR A;  1K3E A;  1NH2 D;  5CE8 A;  2QKC A;  4LFA B;  3PW2 A;  4JI6 O;  2X6B A;  3P3P A;  3SJC C;  3RN4 A;  2LGQ A;  2VQE B;  2YDE A;  4PZ7 A;  2EJ0 A;  4NTY A;  5K1P A;  2YZN A;  3JRX A;  2FPI B;  1KKD A;  4IRC A;  1N48 A;  3O9O A;  2QTO A;  4X62 B;  5CR5 A;  4JI8 O;  1RYR A;  1WLE A;  2ABJ A;  4Q20 A;  2DYS B;  3Q8S B;  4KFM A;  1JXL A;  3FX7 A;  3AX6 A;  2QKA A;  5DGI A;  3M7M X;  1YF2 A;  1XIL A;  3WU2 Z;  1HNW O;  1T36 A;  2M6Y A;  2L6L A;  1Y67 A;  3G80 A;  1I6U A;  1XEQ A;  1GYF A;  5JQG F;  4Q4C A;  4JI2 H;  1SQG A;  5J9P C;  1H2L A;  4IWY A;  2HVS A;  1KMI Z;  2Q6A A;  1SRY A;  5LHH A;  4PDV A;  3OR7 C;  4JI0 H;  1W2B U;  1OV9 A;  3JAR B;  2AGO A;  4JI7 H;  2PUS A;  3T2M A;  1TUB A;  2H8P C;  4IYI A;  4ZHQ B;  2DQ0 A;  2KG7 A;  5BWU A;  4AYB A;  4A3E G;  4O2B F;  3TY5 A;  4LF6 B;  3U55 A;  1NVP B;  4EKW A;  2FYU H;  1QCE A;  2E75 B;  2M05 A;  5IT9 W;  4YY3 O;  1VQ6 V;  1S77 D;  4O2B A;  2RN9 A;  3ZMV A;  4JI4 O;  4FFL A;  3ZBH A;  3NR7 A;  5KUM A;  4GX2 A;  5LHG A;  4RCN A;  1XHX A;  3BQ1 A;  5LYJ B;  4J11 A;  4DL7 A;  4CMF A;  4ABM A;  3G6B A;  3H1I H;  1JMK C;  5I60 A;  5DQH A;  2VOB A;  4FLW A;  3F5W C;  3AG2 B;  1FXV A;  2XCP A;  2IP4 A;  2GQS A;  3I4M G;  4YR2 A;  1XMO B;  1M57 C;  1AJP A;  1YTF B;  3OTO B;  2UXD O;  3L71 H;  2LW1 A;  4DL3 A;  4RAY A;  2DW4 A;  3WO1 A;  4O4H A;  1R9T A;  4YP3 A;  1T5E A;  3K06 A;  4DL2 A;  3VQW A;  2WWW A;  3SPG A;  4CMD A;  4B7E A;  3EPG A;  1HR0 O;  4O4I A;  3QO8 A;  4RUA A;  1CKN A;  1Q6U A;  2XHB A;  1K34 A;  5IJ0 A;  1GO3 E;  1LNQ A;  1N34 B;  1WRV A;  2Y69 C;  4HNA A;  4JI7 O;  1Z2O X;  5D5P A;  1TWC A;  3N27 A;  4I4T B;  5LA6 A;  3HT5 A;  3ZHS A;  1OCZ B;  2EZO A;  3PFF A;  2VPQ A;  4ZHQ F;  1O75 A;  1I2K A;  1R6N A;  3G71 V;  3TW7 A;  5LP6 C;  5KLV H;  2OTJ V;  3CCE V;  3GV5 B;  2EJ2 A;  1G6U A;  1V55 B;  3P3N A;  4PA7 A;  1FFX B;  1AIL A;  3GIQ A;  4TV8 A;  5KHK A;  2KSW A;  1PNM A;  5KFZ A;  1I08 A;  3QZ8 A;  2CNV A;  2V4R A;  3TXS A;  1LR1 A;  4DV6 H;  3SGI A;  5LMU B;  1YIT V;  3R65 A;  3LUT B;  2W8L A;  4J9L A;  4MV3 A;  4X9Q A;  4TWK A;  2XAH A;  2XUM A;  1XRE A;  4O4L B;  2W9B A;  3FMA A;  5EYP B;  4JI6 H;  1C3O A;  1WNS A;  4BWA A;  4O4J F;  2RJZ A;  3E8G A;  2Q68 A;  3KCX A;  5GTH Z;  4R8U A;  2YID A;  1AP6 A;  3JAT B;  1R3K C;  1H38 A;  4EFB A;  2A0L A;  5DGH A;  3H9V A;  2JA7 G;  3HOZ G;  1PNK A;  2DWD C;  3ORQ A;  2DYR B;  3A8T A;  3H40 A;  3ZRV A;  1YIJ V;  1KT8 A;  2RF4 A;  4ECX A;  2NNU A;  4JV5 H;  1I1L A;  1I1K A;  1I94 H;  1P16 A;  3RGB A;  5EZY A;  2LP7 A;  1H2S B;  3TY9 A;  4LF6 H;  1H2G A;  2QK4 A;  1I7F A;  2Q7H A;  2WA4 A;  2PI5 A;  1AI6 A;  3HKC A;  3CC7 V;  5FNV B;  4OPA A;  4NYE A;  3ABK B;  5GW7 A;  4WFA V;  3FB5 C;  3DXR A;  3HKB A;  1D5N A;  4XYL B;  3WFV A;  4X8A A;  4BBS G;  4TUY B;  1R6T A;  2WPD G;  1AB3 A;  4JI6 B;  4K0K H;  1RPR A;  1P49 A;  2JRI A;  4R50 A;  1R6K A;  4NYK A;  3TCU A;  2IBK A;  2VQE O;  4ECY A;  1HDJ A;  1ZTE A;  5BR8 O;  5KMG A;  3GVM A;  3KCY A;  2KB1 A;  2ASL A;  1XNR O;  5KG4 A;  1HNZ H;  3RFR A;  1TVK A;  3AG1 C;  5KFW A;  2W0X A;  4DV3 O;  1X9N A;  1ENV A;  3T99 A;  5EC2 C;  1CQI B;  1VQ7 V;  3RBD A;  4MVO A;  1VBH A;  2RGR A;  5LP6 A;  1KTA A;  4C5A A;  2WLN A;  3UT5 B;  3Q4H A;  4JYC A;  4HNA B;  2A7W A;  5KFR A;  5B1N A;  5H6R A;  4CKE A;  1RP3 B;  2PGG A;  4Y8V B;  2WLK A;  2R8H A;  3PZP A;  5IYD O;  2JEX A;  4O4L A;  4J9S A;  2YI8 A;  1OCC C;  3K3V A;  1SQF A;  1A48 A;  2XC9 A;  5B66 Z;  1YVW A;  3Q4H B;  4Q45 A;  2ZM6 H;  3JRW A;  4A3C G;  2JJ2 G;  1W96 A;  5IT9 N;  5JVL A;  4YIP A;  1MG1 A;  2XT9 A;  4DLK A;  2A1H A;  2QF7 A;  2UXN A;  4PDL A;  4PEL A;  4ZQI A;  3NBY B;  2PBZ A;  4DV0 H;  1KYO F;  1S10 A;  1KEC A;  2LGW A;  3LQS A;  3QG5 A;  5E25 A;  3JAW A;  4IHJ B;  1AI5 A;  2HR3 A;  4E6N A;  2ILM A;  5EWG A;  1IBM B;  3K5O A;  3L2P A;  4F4Y A;  2B63 G;  3AG3 B;  2YWV A;  2YIB A;  5HFM A;  3CME V;  4QW8 A;  3I4N G;  4AQY O;  3OFN G;  3WO0 A;  4J9Q A;  2PYJ A;  1Q43 A;  4FM1 A;  2EIM C;  5IYB O;  3VQY A;  3RB0 A;  2JGD A;  2JVD A;  4JI1 H;  2HJW A;  5KFF A;  1N34 O;  1PV0 A;  2F23 A;  4B3R B;  4JI5 H;  3N2G A;  4EBC A;  2Q4P A;  3G8D A;  3R23 A;  2V1D A;  1JLL B;  5HFL A;  3J80 W;  4RNO A;  2FML A;  4O81 A;  3GWK C;  1KP3 A;  1HNX B;  2ZDQ A;  1SER A;  1Q6H A;  4DUZ H;  3T5K A;  3PW0 A;  4WD3 A;  2Q2U A;  1RSO B;  1K1S A;  2VQE H;  3O65 A;  3UKM A;  4GT1 A;  4MVS A;  3CCS V;  4RU9 A;  3MD0 A;  3LNM B;  1AUX A;  4I9Q A;  3K9S A;  3N8D A;  2PVP A;  4DV1 H;  5DLF A;  2IBZ H;  4O7N A;  4R8U B;  3J80 N;  2W9B B;  3JD1 A;  4IYH A;  4AHC A;  4MA0 A;  3GTG A;  3GTP A;  2GQR A;  3HXL A;  4WFH A;  4PHZ A;  2WLM A;  5HV6 A;  4DR1 H;  4IAJ A;  4QPJ A;  1TUB B;  5B1A C;  4MV8 A;  2VUG A;  5A2Q W;  1AVM A;  2CTP A;  2UVV A;  3GB7 C;  4LF8 O;  4XBF A;  5DGB A;  4YAJ B;  2NVY A;  1BCC H;  2XTA A;  1VQ8 V;  3NXS A;  4F4Z A;  2ATL A;  3OT7 A;  5IYC G;  1ROP A;  4RUE A;  4CKB A;  1DK1 A;  3GJX B;  4TV9 B;  1LUV A;  4P9P A;  1UFI A;  3SE7 A;  1JDB B;  1SQV H;  2QWO B;  2R8K A;  1WB7 A;  2A9H A;  1AR5 A;  1CXZ B;  4ME6 A;  1EFR G;  3GIL A;  4A3F G;  5JCO A;  1EZV H;  4YB8 B;  3VA7 A;  4JI3 H;  4UCT A;  1XK5 A;  1UPG A;  4E4T A;  4DUZ O;  3OAA G;  1N4C A;  3FKI G;  4O4J B;  4J80 A;  1GH6 A;  3OUF A;  3RBE A;  3V4Z A;  3IN5 A;  1K73 W;  3Q8Q B;  3LWB A;  2GTA A;  2JA6 G;  5BR8 B;  1H8H G;  5JQW A;  5BWR A;  1E1Q G;  2W57 A;  4JTA B;  3TIG A;  1Y74 B;  1VF6 C;  1BJT A;  1V9P A;  1OCZ C;  2YZL A;  3CWB H;  2WE6 A;  1LUW A;  3N44 B;  2ZQM A;  3BAA A;  2GV9 A;  5FLM G;  4YJ2 B;  2UVW A;  5B1B B;  3ZMS A;  5L3F A;  1Q86 W;  5L3B A;  2HVQ A;  3NC0 B;  3K5L A;  4MVZ A;  3L72 H;  2PN1 A;  4LF5 H;  3SYO A;  1L0N H;  4TUY F;  3H4B A;  4CHI A;  3JD2 A;  2OT5 A;  3R9R A;  1M5I A;  2PF4 E;  4Q43 A;  1I3Q A;  4YQW A;  1VQM V;  4O82 A;  3PW7 A;  1SF9 A;  3GIJ A;  1DGS A;  1RFY A;  4I50 A;  4ED1 A;  2UXD H;  3MAQ A;  3AYH B;  3LSS A;  3RTX A;  4DL6 A;  3T9F A;  5IWA B;  4GLW A;  3VPC A;  5LMN H;  4QSH A;  4LF9 O;  2HIX A;  2WYO A;  2ZT9 B;  1S5L Z;  3SPH A;  1BGY H;  2HVR A;  3CXH F;  5L3G A;  3HKD B;  3OUS A;  2MW2 B;  1GN2 A;  2CNQ A;  4IIJ A;  4O4J A;  4UXN A;  1EYZ A;  1NBM G;  2ODT X;  2W70 A;  3GV7 B;  3ZHV A;  5IP7 G;  1MZF A;  1CKO A;  4LFA H;  3I55 V;  4QNH B;  5JWP A;  2EIY A;  3G6V A;  4UCS A;  4BIU A;  4QE7 A;  5IYB G;  2A79 B;  2Z04 A;  3ETJ A;  4DAA A;  4C5B A;  1PNL A;  4TOI A;  3Q2O A;  3PR5 B;  4JTC B;  5HBR B;  4YJ2 F;  4GX0 A;  5DEC A;  4GC6 A;  3JCZ A;  5J2U A;  4O84 A;  5KFI A;  2NLJ C;  4MTO A;  4X20 B;  4RWU A;  4JI4 H;  1RK6 A;  1GSA A;  2Q2T A;  1Y74 A;  4TQF A;  1EN5 A;  5C8Y B;  1VQ4 V;  2VRZ A;  1EKP A;  3L4J A;  4LF7 O;  1VQO V;  1NQT A;  5KFN A;  5JVD A;  4ECT A;  4J7Z A;  1KBL A;  4DV5 O;  5LA6 F;  2UU9 B;  5EWE A;  4DR4 B;  3CCJ V;  1XMQ O;  2LFS A;  5LL6 Y;  4MV6 A;  5FLX N;  4RO2 A;  1F23 A;  4IHJ F;  1QLN A;  3T1Y B;  3T9C A;  1OCO B;  3UO2 A;  2FLL A;  4HYO A;  2NU7 B;  3WWI A;  4GKK B;  5FD5 A;  4JI0 O;  3X2Q C;  1BQ0 A;  4JV2 A;  3GB8 B;  2DOS A;  5LXT F;  4DR6 O;  2HVK C;  4M0J A;  5H80 A;  4G3I A;  3ZRS A;  2AZ0 A;  1OCO C;  2Y0P A;  2P90 A;  4JV5 O;  1Y6X A;  3TEK A;  1EZJ A;  2GLT A;  3KAL A;  5DMX A;  4FE2 A;  2WLL B;  4I5S A;  1YTF D;  3ZRW A;  3MR2 A;  2BQR A;  1ORQ C;  2BCC H;  5I47 A;  2Y48 A;  1QLE B;  1Q90 D;  4LFC H;  4J9M A;  3N2G B;  2QKS A;  3U0Z A;  2F4V O;  3IG0 A;  1YEW A;  1FYJ A;  1PKX A;  5LOV F;  2VWJ A;  4YHH H;  4L87 A;  3KXY T;  4O3S A;  1IBL O;  5IYZ B;  2AQ4 A;  4MA5 A;  1SEI A;  4Z1V A;  4LF5 O;  3QFF A;  1DIK A;  3JAL B;  2QA4 V;  4DV4 O;  4OX9 B;  5KFH A;  2W6Z A;  4O4I F;  5I5V A;  3QF7 A;  4KHP B;  4I7H A;  2PY5 A;  4EBD A;  5LMU O;  1K33 A;  1GMG A;  5CM0 A;  4X88 A;  4A3K G;  1S9F A;  4DYL A;  4IR9 A;  2Q7D A;  4DR7 H;  3OSN A;  2F95 B;  1XL6 A;  5KFO A;  2QWR B;  2NN4 A;  2V4Q A;  4DUZ B;  1YDX A;  2YEV A;  4O3O A;  3MR5 A;  1KD1 W;  1MA1 A;  3L70 H;  3ZN1 A;  1SZX A;  3E22 B;  4LC1 A;  3JAK A;  1NTM H;  1G2W A;  2UUC B;  4GCZ A;  2MK3 A;  2WAM A;  2P4K A;  2YSU B;  4D7S A;  4ZOL F;  5I5W A;  3K58 A;  4X62 O;  3GLK A;  3HKE B;  4ICG A;  5A2Q N;  4DV6 B;  2PZS A;  1Z2P X;  1N32 O;  2HVJ C;  1TA8 A;  4D7T A;  3OMN B;  2EIJ B;  2HJD A;  4LFB B;  1WPB A;  5KHJ A;  1JFF A;  2C22 A;  1M4U A;  4YHH B;  1BMF G;  3J81 W;  2ARH A;  1P8L A;  1ZL8 A;  2RCV A;  5IY5 B;  2CK3 G;  5ITZ A;  2BTQ A;  2ZR3 A;  2F4V H;  2HEP A;  1DF4 A;  1B04 A;  2WA3 A;  1OWT A;  3RF2 A;  4HR7 A;  1YI2 V;  4BW9 A;  1H8E G;  4K3A A;  3B2E E;  1F4M A;  4JYA H;  4A3L G;  5JJJ B;  1DAA A;  2WLH A;  3M9O B;  4DV0 B;  4LSX A;  3MFH A;  4O3R A;  1HWY A;  2N05 A;  2HHH H;  5KFT A;  5BWX A;  1X59 A;  5KFU A;  2YUA A;  1NH2 B;  4F6E A;  5D1O B;  3H3V H;  4WFG A;  4DV7 H;  3KAJ A;  4DW0 A;  1XHZ A;  1I1M A;  5EK0 A;  4LF7 H;  1FKA O;  2AXT Z;  5BZB A;  5KMG B;  4XZ3 B;  1HNZ O;  2V9W A;  3WWH A;  1K9M W;  4TSF G;  1XNR H;  1DTO A;  4CC6 A;  3CCL V;  5EOY A;  4A3D G;  1K92 A;  1CQJ B;  4DR2 B;  2UUA O;  2QWQ B;  4FFO A;  3VNN A;  1VS0 A;  1WR2 A;  2QM7 A;  4DV5 H;  3R5F A;  2X0S A;  1NS1 A;  4DRX A;  3QQM A;  3ZRX A;  3OEE G;  3LUL A;  3U54 A;  3W1B A;  1L2Z A;  3T9D A;  2FLN A;  2C2A A;  4JZ2 A;  2R7L A;  2UXC H;  4LNU A;  5JCO C;  4J9Y B;  4R8C A;  1AJQ A;  2CDY A;  3CRR A;  4UCO A;  4YXW G;  4J9N A;  2R85 A;  4PZ8 A;  4FFB B;  5GON B;  1J95 A;  5K3W A;  1ZX3 A;  3OGI B;  2JA6 A;  4QJF A;  3I5D A;  3L75 H;  2J6S A;  4LF7 B;  1ULZ A;  1Y1W G;  5LGT A;  5KFS A;  3VBB A;  4QE9 A;  2YU9 A;  1R1B A;  1F4N A;  1SQX H;  3W7S A;  2W9C B;  1JQ0 A;  5FPR A;  4BW5 A;  3OUZ A;  4NTX A;  4X1Y A;  2JEG A;  4XDK A;  2A06 H;  5LBQ A;  5LHI A;  2OCC C;  4O7Y A;  4R7R A;  5LXT A;  1NTK H;  4QWD A;  1YSC A;  3CXC U;  1E4F T;  1Y1W A;  3P30 A;  3GDE A;  2W9C A;  2B5U A;  5J2T B;  2ZJT A;  2UU9 O;  4J9K A;  1EUD B;  1YZB A;  4J7J A;  4YJ3 A;  1IUR A;  4FU0 A;  2R93 A;  1NR1 A;  3UO3 A;  1Y4M A;  2H94 A;  5FL7 G;  3SDL A;  2ADP A;  2UXD B;  4DV2 O;  3S3W A;  2Z3Y A;  5K1X A;  4JV5 B;  1P4R A;  2E5L H;  3B8M A;  4PI2 A;  4LBE C;  1VMG A;  1SYX B;  1IBL H;  4DUY B;  1XUQ A;  5C8Y F;  4DUY O;  3FDS A;  2EJ7 A;  4X66 H;  2YZG A;  2Z02 A;  4F4X A;  4H33 A;  4XDL A;  4I4T A;  2RQ6 A;  3JAT A;  4NZN A;  4TV8 F;  2F4V B;  2UUC H;  3WB0 A;  1ZUQ A;  5H6Q A;  4FS2 A;  1Q81 W;  4FBT A;  1P84 F;  1PL0 A;  2ASD A;  2AGA A;  5IJ0 B;  5KA6 A;  3BAB A;  1XI1 A;  1WAZ A;  3MWD A;  4FZ0 A;  3L4K A;  2QWP B;  3T1Y O;  4I55 A;  2QYZ A;  4B3S B;  3F7Y C;  3HKB B;  4CH3 A;  4K0K O;  3B4S A;  1S0N A;  2P4V A;  1I2L A;  5FNV A;  5KFC A;  3G67 A;  5KS8 A;  5C3E G;  3BPZ A;  3QNE A;  2FKL A;  1ZQ7 A;  2IJJ A;  4Z2W A;  3D36 A;  1Q7Y W;  1V51 A;  3JAK B;  4ETS A;  5GON A;  1SZT A;  3W7X A;  4BAY A;  1TVK B;  5C1P A;  5IDJ A;  3ABU A;  3I12 A;  3RFC A;  4J9R A;  2Y4T A;  3HOU G;  1VEW A;  2XD4 A;  2YXY A;  1EHI A;  2VR1 A;  4NVP A;  1JJO A;  3IJ4 A;  4B3S H;  1HR0 H;  5BMV B;  3JD3 A;  1NT2 B;  3B09 A;  5GTI Z;  1VQP V;  3G6X A;  3MJF A;  2HFE C;  3CCV V;  5EYP A;  2W0F C;  2XIG A;  3FYI B;  4PDM A;  4DR1 O;  3AG7 A;  1GK9 A;  4DR5 O;  3EXA A;  2CGO A;  2QSA A;  1M56 B;  4O4I B;  3LNN A;  3RB6 A;  4X1Y B;  1SES A;  3SPI A;  3RB4 A;  4TVI A;  1WH2 A;  4MTF A;  2KSD A;  4PDR A;  3ZMZ A;  4ZHQ A;  1I5Y A;  3RIZ A;  4XDJ A;  3J7A U;  3RT3 C;  2GHY A;  4RB3 C;  1GN4 A;  1OCC B;  2SCU B;  3HOV G;  5CA3 A;  2FTK A;  4MVM A;  4TV8 B;  1P7G A;  3E22 A;  4LH6 A;  3E2E A;  5KFQ A;  3VPD A;  5EBW C;  2B1I A;  3MWM A;  2QJ1 A;  1IYE A;  3H1J H;  3OHA A;  1CPY A;  1B6R A;  1KC7 A;  3ASO C;  1AR1 B;  2BTO A;  3ZS8 C;  3KRE A;  4NR1 A;  5KAF Z;  1ZLZ A;  2HGS A;  4B3T B;  2UXB O;  4DRX B;  2VA2 A;  4WFE A;  4KUM A;  2HJF C;  1IXB A;  3M4I A;  3K5N A;  1N34 H;  1CKN B;  3PVX A;  2NVX A;  3SI8 A;  1HNZ B;  3K3P A;  3KHL A;  5JH7 B;  5BXZ A;  4HNU A;  1FJG H;  3ABL B;  4PA3 A;  4ECR A;  2HLD G;  1FXK C;  4BIO A;  2P22 C;  2DYS C;  2FP4 B;  1M7J A;  2EIJ C;  4YR3 A;  2EIM B;  2ADQ B;  4JI5 B;  1S68 A;  4B3R H;  3JD0 A;  1VQL V;  1B3Q A;  3K0G A;  3TET A;  2LJ2 A;  3HOY G;  2W6J G;  4RAZ A;  5IY5 C;  4FLZ A;  5CA0 F;  5D1O A;  1A9X A;  5KA5 A;  4LF9 H;  2WLL A;  5DN6 G;  3MWE A;  4PD4 F;  4CS2 A;  3WB1 A;  4J42 A;  3B40 A;  3OM3 B;  2YZM A;  1EUC B;  4JI8 H;  4YY3 B;  3N2K B;  4EBE A;  4UV9 A;  3DF7 A;  4R6Z A;  5KFM A;  2QWN B;  4DK1 A;  3CB2 A;  5KFA A;  4DV5 B;  5CAE B;  2WAQ A;  2IU0 A;  2FMA A;  3BQ0 A;  2ALZ A;  1OZ0 A;  3H0G A;  1O9G A;  4FPP A;  1NKD A;  2HHH B;  4MV7 A;  3CEI A;  5KG2 A;  1J5E O;  4JI2 B;  1Q5O A;  4B7K A;  3M99 B;  4CS4 A;  1THZ A;  5DM6 V;  4LF4 O;  2V4D A;  2XOK G;  2ZDI A;  1IBM O;  1K5Q A;  1IOW A;  3T5H A;  3SJB C;  2XAQ A;  5BY1 A;  4UB8 Z;  3WG7 B;  4EFE A;  5D5Q A;  5JJE B;  3Q1K A;  4LSA A;  4IRK A;  3H1H H;  2DQ3 A;  3RYF A;  3PN1 A;  1GM9 A;  3CRM A;  3STZ C;  3CC4 V;  1UC9 A;  4FM2 A;  5GON F;  1AI4 A;  1RJP A;  3FKI A;  4IT5 A;  2UVR A;  2ZXW C;  4O7R A;  4GZR B;  5D8D A;  5KHI A;  4ZBM A;  1KKC A;  4PZ6 A;  2ZIN A;  2CH7 A;  1S72 V;  2OTL V;  3T9B A;  3K0D A;  5IJ9 B;  4A3I G;  2ITD C;  5CA1 B;  1ZET A;  5DQG A;  4FS1 A;  2E74 B;  5JUM A;  4WF9 V;  1UJW B;  4RNN A;  1OJH A;  2ZXW B;  2EZP A;  1SA0 A;  3ZX6 A;  1I94 B;  4RUC A;  1EM1 A;  1IYD A;  2P7T C;  3DC6 A;  3FAV B;  2X0L A;  1O9H A;  4I9W A;  4WCE V;  1WSC A;  1BNC A;  5JJN B;  4GC7 A;  3F7V C;  4ZKI A;  3E5N A;  4M7E A;  2CTQ A;  4CZZ A;  3W7T A;  5C5J A;  4NXM O;  1FFT B;  3G4S V;  4PA6 A;  3N42 B;  4B3S O;  4X65 O;  3ICX A;  1BL8 A;  3ZRW B;  1XOU A;  1B6S A;  4ECW A;  4GKJ B;  1H2K A;  2JEI A;  3RBZ A;  4U3F H;  1M9N A;  2HGX A;  2OIG A;  3TIN A;  1IBM H;  4CH6 A;  3AK3 A;  4RB2 C;  4EB6 A;  3OTO H;  1OCR B;  4RZR A;  3TW6 A;  2ITC C;  1Y76 B;  3HPL C;  1YJW V;  4NXN B;  3MR6 A;  5DGA A;  2M7W A;  3R5H A;  4YHH O;  3G6E V;  4MT8 A;  2ZNI A;  4JI1 O;  2V5A A;  4MVU A;  3THO A;  4AI8 A;  3M9M B;  3HKD A;  2Q73 A;  4LCU C;  4U7N A;  2W71 A;  4FM9 A;  4RAI A;  5EZY F;  4U7C A;  1BZK A;  2AHY A;  1G8M A;  2Q67 A;  3GID A;  4CH5 A;  4F4L A;  4DR5 B;  4BIZ A;  4GLX A;  2E5L B;  5KG1 A;  4RNM A;  3KHH A;  3BVO A;  1VF5 B;  4B3M B;  3IC7 A;  2CNU A;  2Q8V A;  3CQZ A;  1QBZ A;  5J2U B;  3K57 A;  2DIK A;  2P67 A;  1H2N A;  3ZHT A;  2IJK A;  3EPI A;  1S5J A;  4JI8 B;  1N33 H;  1XQ8 A;  2DE0 X;  4AQY H;  1QHT A;  2JA8 G;  3KYH C;  3DTF A;  1N36 B;  1M0T A;  2W6N A;  3N2K A;  2RMK B;  1BHB A;  2EJ3 A;  4DR1 B;  3TJT A;  4NB5 A;  4MW3 A;  4H37 A;  3JYC A;  3QO7 A;  5LL6 b;  4Q6G A;  2W6Q A;  4KXR A;  2FPG B;  1BGW A;  5DED A;  2DYR C;  2F93 B;  1KP2 A;  2HHF A;  4K8Z A;  4MSW C;  2V59 A;  3QWU A;  3P32 A;  1A3G A;  4LH7 A;  2I8C A;  1GN3 A;  4UVA A;  2GUZ B;  4WBN F;  4DL4 A;  4X64 H;  3E83 A;  4OPH A;  1SS3 A;  1B06 A;  2VWK A;  2F1M A;  3T1C A;  1E4E A;  1VAR A;  2DWC A;  2VQF O;  2WAQ E;  2A3Q A;  2JGD B;  4AQY B;  2FK2 A;  4UUJ C;  3ZCC A;  2WLI A;  1TWF A;  4RZQ A;  1Z5V A;  1M90 W;  2ZKO A;  4JUZ A;  2OH2 A;  3GTQ A;  2RGV A;  5KX5 A;  5CMU A;  1XDC A;  4PA4 A;  2NUA B;  5KG6 A;  2QB5 A;  1YHQ V;  1EZ1 A;  4HYK A;  4PV1 B;  3RVZ A;  3N43 B;  4M9U A;  3ZED A;  4XX0 B;  4JI2 O;  5CBH A;  1CS0 A;  5CB4 F;  2AGP A;  4K8X A;  1JCH A;  1RSO A;  2AHZ A;  1IBK H;  2EIK C;  2BQU A;  2C2E A;  4GX5 A;  5KFK A;  5KAI Z;  1IBK O;  4U3J B;  5C93 A;  2YS8 A;  1OBG A;  3BJY A;  4MV1 A;  3CMA V;  5CBF A;  1RK5 A;  4FZ1 A;  2X5R A;  1YXB A;  4ED2 A;  2YRW A;  1N0J A;  1DF5 A;  5CA0 B;  3PW4 A;  1S03 G;  4LF4 B;  2FK3 A;  3BRC A;  3TK1 A;  2NU8 B;  4JAV A;  1EKF A;  1PM9 A;  2ZR2 A;  2AGQ A;  4H44 B;  3U0G A;  3VQX A;  2ATK C;  1QLE C;  1WA8 B;  1QR8 A;  3OR6 C;  4DV1 O;  3CC2 V;  2GPW A;  4B3R O;  3KHG A;  2R84 A;  2HIV A;  2VUM A;  1FXH A;  1VQK V;  1ZWI C;  1E4G T;  1HNX O;  3ETG A;  1G1X B;  3JAS B;  2XAF A;  3OGC C;  2PTM A;  2C00 A;  4WBN B;  4DR3 B;  4H0L B;  1NI8 A;  3GTM A;  1J5E B;  4I0X B;  3OUU A;  1V54 B;  3ASN B;  5KFB A;  1MZE A;  5HNE A;  2C2D A;  3CRA A;  2LFR A;  4AYB E;  4UV8 A;  2ZE6 A;  3H1L H;  1GLV A;  4PI0 A;  3W7W A;  3ZJZ A;  3IGA C;  1KC8 W;  5FPO A;  1N32 H;  3K59 A;  3K08 A;  2XAG A;  4X62 H;  4TQS A;  3RW0 A;  4ECV A;  1W59 A;  5L3D A;  3HB9 A;  3A0B Z;  3RV3 A;  1K97 A;  1CE8 A;  3AG3 C;  3CJH A;  2JS3 A;  4JAS A;  1KEE A;  5KFL A;  4C2M A;  4IR1 A;  4CE5 A;  1VQ5 V;  3U11 A;  4GKJ O;  4WHX A;  1R73 A;  3HO8 A;  3V6J A;  4X1K A;  3TQT A;  4LP8 A;  2R7N A;  4LR3 A;  4APM A;  4IHJ A;  1OHH G;  4O3N A;  2QGN A;  4U7O A;  5IP9 G;  4O7Z A;  5FNV F;  5LMN B;  2WSS G;  2JGU A;  2R9A A;  4DV4 B;  4OX9 O;  4LFB O;  2R8I A;  1IXM A;  2EJR A;  3IFX A;  1IBL B;  4MVR A;  1RJQ A;  2UUB B;  1W0J G;  3N6X A;  4QWE A;  1YJ9 V;  5LP6 F;  2R92 A;  2ZDI C;  2HDK A;  2X6C A;  2COJ A;  2JEF A;  3OE7 G;  3ETQ A;  2KKW A;  3OTF A;  1EN6 A;  2H3O A;  4EGJ A;  5KFG A;  4PDB A;  2FB5 A;  3ETD A;  2FJZ A;  4WFF A;  5DIS C;  3MHS C;  2FE3 A;  5LXT B;  5EBL C;  3RYC B;  2R92 G;  2ODM A;  3H20 A;  2OLS A;  1KU9 A;  2BQ3 A;  4LF8 H;  3ZHQ A;  2ZDH A;  2XCA A;  1Q3E A;  3FB8 C;  4LF9 B;  2NU9 B;  3LSU A;  4WFB V;  3JAW B;  1VF7 A;  5FLX W;  4LWS B;  4ECU A;  5KKN B;  1ZAU A;  3K5M A;  1TGO A;  4YR0 A;  5DG7 A;  5EZY B;  2JA7 A;  3SPC A;  3FB6 C;  4YY3 H;  2W9A A;  4Q0Y A;  3EVK A;  4QIW E;  3WG7 C;  1WN7 A;  4JI5 O;  4E2L A;  2YS7 A;  3KTM A;  3GII A;  3H4D A;  2CQY A;  1XNQ B;  5KG0 A;  4O7W A;  4X64 O;  4LFA O;  2QDO A;  1QQC A;  1GSH A;  1QU7 A;  5J2T A;  3SNO A;  4QIW A;  2COG A;  2WB1 A;  3SJQ C;  5H9C A;  2RDC A;  4JYB A;  1S3J A;  2ZD9 A;  2CUG A;  4U6P A;  1JR9 A;  3CVZ A;  4H13 B;  4JXU A;  5L9X A;  2GPS A;  4ED7 A;  3S3X A;  1OCR C;  1SQQ H;  4LF6 O;  1IDS A;  3HKE A;  4DUY H;  2E2I A;  3UT5 A;  2YIA A;  4IL6 Z;  5LP6 B;  3FD9 A;  1NTZ H;  5DAA A;  1BHA A;  1CKM A;  4DR4 H;  3VOT A;  3RAX A;  4RB1 A;  2DJV A;  4DR4 O;  2EIL C;  1GRJ A;  4FFN A;  4IGG A;  4BXX G;  3HBL A;  4LNU B;  1M1K W;  2BSK B;  4IWX A;  4GKJ H;  1WP8 A;  4MAM A;  1CEZ A;  3ZHR A;  1Y1V G;  2VUM G;  5KFV A;  3GTK A;  1N36 H;  1UC8 A;  4NLG A;  3OW2 U;  1COW G;  3D8C A;  1AP5 A;  1TWG A;  1XBL A;  2C28 A;  4DV1 B;  2YIB D;  5FD6 A;  2I87 A;  5LMU H;  2BR0 A;  1ZL8 B;  3H0G G; 
#chains in the Genus database with same CATH homology
 1N33 B;  3F8N A;  4O4I B;  4O2A A;  4UCV A;  3LNN A;  3VQY A;  4X1Y B;  1FKA H;  4LF5 B;  2JVD A;  1WH2 A;  1FJG B;  4JI1 H;  4DR3 H;  4JI7 B;  4ZHQ A;  4B3R B;  3RIZ A;  3U10 A;  3N2G A;  2ZM6 B;  4JI5 H;  2UUA H;  2P5O A;  4RB3 C;  5CA0 A;  1MZB A;  4TV8 B;  3N40 P;  3QTC A;  3J80 W;  1FFX A;  4FFB A;  3E22 A;  3RYI A;  4LH6 A;  1HNX B;  1XMO H;  2UXC B;  3JSN A;  2ZNJ A;  4DUZ H;  3CHX A;  5LOV A;  3MWM A;  2QJ1 A;  2R70 A;  4B08 A;  2Q2U A;  4MTE A;  5IWA H;  4EEQ A;  4KHP H;  2BTO A;  2VQE H;  3ZS8 C;  4WBN A;  4KL1 A;  3VQV A;  4K0K B;  5LA6 B;  2HGS A;  4B3T B;  4X1K B;  4DRX B;  4I9Q A;  3RR5 A;  4DV1 H;  3EYY A;  2BTQ B;  3M4I A;  3K5N A;  1N34 H;  1CKN B;  4AHC A;  3RGZ A;  2CW7 A;  1XDN A;  1HNZ B;  5JH7 B;  1FJG H;  3HXL A;  4PHZ A;  4DR1 H;  4IAJ A;  1J5E H;  2P22 C;  1TUB B;  2UUA B;  4ZIB A;  4JI5 B;  1S68 A;  2VUG A;  2CW8 A;  5A2Q W;  5BR8 H;  3JAR A;  4B3R H;  2ZIM A;  2UXB H;  2ZIO A;  4A2B A;  4LFB H;  4RAZ A;  4FLZ A;  3FFQ A;  5D1O A;  4LF9 H;  1TAE A;  4LFC B;  3WB1 A;  4CS2 A;  2UUB H;  3BA8 A;  4LMY A;  3GJX B;  4JI8 H;  4TV9 B;  4YY3 B;  4MTD A;  3N2K B;  3DF7 A;  4DK1 A;  3CB2 A;  4JYA B;  5JCO A;  2QM4 A;  4O2B B;  4DV5 B;  4JI3 H;  4UCT A;  1ZHS A;  1O9G A;  5EIB D;  1XK5 A;  2HHH B;  4MV7 A;  4JI2 B;  1Q5O A;  4AIL C;  4O4J B;  1A0I A;  4IIJ B;  4CS4 A;  4FM0 A;  1JFF B;  4GKK H;  2V4D A;  4JI0 B;  1IBK B;  4O4H B;  5BR8 B;  1M0W A;  3SJB C;  2VPS A;  2W57 A;  4LSA A;  4EFE A;  5JJE B;  5D5Q A;  1HNW B;  1XNR B;  1BJT A;  2VQF H;  1V9P A;  2Q7G A;  3T1H B;  4X20 A;  3RYF A;  3PN1 A;  2WE6 A;  3N44 B;  4U3J A;  3BAA A;  2GV9 A;  4FM2 A;  4I50 B;  4YJ2 B;  4ZI7 B;  4DR6 B;  4DV3 H;  2E3C A;  4FVM A;  4DV2 B;  2HVQ A;  1SA0 B;  4BWS C;  3NC0 B;  5KHI A;  3RGX A;  3K5L A;  4PZ6 A;  4X64 B;  2ZIN A;  4NXN H;  4LF5 H;  5IJ9 B;  4DR2 H;  5CA1 B;  3SR2 C;  4JI3 B;  5KX5 B;  3JAL A;  4FLT A;  4LF8 B;  3SJA C;  1SA0 A;  1I94 B;  1M5I A;  5IYZ A;  3RWR D;  2CAZ C;  5JQG A;  1O9H A;  1DGS A;  3A2F A;  4I50 A;  4X1I B;  4YJ2 A;  3MAQ A;  2UXD H;  5JJN B;  3RTX A;  3C0F B;  5JVD B;  3NBZ B;  2WDT A;  4JI4 B;  3RYF B;  3WB2 A;  4A2A A;  3RYH A;  5IWA B;  4M7E A;  5LMN H;  4GYC B;  1XMQ H;  2HIX A;  4X65 B;  3RYH B;  2WYO A;  3N42 B;  3ICX A;  3T1H H;  4X66 B;  2HVR A;  2MCT A;  5D1P A;  3HKD B;  4GKJ B;  5JQG B;  3RJ0 A;  4IIJ A;  4DV3 B;  4O4J A;  3S24 A;  2EX3 A;  1IBM H;  1L8D A;  4CH6 A;  4RB2 C;  4EB6 A;  4UFZ A;  3OTO H;  4F6R B;  4LF4 H;  4FLY A;  1CKO A;  4LFA H;  4NXN B;  4UCS A;  2JS5 A;  5IJ9 A;  4TOI A;  4F6R A;  4B3T H;  5KHG A;  4JI1 B;  2ZNI A;  3DSQ A;  4X65 H;  3THO A;  4NXM H;  2R72 A;  1D5A A;  3HKD A;  4FM9 A;  2YXL A;  5J2U A;  3JSL A;  4X20 B;  4CH5 A;  4JI4 H;  4DR5 B;  2OYQ A;  2Q2T A;  4TQF A;  5C8Y B;  5C8Y A;  4GLX A;  2E5L B;  3L4J A;  4B3M B;  4RB0 A;  4LFA B;  2PYJ A;  5JVD A;  3SJC C;  5J2U B;  4X1I A;  3K57 A;  2UU9 B;  4DR4 B;  2VQE B;  2OWO A;  4PZ7 A;  4DV7 B;  3T1Y B;  5K1P A;  1S5J A;  4X62 B;  4GKK B;  4JI8 B;  5FD5 A;  1N33 H;  1XQ8 A;  3UQ8 A;  3N41 B;  4AQY H;  1QHT A;  3GB8 B;  3KYH C;  3M7M X;  4EB6 B;  1N36 B;  1M0T A;  3N2K A;  1HW7 A;  1HR0 B;  4TV9 A;  4DK0 A;  4DR1 B;  4OX9 H;  5LL6 b;  1I6U A;  4Q6G A;  1GYF A;  4ZI7 A;  5LOV B;  1BGW A;  3KAL A;  4JI2 H;  1SQG A;  2F93 B;  4K8Z A;  3QWU A;  2HVS A;  1Q8I A;  1Z2N X;  1KMI Z;  2O03 A;  4LH7 A;  2ZCE A;  4JI0 H;  4JI7 H;  3JAR B;  4LFC H;  2YCH A;  4X64 H;  3N2G B;  2PUS A;  3U0Z A;  3IG0 A;  1TUB A;  4ZHQ B;  4B3M H;  2VWK A;  1YEW A;  2F1M A;  4UCU A;  1XNQ H;  2VWJ A;  4AQY B;  4YHH H;  3TY5 A;  4LF6 B;  3KXY T;  5IYZ B;  5IT9 W;  4CC5 A;  1SEI A;  4RZQ A;  4FLV A;  1Z5V A;  3JAL B;  4OX9 B;  2RGV A;  5KX5 A;  3QF7 A;  4KHP B;  4I7H A;  4O2B A;  5CA1 A;  2PY5 A;  3N43 B;  2F95 B;  4ZOL B;  3ZED A;  1XHX A;  5LYJ B;  4DUZ B;  4K8X A;  1RSO A;  1IBK H;  2CFM A;  1JMK C;  1AN7 A;  2VOB A;  4U3J B;  4FLW A;  3E22 B;  3JAK A;  2UUC B;  4D7S A;  5CA0 B;  1XMO B;  1HNX H;  1S03 G;  3OTO B;  3K58 A;  4LF4 B;  3BRC A;  3HKE B;  1Z2P X;  4DV6 B;  2PZS A;  1N32 B;  4RAY A;  4O4H A;  1TA8 A;  4D7T A;  1T5E A;  3VQX A;  4LFB B;  1WPB A;  3VQW A;  5KHJ A;  1JFF A;  1M4U A;  4YHH B;  5JH7 A;  4O2A B;  4O4I A;  3J81 W;  2HIV A;  1P8L A;  1CKN A;  2XHB A;  5ITZ A;  1SKV A;  2BTQ A;  5IJ0 A;  3J7A K;  2F4V H;  2HEP A;  3IAY A;  1N34 B;  1B04 A;  4HNA A;  1E4G T;  3RF2 A;  1Z2O X;  5D5P A;  4BW9 A;  5LA6 A;  4I4T B;  3JAS B;  3B2E E;  2Q7E A;  2PTM A;  4JYA H;  4WBN B;  4DR3 B;  5JJJ B;  3CSX A;  1FVI A;  4DV0 B;  4LSX A;  1J5E B;  1O75 A;  5LP6 C;  2HHH H;  2VQF B;  2UXB B;  4FM1 A;  3RYI B;  1G6U A;  5D1O B;  4FLX A;  1FFX B;  4TV8 A;  4CH4 A;  5KHK A;  4DV7 H;  2KSW A;  3KAJ A;  4PI0 A;  1XHZ A;  3TY8 A;  4LF7 H;  5FPO A;  4DV6 H;  1N32 H;  3SGI A;  3K59 A;  5KMG B;  4X62 H;  4YJ3 B;  5LMU B;  1XNR H;  4CC6 A;  5EOY A;  1M93 A;  2Q0A A;  5CB4 A;  4DR2 B;  3RYC A;  4CS3 A;  1VS0 A;  3VNN A;  4O4L B;  4DV5 H;  3U11 A;  5EYP B;  3FMA A;  4JI6 H;  1WNS A;  4BWA A;  4DR7 H;  2RJZ A;  5BMV A;  3T1Y H;  4X1K A;  4DRX A;  3JAT B;  4LR3 A;  3W1B A;  4EFB A;  4APM A;  1L2Z A;  3LML A;  4IHJ A;  3BA9 A;  2UXC H;  4LNU A;  5JCO C;  5LMN B;  2JGU A;  2R9A A;  4DV4 B;  4JV5 H;  4TQD A;  4UCO A;  4J0M A;  1I94 H;  5KHH A;  3RGB A;  5EZY A;  1P16 A;  4PZ8 A;  1H2S B;  3TY9 A;  4FFB B;  5GON B;  1HNW H;  4LF6 H;  1IBL B;  4UCR A;  1I7F A;  2Q7H A;  2UUB B;  3N6X A;  4LF7 B;  3HKC A;  3BHP A;  5FNV B;  3ETQ A;  2KKW A;  3OTF A;  4PDB A;  4DV2 H;  3HKB A;  5FPR A;  4X1Y A;  4I55 B;  4TUY B;  5DIS C;  2FE3 A;  5LXT B;  4R7R A;  3RYC B;  5LXT A;  1E4F T;  4JI6 B;  4K0K H;  3GDE A;  1P49 A;  5J2T B;  2ZJT A;  1KU9 A;  3H20 A;  4LF8 H;  1XMQ B;  4YJ3 A;  1Q3E A;  5KMG A;  3W5O A;  3JAM W;  4LF9 B;  3JAW B;  2UXD B;  1VF7 A;  1ZHQ A;  5FLX W;  1HNZ H;  3RFR A;  1ZAU A;  5K1X A;  3K5M A;  1TGO A;  4JV5 B;  4DV4 H;  5EZY B;  1TVK A;  2E5L H;  4PI2 A;  3KAK A;  4YY3 H;  4Q0Y A;  1SYX B;  1X9N A;  1IBL H;  4DUY B;  1WN7 A;  4X66 H;  2UU9 H;  2RGR A;  5LP6 A;  1XNQ B;  3UT5 B;  4I4T A;  1Z5W A;  2RQ6 A;  3JAT A;  2F4V B;  4EQ5 A;  2UUC H;  4HNA B;  3WB0 A;  1QQC A;  5J2T A;  5IJ0 B;  2PGG A;  5ITZ B;  3BAB A;  1XI1 A;  4O4L A;  3L4K A;  2YI8 A;  4TUY A;  4I55 A;  5CB4 B;  3K3V A;  1SQF A;  1X4T A;  3CVZ A;  4B3S B;  3HKB B;  4CH3 A;  4MV9 A;  2F66 C;  5FNV A;  3HKC B;  3HKE A;  4DUY H;  3UT5 A;  2ZM6 H;  2YIA A;  4DRF A;  3BPZ A;  5LP6 B;  4NXM B;  1CKM A;  4DR4 H;  3JAK B;  4ETS A;  3W1G A;  5GON A;  4RB1 A;  4DR5 H;  3NBY B;  1TVK B;  4DV0 H;  2IM9 A;  4LNU B;  5EIB C;  3QG5 A;  3JAW A;  4L8J A;  5LYJ A;  4GKJ H;  2YI9 A;  4IHJ B;  4ZOL A;  4E6N A;  3JAS A;  4DR7 B;  4NVP A;  1IBM B;  1JJO A;  3K5O A;  3L2P A;  1N36 H;  4B3S H;  1HR0 H;  5BMV B;  1NT2 B;  2YIB A;  4FLU A;  4DR6 H;  4DV1 B;  5EYP A;  4HBN A;  2XIG A;  2YIB D;  5FD6 A;  5LMU H;  2PYL A;  1Q43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...