3BA9A

Structural basis for inhbition of nad-dependent ligase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
313
structure length
313
Chain Sequence
PLTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Inhbition of NAD-Dependent Ligase
rcsb
source organism Enterococcus faecalis
molecule tags Ligase
molecule keywords DNA ligase
total genus 102
structure length 313
sequence length 313
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3ba9A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3ba9A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3ba9A02
3OTOB 1XMOB 3KYHC 2Q2TA 1HNWB 3TY8A 3JSNA 3BABA 4GLXA 3UQ8A 4PZ6A 1N33B 4JYAB 4UFZA 4JI3B 4JI0B 4TOIA 4DV5B 4JV5B 4EFBA 2F4VB 5LMUB 5D1OA 4DR2B 2ZM6B 4LF8B 3GJXB 4JI5B 4DR4B 4UCOA 5FPRA 4LF6B 1XNRB 1CKOA 1ZAUA 2UUAB 1IBMB 4K0KB 3NBYB 3NBZB 4B3RB 1TA8A 3NC0B 4EEQA 4PZ7A 3TY9A 4LF4B 5D1PA 1N36B 1XMQB 1FVIA 4NXNB 1XNQB 5FPOA 4LF7B 4JI6B 4DR7B 5LMNB 4E6NA 3S24A 1IBLB 4UCVA 5D1OB 1N34B 4LF9B 3GB8B 3T1YB 3W1BA 1CKNA 5BR8B 3VNNA 1V9PA 2UU9B 1XDNA 1VS0A 4DRFA 3PN1A 4CC6A 2HIVA 1IBKB 4GKKB 2UXBB 4DUYB 3RR5A 3T1HB 4X64B 4DR1B 1X9NA 1HNZB 1P16A 4DV0B 1B04A 2UXCB 4DUZB 4DV3B 4LH6A 4JI2B 4LFBB 2HIXA 1A0IA 2UUCB 3SGIA 4DV1B 3BAAA 3BA8A 3BA9A 5IWAB 2E5LB 4PZ8A 4KHPB 1CKNB 2HVRA 4JI7B 3JSLA 4JI4B 4UCTA 4EFEA 2OWOA 4X65B 1J5EB 3QWUA 4B3MB 4EQ5A 4DV4B 2Q2UA 2HVQA 2VUGA 4LH7A 4UCRA 5DISC 2CFMA 2UXDB 1XK5A 4DV6B 4LFCB 1CKMA 2VQFB 2VQEB 1N32B 4DR3B 3W5OA 4B3SB 2HVSA 4JI1B 4DR5B 1HR0B 4UCUA 1P8LA 4DR6B 4LF5B 1FJGB 4B3TB 3W1GA 1TAEA 4X62B 3TY5A 1S68A 4UCSA 4YY3B 4LFAB 2HHHB 4GKJB 4AQYB 4X66B 3GDEA 3RTXA 4JI8B 2UUBB 3L2PA 4YHHB 4DV7B 4DV2B 1HNXB 1DGSA 4CC5A 4NXMB 4OX9B 1I94B
chains in the Genus database with same CATH superfamily
3OFNG 2A1HA 3ZRXA 3OMAB 2DN9A 1AUVA 3TY8A 4F50A 4PDLA 2ZR3A 1P7GA 3UM7A 4ZHQF 2ZIOA 1COWG 5CR5A 2OH2A 3ZMVA 3T1CA 2ZQMA 4JI0B 2UXBO 3SJCC 1VQMV 3R66A 4DV5B 5LMUB 2HJWA 5D1OA 3ABKC 1XOUA 1OCOC 2E75B 4ZKIA 3K5MA 3OW2U 4BR6A 5BMVB 3ZX6A 2UUCO 4LF6B 3GIMA 2EULA 2QDOA 3E86A 3U10A 2FK1A 1HW7A 1KB9F 1R3IC 4LR3A 2JIZG 4HAMA 1N36B 4AYBE 4YP3A 2UXNA 4APMA 3CPWU 2FLNA 4DV1O 2PN1A 2LFRA 3OD4A 3SYAA 1GSOA 2WLKA 5CBFA 1RK6A 5L3DA 2I80A 4RCNA 3JAMW 3BY6A 4FZ0A 3RVZA 1Y1WG 2P0AA 3W1BA 1CE8A 1XNQH 4FIPC 5L1JA 2CKZB 1S97A 2OT5A 2EIKC 4ZHQB 3TEKA 1I08A 4K0KO 5IYCG 5LMUH 3JD3A 4ETSA 3FFQA 2E5LH 4ED8A 1P16A 4DV0B 4O81A 2CK3G 2WLIA 4TV8A 2VRZA 3CHXA 4B3SO 2KKWA 5IT9N 3RV4A 4Q8EA 3TJTA 1H2LA 3BCCH 4DV1B 4HZ3A 1FS0G 4X89A 4QSHA 3N6XA 2HGWA 2PVPA 2NVYA 1WA8A 1I2LA 4MTFA 2MCTA 5GONB 2FPPB 4JI6H 4H13B 1K92A 2CQYA 1Y6XA 3RYFB 5BWWA 3J7AU 3AG3C 2WLLA 3WNZA 1JVMA 4N23A 3PO3G 4KFMA 3ZRSA 1BJTA 3HKDA 3JATB 3AG4B 2LQTA 1BHAA 1Y74B 5B1NA 1Q6UA 5B1BB 3U9TA 1HR0B 1IXBA 2Y48A 2M05A 1SKVA 3FAVB 2GUZB 4DXWA 1ZL8B 4YJ2F 5CMUA 1S68A 3DTGA 1SESA 3EFFK 3GDEA 5E79Z 3ABMC 1S0NA 4IGGA 5DM6V 2HGXA 2W9CA 4IIJF 1E4GT 1S72V 3ETEA 3OE7G 4O4HA 4BW5A 3OUUA 1QLEB 3AK1A 1RYSA 3PR4A 5JQWA 1AN7A 1KKCA 2RGRA 2F1MA 3MFHA 4PZ6A 4FVMA 4RUEA 4HYOA 1CPYA 3AW8A 4RAYA 3RIZA 4LF6H 2JA8G 2UXDO 4I55A 2YIBD 5A2QN 1IBKH 3FX7A 5IYCO 5FD5A 2AQ4A 4QPJA 2YZGA 1TWGA 2PY5A 4K6NA 3H0GG 1XUQA 3CCJV 3T5LA 4LFBO 4J9NA 5EWGA 1XHZA 5B3SC 4WBNF 3T9BA 4YR3A 1KP3A 3NBYB 5EIBD 3HT5A 1WB7A 1OCZC 5KFKA 2WE6A 5F9NA 4LBEC 2IJKA 2ZM6O 2DYSC 1VF5B 4ECQA 1SFOA 2QTOA 4O7RA 4HYKA 1K34A 2XAQA 4LP8A 1BGWA 2X6CA 5IWAO 3SPGA 4DV5O 2W71A 5IJ9B 1Q86W 3SE7A 1PV0A 1ORQC 2YZLA 3GB7C 4O7LA 2XGPA 2EJRA 5KA5A 2NU9B 5LGUA 2J6UA 3OHAA 4MV1A 5ITZB 3RBZA 2R6FA 4RB1A 2W8KA 3Q8RB 5KFUA 4QWEA 1X9NA 3OUSA 1N36O 2DJVA 3CXCU 4O7VA 5KFXA 1EM1A 1VF6A 4RQEA 4NTYA 5KFRA 1O9GA 5BWVA 1Q3EA 5IWAB 3RAXA 2LP7A 4GZRB 4MTGA 4HN2A 2VQEH 1P84F 4IL6Z 4UCTA 3OSNA 3GTPA 2CE4A 1GN4A 2D2CB 3VQVA 3BQ1A 3QWUA 4B3MB 2VUGA 4LH7A 5D5PA 3TW7A 4DK1A 2AGPA 4WHXA 3M9MB 2IMWP 1CKMA 5E25A 3MR3A 4DR3B 2O03A 4CH4A 4B3SB 3CX5F 1H2KA 4QIWF 4JI1B 4CH3A 5C5JA 5KT6A 3LNMB 4FLZA 3ZHUA 4RB2C 1KMIZ 3GIQA 1Z5WA 4P9PA 4AQYB 2HKOA 4AILC 2RQ6A 2ZXWB 1SRYA 4J42A 4J11A 4CS3A 3CCUV 4JI2O 2YCHA 5BY1A 1FFTB 4M0JA 1GN6A 3VPCA 1Q43A 1HNXB 1QLEC 2CTQA 2Z3YA 3N2GB 3HOYG 5HFMA 2XCAA 2LW7A 1XI1A 3QZ7A 1XQ8A 2A3QA 3BABA 2Q7DA 1AR1B 4IZOA 2KB1A 1FXKA 1V4YA 3N8DA 2L35A 4O3SA 4IHJA 2Q9LA 5BR8H 2VA2A 4RAZA 2X6AA 3OR7C 3SR2C 3ORQA 2F4VB 5KFQA 4LF8B 2ZDHA 2UVWA 1CXZB 3APOA 4JZ2A 1Q82W 4C5AA 5H6RA 3I12A 5DQGA 4J9RA 2UVVA 1N33O 1B6RA 2R8HA 3OEHG 4MV9A 3HB3B 1YTFB 3R5HA 3I56V 4YQWA 2YDEA 3QF7A 2PI5A 5DGAA 2IM9A 5HV6A 2P5OA 1KBLA 2DMXA 2WB1A 1SETA 4YHHH 1EBOA 3A2FA 2LGQA 2PI4A 1HNXH 3CC2V 3RYIB 5BWUA 2JS5A 5FPOA 1DV2A 1K8AW 4ED0A 1WR2A 2IH1C 5BWRA 4A3DG 2YWVA 3HOVG 1IBLB 2Q69A 5EWEA 4J7JA 4QW8A 3TXSA 2ALZA 3FB6C 5KA6A 3T1YB 1C30A 1VARA 2QKAA 3N2KB 1CS0A 3CE2A 1G6UA 3CRMA 1AROP 4LCUC 3WO0A 4JV1A 5L3BA 4I7ZB 3AG1B 3UO3A 4JYAO 5DGHA 1QBZA 5AG2A 2JEIA 3BFRA 3ZMZA 4ECTA 2FKXA 4B3TH 1GM9A 3MJFA 4YY3H 3G6YA 2R8KA 1SA0B 4NB5A 4P30A 2DIKA 2Y0PA 3OMNB 3ASOB 2R93G 4HNUA 4F4YA 1KU9A 2E5LB 5LYJF 2AW9A 4W4LA 2XAFA 4EB6B 2HVJC 4A3IG 1GM7A 5KFOA 1PK8A 4DR3H 4RAIA 2V5AA 4JI1H 2XGQA 2ASJA 2Y4RA 3CWBH 5BMVF 4GC7A 2QJ1A 4LF5H 2AZ0A 4O4LA 2VA3A 3LDCA 4FLXA 5IYDG 3SJAC 1T5EA 3CC4V 2Y4TA 2P90A 2ODTX 2F43G 1WCMG 4J10A 2GPSA 1FJGB 1VIBA 3H1JH 1QVFU 2QE7G 2E5LO 3NXSA 1AI6A 2HHHB 4JV5O 4A5UB 1ULZA 3U54A 2V9WA 4PA6A 3IFXA 4BIOA 2FMLA 1GSHA 1CP9A 2HFEC 2YW2A 1OCOB 1NVPD 1S0VA 3T2MA 4Q8FA 1BE3H 2HIXA 2YXLA 2IJHA 3KYHC 1ENVA 5B66Z 3D8CA 4O4IA 4JI1O 2ZE8A 4ECVA 5KFBA 4ICGA 1S5JA 4EEYA 4NVPA 3F5TA 1OCZB 4QGPA 1OBDA 1TWCA 5I5WA 1B6SA 3U11A 1IYEA 4FM2A 2HHHO 4E4EA 3WU2Z 4J9PA 4JTDB 1Q5OA 1SS3A 4JPRA 1PD3A 1GN3A 4RZQA 1Y74A 4UCOA 3JRXA 1PL4A 2CH7B 1IBLH 3Q4HA 5I60A 4RUCA 3CSWA 2X0LA 2GQRA 4YJ2A 4DUZO 1I1MA 4QWBA 5KHJA 2EBOA 3L9DA 2DWCA 5LL6b 5KG7A 1Q8IA 4YJ3F 1TWHA 2QWPB 5DQHA 1AVMA 3OTOH 4DAAA 3SNOA 5C8YB 3MWEA 2C2RA 4O4HB 1PM9A 3MAQA 1NTMH 5BPHA 4I4TB 5C8YF 1KC7A 3T9FA 1LUVA 3CS5A 5KX5B 4I4TF 1R6NA 5L3EA 3SYQA 4P2ZA 4ED2A 1V9PA 1RJRA 3PN1A 5IJ0A 1A9XA 1E79G 4JI0O 3WB2A 2UXBB 2YXHA 2Z04A 2RJZA 1VAJA 3N41B 1R1BA 4NLGA 4EGQA 4MTOA 3NUAA 4JI7H 1Z2PX 4DUZB 1R9TA 4MV7A 1EZ1A 2UUCB 3N2GA 4LF6O 2JEXA 4MVSA 4D7SA 4GLWA 2ZJTA 2R92G 1XL4A 3BA9A 4X62O 1V55B 3K9SA 2BTQA 3JARA 2W57A 2P7TC 4LFAO 1S5LZ 3KKYA 4DW0A 1HP8A 3T1YO 4O4LF 2YZNA 5IP7G 4NR1A 4B08A 4DR7H 3QO8A 4EFEA 4X65B 4DV3O 1J5EB 4P9OA 3GTQA 2Q2UA 2Q6AA 4O7TA 1ROPA 1SC5B 4M7EA 1N0NA 1N33H 5DISC 4FLTA 3WG7C 4OX9O 4X1IB 3FKIA 4M9UA 2CTWA 3AX6A 3NR7A 1B33N 2AGOA 4FGRA 3VQYA 2Y69C 4FLWA 3LMLA 5KHHA 2R9IA 3DC6A 5FLXW 4X62B 2VS0A 5CA1B 2PTMA 2ZDGA 4RQFA 2EIJC 1L8DA 1BS3A 2YSUB 5H2FZ 1R3LC 3MR2A 2B9ZA 2HG8A 2I87A 1JXLA 1P4RA 2FYUH 4CKEA 5KLVH 5C44G 3JD2A 1EZVH 4QE7A 5DG9A 3ZMTA 2UVUA 3GTGA 3K79A 5BXZA 4ECRA 2BE3A 3SPHA 1KC8W 2C2DA 2BR0A 2YXYA 5D5QA 3E8GA 1FJGO 3EPGA 3JASB 5E1AC 3T9EA 3RYCB 3H1KH 4JV5B 5CM0A 4XYLB 2XCPA 1DTOA 1VQOV 1R3JC 4DR4B 3RB6A 1D2DA 1IBMB 2JA7G 1K73W 1QCEA 3HOWG 4X88A 4J9QA 4DV2H 4XDKA 3UO2A 2WLLB 1XNRH 1O75A 2WLIB 4TV8B 5KG6A 4D6TH 5BZBA 1G4YB 5CBGA 4O3NA 4JI7O 1CQIB 4RO2A 5JQGB 4LF4O 4K3AA 4X9QA 2GUZA 1GLVA 3ZN1A 1FXKB 2R7KA 1IBKB 5FJ8G 2UUCH 2Y0IA 3MDSA 5JH7A 2ETNA 3E89A 4D7TA 1AUXA 4AYBA 2HHFA 4IR1A 1PNMA 3FYIB 1WH2A 2DE0X 3U0ZA 1PX2A 3PW7A 3ZJZA 2JA5G 4WFGA 3CMAV 4LFBB 1OBGA 4ZOLA 2ILMA 1QQCA 3FD9A 4O7WA 4DL6A 2ITDC 3H1HH 3GTOA 4DV6O 1BL8A 2IH3C 3G8DA 2W70A 4KHPB 4HNTA 2NUAB 3TINA 4MV4A 2AXTZ 2RN9A 1JOYA 4C7UA 4ZQIA 1AI5A 3LWBA 2P22C 3ASOC 3J81W 5B1AC 2E2IA 1YF2A 3E8FA 4E2LA 3Q2OA 3MR5A 1YZBA 2Q68A 2ZGIA 4FFMA 2P4VA 3HOUG 1NTZH 1S3JA 1QR9A 2HR3A 5CA3A 1YJWV 3OSPA 1BCCH 4EG0A 3G6XA 2Y0SA 3I4MG 5A9GA 2COGA 2XAHA 4JTCB 1VKZA 4RZRA 2PBZA 4LFAB 4IWXA 2YU9A 4TQFA 3CEIA 1RFYA 5A2QW 4FM9A 4O7SA 4FM0A 4WBNA 1IYDA 1N8RW 1O9HA 4J80A 1J5EO 2DPJA 4PWQA 1RSOB 1K7DA 2A06H 2DPIA 3KHGA 2P4KA 5I5SA 3D3IA 4OX9B 5KX5A 2QWRB 1VQ6V 3JZ6A 3CYOA 4DQNA 1XMOB 5IYBG 2KSDA 3OGIB 3OTFA 4JV5H 1SQVH 2YS7A 2J6SA 2EIJB 4LSAA 2JGUA 4B3MO 5ITZA 3ABUA 4JI6O 4PDBA 4JI5H 4PHZA 4LF7O 5K2MA 3N43B 3V6KA 5KG3A 1H2GA 1OZ0A 2Y69B 1K3EA 2XNDG 3RW0A 3ZMUA 5IYZB 5FLMG 1IBMH 3EPIA 5L9XA 1I50A 1SEIA 2CDYA 3DF7A 4O4JB 2VPSA 2OCCC 1YVWA 2W6PA 1ZX3A 2ZNIA 4YR2A 4DV0H 3ASNB 4JI3H 2LGWA 2DZDA 3NC0B 4CBCA 2PMZE 3KALA 3RVYA 1GO3E 4DV1H 5EYPB 4J9MA 2Z5UA 1K1QA 3CJHB 2EJ2A 3HB9A 3QTCA 5J2UB 1FVIA 4Q20A 4NXMH 4JI6B 2BSKA 3ZCCA 2DWEC 4ZIBA 3L4KA 5CA1F 3ZIAG 4I50A 4B7EA 2H3OA 1FKAO 1VEWA 3CRCA 3N44B 2EIYA 1SERA 3JZFA 3T9AA 3G4SV 2RNBA 4DR4O 3VNNA 3PZPA 2CNVA 3JCZA 3HKCB 3GIJA 2CTPA 4UV9A 2NU7B 4LFBH 4FM1A 2R85A 4R8UB 1KJQA 2OLSA 3G67A 4RWUA 1A0GA 3ZHRA 4LH6A 5C8YA 3WG7B 2UU9O 3K3VA 4QIWA 4BXXG 4NYKA 3OAAG 3BA8A 2N05A 4DRXA 4Z2WA 2CNUA 4FFNA 3IAYA 4IRCA 3T9DA 3AG7A 1GK9A 2HVRA 5KFMA 4JI7B 1C3OA 4XZ3B 3AK2A 2YEVB 3CCVV 4QWCA 4G28B 4PD4F 3KREA 1IBKO 3T1YH 2RDCA 5B1BC 2BTOA 2FPIB 1MZBA 4R7CA 1B06A 4R7RA 1RYRA 4HNAB 4IYHA 4ZOLF 2KG7B 2WA4A 2QF7A 1P8LA 3K03A 5DLFA 4C5BA 4B3TB 2DQ3A 4IHJF 4IHJB 4UCSA 4ECXA 5KHKA 2XD4A 3WWHA 1FPOA 2HJFC 4MA5A 3TIGA 5FNVB 3L2PA 1TUEB 1NR1A 1IVSA 4X1IA 4X62H 3RT3C 4CS4A 5CB4B 1I94B 5EZYF 4B3RO 2YIDA 3VQWA 4FU0A 2H94A 2BTQB 1JDEA 3CRAA 2GQSA 3OHBA 2ATLA 1XBLA 3CMEV 2Z0AA 2NLJC 3W7SA 1GH6A 2QWQB 4MVOA 3T99A 4KXRA 3SJBC 1VQKV 4OPHA 3B4SA 2W9BA 1SA0A 1YTFD 2ZM6B 2HVKC 4X64H 2EX3A 1RJQA 3ML0A 2Q73A 3DTUB 2DWDC 3E2EA 3ZRWB 5KFEA 3DXRB 4BBSG 2ADQB 5J2TA 3HPLC 5IYZF 2C28A 5KFGA 3GV5B 2HEPA 1OJHA 3FKSG 5CA1A 3AK3A 1A3GA 5LL6Y 2WSSG 4DR4H 1JLLB 3THOA 3AYHB 4LF7B 1P7BA 3ABTA 2XASA 4K0KH 5I5XA 1TGOA 2FB9A 5D1OB 5KFSA 1NBMG 2DAAA 3ABLC 1V55C 3HKZA 4JYBA 3RGZA 3GTMA 2DW4A 2R72A 3GTJA 4NXNH 5EK0A 4DL2A 2JA7A 4CKCA 4TQDA 1OWTA 3HKEA 4CKBA 2R87A 4U3FH 5HBRB 1VQLV 3VBBA 1E1QG 3JASA 3RBEA 1JFFB 3GIIA 1N32O 3NGDA 3LDDA 1MA1A 2Q7GA 2GPWA 1W59A 5KUKA 1FXVA 2W0FC 3AEIA 4O7NA 3FDSA 4GUNA 3GTLA 3STLC 5I5YA 3GV7B 4NXMO 4NZMA 5KG5A 4FFLA 1H2SB 1L1FA 1EKFA 2FJZA 3CB2A 1ZHSA 1Y1VG 3ETDA 4X66O 1OCCB 4LF7H 4OGQB 1THZA 4JI8O 5JH7F 3N27A 5JH7B 4I9WA 4H37A 1I2KA 1KT8A 4LWSA 1UC9A 1T36A 3K5LA 4QNHB 4ECYA 1N32B 4GKJH 3VPDA 4Z1MG 4CMFA 2IBKA 4XX0B 2F4VH 1JA8A 2OTLV 2DYRB 3IC7A 4O4IB 2JGDA 5B5EZ 4X20A 1NS1A 3DC5A 2ZR2A 5GONA 1VQNV 1I94H 3FB7C 4KUMA 5J2UA 5GTHZ 4X66B 1S0MA 1QU7A 1YSCA 4JGSA 2FP4B 3GQCA 4I9QA 1I1KA 4DK0A 2VUMG 1UPGA 3BG5A 4G3IA 1KP2A 2VWJA 3HO8A 5LMNH 2Q67A 4LFAH 3B09A 4CMDA 4X65O 1N33B 2IA6A 2ZDQA 2B1IA 4YJ3A 4FLVA 4GKKO 5HFLA 1SCUB 2ZD9A 1GAXA 3HXLA 5DQIA 2V4RA 4UVAA 2E3CA 2EZPA 1EUCB 1K4CC 3ICXA 3KCYA 2W7PA 4L8JA 1EHIA 5FPRA 3R23A 4TVIA 1IBLO 2QM8A 2R7ZG 4B3RB 2Y4UA 2N04A 1US6A 4MTDA 1GO3F 1WCMA 3K5OA 3TQ1A 4FJCC 4O2BA 1E4EA 4O3OA 5EBLC 4NZOA 4MW3A 5LMNB 3OMIB 3LNNA 1Q6IA 3V4ZA 4J9YB 2W8LA 5KX5F 5BYBA 4JI4O 2WAQA 2VR1A 4O83A 4PI0A 2DYSB 4CC6A 1QLNA 3BEHA 1B6QA 2FB5A 1TWFA 3F7YC 5KFDA 3RR5A 2RMKB 1KJ9A 1Y76B 1WRVA 4LNUB 2RGVA 1AR5A 2JEGA 3OUZA 4I50F 3RJ0A 2ZE5A 4I50B 3K3PA 4NZNA 1ZQ7A 3O9OA 1F4NA 1L0LH 1NH2D 3H0GA 1XREA 3KZIZ 1U96A 4JYYA 5FLXN 3G6EV 3RB3A 4CZZA 1R6KA 2JS3A 3QNEA 1NQTA 5DN6G 2ZDIC 4EQ5A 2JEUA 1QHTA 3L70H 3SJQC 1G2WA 3SYOA 5IT9W 4EYIB 2FTKA 3LDEA 3G80A 2QB5A 1Q6HA 4UB6Z 2VQFB 1HNWO 4O3RA 4I0XB 1EKPA 2R92A 2QYZA 5KFNA 1D5NA 3OM3B 4NTWA 3T4ZA 1GGOA 2K1EA 3ZRVA 4DV4O 1DF5A 4K8ZA 1G8MA 4R8UA 4FE2A 4WFHA 4JV2A 4JI8B 2EIMC 2VQDA 5DGIA 1K4DC 2FK3A 1V51A 4DV7B 3V6HA 5KFTA 1DGSA 1MSDA 1N48A 3M99B 5I5VA 3IGAC 1M5IA 5BMVA 4X1YA 2YRWA 5JQGA 1KKDA 1JJOA 1KTAA 1YXBA 2VQFO 1HNWB 2FMAA 2WLHA 4TM5A 2OYQA 1CQJB 1WAZA 4ASUG 4DR7O 1IOVA 1X4TA 4FFKA 2JA6A 1JX9A 1JFFA 2EZOA 4TOIA 3M4IA 1MABG 4WF9V 1UNNC 1VQ7V 4Q0YA 4J41A 5KFVA 3FKIG 2R86A 1PNLA 1HDJA 5CAEB 5LHGA 5JVDB 2COIA 1X59A 4XDJA 3ETJA 2ZM6H 3H4DA 4YB8B 4EBDA 5EIBC 5KFLA 5KG4A 4JI4H 4DR7B 5K1PA 1SQFA 3LSSA 4X65H 2V1DA 1XMOO 2FE3A 3T1HH 2A7WA 3ABKB 2B63G 5EZYA 3FB5C 1RM1C 1TVKA 2NU6B 4O7ZA 2BQ3A 1A48A 1BT8A 2JGDB 4TV9B 2WPDG 1XDNA 5FNVF 4A3MG 3I55V 1VQ5V 4JI0H 3K04A 5DECA 1HR0H 4WFAV 4WCEV 3RYFA 4O3QA 3T7AA 1Z2OX 4I55F 2AGQA 1I7NA 4GCZA 4FFPA 4F6RA 4DV3B 5BR8O 1NZ6A 1UJWB 4Q6GA 2UUBH 3L73H 5LMNO 5BYAA 3KHHA 3WFVA 1WP7A 2VUMA 3EYYA 2VQFH 4JI4B 1PPJH 2OWOA 4Q4CA 4PBCA 4FPPA 1I1LA 5J2TF 4WBNB 2CTRA 1VF7A 5LOVF 5IYZA 5KFHA 3CC7V 1M56B 1UFIA 2HLDG 1EYZA 1FJGH 5C1OA 3B8MA 2VQEB 3DTFA 3ZS8C 4QW9A 2NNUA 1G1XB 2HHHH 2R93A 1GKFA 4U7OA 4DL4A 2JJ1G 3SYPA 2ITCC 3H1IH 4E4TA 5EYPA 3EHBB 3BVOA 4ECSA 1E4EB 1ZUQA 3RF2A 5KG1A 4LC1A 4U3JB 3CRRA 3WWJA 4WFFA 4QWAA 1HNWH 4K35A 3VOUA 5JQGF 2E74B 3IG0A 4RB3C 5H5NA 4Q45A 2A79B 2QKSA 3RV3A 4DV2B 1JQ0A 4DR6O 2VPQA 2R9AA 2PYJA 4CH5A 2VQEO 2GV9A 3PR5B 1WA8B 4GLXA 1I5YA 1MMMA 1SQPH 4UVBA 3MFIA 1K1SA 4WFEA 3KG2A 3UT5B 4X1KB 3MHHC 4JAUA 4PDRA 3RWRD 3ETHA 1JIHA 4EFBA 2IP4A 2Q4PA 2ZIMA 3V4SA 1ET0A 1Q81W 2QSAA 3FYEB 4H0LB 1AI4A 2JEJA 4MVRA 3TXQA 2EINC 1WNSA 2BOCC 4DRXB 4B3TO 1ZAUA 2O57A 2C2EA 4EEQA 1KJ8A 4FFRA 3H40A 2F23A 4J7ZA 5IWAH 4LF4B 3ZBHA 3P3NA 1HNZO 1KUQA 3MWDA 4YJ3B 4GX1A 3VQXA 4ZBMA 3BHPA 3K57A 5H80A 5KMGA 1AILA 3S24A 2N74A 4PDMA 1XL6A 3UKMA 4JTAB 2HJDA 5LP6C 3KAJA 4UUGA 4QIWE 4MTEA 3AG4C 1KD1W 5BWTA 3RYHB 3L72H 1DAAA 2BQUA 3ZEDA 5L1KA 1R73A 1LR1A 3B40A 2GSMB 4BIUA 1PP9H 3JAMN 4DIMA 3JAKB 1FFXB 5LA6A 1YITV 4IIJB 3DAAA 2ASLA 4O84A 3GTKA 4O2BB 3B77A 3P30A 3LUTB 2P67A 3R65A 1B04A 1SZXA 4RNMA 2GLTA 2A9HA 3SPJA 2YIAA 4ED6A 3C0FB 3MR6A 2NVXA 4PELA 5EBWC 3SGIA 1RM1B 3H20A 4PA9A 4H44B 4ME6A 4DR1H 4FS2A 3HBLA 2NU8B 4OX9H 3TCUA 2DQ0A 4R50A 1AB3A 4RNOA 1PNKA 4YBZB 5J9PC 2W6NA 4EBEA 3M9NB 5C3EG 2IJJA 2W6JG 4FFOA 1I3QA 3BRCA 3ETQA 3X2QB 3UYYA 5JVDF 1S03G 3F7VC 2CGNA 2CGOA 1XHXA 2OCHA 4LFCB 5KG2A 3U9SA 3JYCA 5IJ9A 4GC6A 2HVSA 4GYCB 5J2TB 4X8AA 4DR2H 3ABMB 1JDBB 2QM7A 2L6LA 3E8HA 4LF5B 4PA3A 3CEBA 1Y4MA 4DV6H 5DMXA 4YAJB 2WLJA 5BPFA 3JD0A 3EVKA 3EXAA 5HNEA 3RTXA 2YICA 2F95B 3CD6V 4QPKA 4YHHB 3HOXG 2W9BB 3KHLA 1DV1A 1M57B 4NXMB 2ADPA 3ZRWA 2HGSA 5C93A 5EZYB 2Q2TA 1FKAH 1DLBA 1OHHG 5L1IA 3JD4A 1XMQO 4EBCA 1NU1H 3RFRA 3HKEB 3PW5A 2FLPA 3TIIA 4BWAA 4BY1G 3RYIA 2QM4A 4LF5O 5B3SB 3F5WC 1N32H 1FD9A 4B3SH 3D3QA 1VP7A 1VQPV 4F6RB 2R8JA 3O65A 3ZHSA 4NTXA 5DLGA 2M6YA 5LOVB 4DV2O 3K59A 4F4LA 1XNRB 5DAAA 4X1YB 2MW2B 1QNMA 3HR0A 3C3SA 1MSWD 3STZC 1RPRA 1AJNA 2UUAB 2IBZH 4AI8A 3E35A 1OCCC 3JRWA 1XMQB 3PW0A 4L87A 4JI5O 2XUMA 5JCOA 3ZHVA 4IRDA 1M4UA 4A2BA 1S0OA 4UXNA 4GX5A 2YZMA 4PV1B 1W0KG 4UCVA 5C1PA 2ASDA 4A93G 3E5NA 3GLKA 1CKNA 2Q0OC 1JR9A 1QVGU 2AZ2A 2UU9B 4MAMA 2OIEA 2HIVA 2WB1E 4EKWA 2I8CA 4GKKB 2M7WA 2UUAO 2ARHA 2WAMA 1V54B 2NR5A 3QO5A 1HNZB 1YJNV 2UXCB 1IURA 4C5CA 2YI8A 1H2MA 1A0IA 3HKZE 3FB8C 2WWWA 4ABMA 5LP6F 1BMFG 3T9CA 1TVKB 5KS8A 1XMQH 5KFFA 5JVDA 1GN2A 1EN6A 2V59A 2ZE7A 2ZE6A 1EZJA 1S10A 1AR4A 2SCUB 5D8DA 4UVCA 2WDTA 2AHYA 1NTKH 3H1LH 3A0RA 1OCRC 2FLLA 5LHIA 3PJSK 3E8BA 3ASNC 1J5EH 4YXWG 5KFIA 1P49A 3N2KA 4UCUA 4GKKH 2LW1A 2CH7A 2ZXWC 3DSQA 4MA0A 1MNGA 3CSXA 3Q4HB 4RNNA 4A3EG 1BSMA 1I94O 1FYJA 1XDCA 2AHZA 4YJ2B 3K0DA 2EILC 2C22A 2F93B 1AI7A 2GTSA 4JASA 3UCSC 1D5AA 3RB0A 3TGUH 4F6EA 4PDVA 2ZCEA 4LMYA 4I7HA 1M57C 1SQBH 2JRIA 3GVMA 3OTOB 3RYHA 4LFCO 3A8TA 1WP8A 3H9VA 1ZWIC 3JSNA 5KHGA 1BNCA 3PW2A 5IJ0B 3FMAA 3KCXA 4FFBB 5IY5B 1M0WA 5LXTF 4RUFA 5CB4F 2LO1A 4U3JA 4LNUA 2HDKA 4ECWA 2GTAA 3CCEV 1EUDB 3H3VH 2R7LA 1MOFA 4MT8A 4O4JF 5JJJB 2AU0A 3CCQV 4DUZH 3LSUA 5KAFZ 1YEWA 3JALB 3QQMA 5L3GA 3NBZB 3K5HA 4JI8H 1KBHA 1FXHA 4A2AA 4PZ7A 3QFFA 1URFA 2QWOB 4DLKA 3ZHQA 1XEQA 5KT5A 2BQRA 4WD3A 5CN0A 3HKBB 4DV7O 4TSFG 5KFAA 2YRXA 3M9OB 3RUPA 1T94A 5KT7A 3K5IA 4MS2A 1BQZA 1N4CA 3B2EE 1I7FA 4K8XA 1OCRB 1MG1A 1H8HG 3JARB 2UXCH 1NI8A 1YI2V 5B1OA 4BIZA 1Q7YW 3RFCA 3RGXA 1KJIA 3JD1A 1WJZA 3K9AA 5LXTB 3AG3B 1V54C 4U7NA 2EJ3A 3N42B 4YIOA 5LYJA 2P06A 1NVPB 2YC0A 2X0SA 2IJIA 4GX2A 5KT4A 5LGNA 3A0BZ 4Q43A 1F23A 2R8IA 2WAQE 1KQSU 3M8AA 1W2BU 5KFPA 3ZN0A 1A32A 4IIJA 3C90A 5KG0A 5KT3A 2EJ7A 2HVQA 2QTSA 2XAGA 1N0JA 1VQ4V 3AG1C 1SF9A 1JJ2U 2WLNA 1Q90D 3SPCA 2JA6G 4I5SA 4I4TA 5JUMA 3W5OA 4BW9A 1H8EG 2B1GA 3BPZA 2UXBH 1M0TA 5EDWA 3QO7A 4U6PA 3WB1A 5B1AB 1M90W 1JKJB 4J7KA 3JAKA 4RUAA 4ZI7A 4KL1A 4QWDA 3RB4A 3L74H 1L0NH 4DV3H 3UFXB 5EWFA 4DR2O 2UUBB 2W7OA 1AJPA 1RPOA 1M9NA 4O7YA 5EOYA 2XC9A 3GIKA 5I5UA 1WB8A 1KEEA 4XDLA 1JPXA 4J9OA 1VQ9V 4FK5C 3I4NG 3SDLA 4MV8A 2HG5C 4J9KA 5L3FA 4MV6A 2R70A 3RBDA 2HP8A 2MK3A 4L1KA 4UV8A 5IY5C 3GWKC 4J9ZB 4QJFA 4IWYA 3E22B 4BBRG 1BQ0A 1FXKC 1L2ZA 1XMOH 3QZ8A 4JF3A 5GW7A 3J80N 4ED7A 2GDSA 1HWYA 2NN4A 5LA6F 1BZKA 1EN5A 4ZOLB 3RGBA 5IYDO 2FKLA 2Z02A 4O82A 4FBTA 3HOZG 1TWAA 4DYLA 4TV9A 3OTOO 4FMTA 3CCSV 5JJNB 3Q1KA 3TY9A 3MD0A 5D1PA 4LF8H 2CW7A 2RF4A 3CCMV 2Q0AA 2DABA 1NKDA 3VPBA 2UUAH 3S3WA 4ECUA 3IJ4A 4CE5A 4JAAA 3BQ0A 1GTOA 3DXRA 4FLYA 4CH6A 2C2AA 3R9RA 3BQ2A 4J9LA 1I6UA 1ZTEA 5CBHA 3RYCA 4PA7A 3Q8QB 2PYLA 3CRQA 2R9RB 1SQXH 3Q8SB 3T5HA 1BHBA 2WLMA 1NT2B 2YS8A 4R6ZA 4DV7H 1LUWA 4O2AA 3RN4A 2UVRA 2Y0SE 1CKNB 1HNZH 4CS2A 5IE9A 2Q5ZA 3TK1A 4U7CA 4H33A 4IAJA 3ZMSA 5IP9G 2QR4A 2JDIG 4Q4DA 4YIPA 4DV4B 2HHFB 4LSXA 1RP3B 4X1KA 1GSAA 2PZSA 2CFMA 1XK5A 1W93A 2BOBC 4TQSA 4FBUA 2YS6A 3F8NA 4A3FG 5EC1C 2WYOA 5DGBA 5H6QA 2OCCB 5LBQA 1ZHQA 2EIKB 4TV8F 2CZGA 3G8CA 3N40P 4DL5A 3D36A 4A3JG 3CXHF 2RCVA 3JAWB 2R84A 4DR3O 4JZGA 5DG7A 3KAKA 1YDXA 1BXRA 4DR5H 2BSKB 4LWSB 4J0MA 3PW4A 1N36H 1E4FT 1R6TA 5KMGB 5FR9A 4DR6H 4W4KA 1E1RG 1I7LA 4O4HF 1WPXA 5CA0A 5EBMC 1GRJA 2E76B 2QKCA 4JYCA 2YL2A 5LP6A 1J95A 3KHRA 4AQYO 1N34H 1B3QA 3X2QC 4LF9H 3G6VA 2PMZA 1FFXA 5LA6B 3UQ8A 4X20B 5EC2C 1ZL8A 1AP5A 1LNQA 3CJHA 3I5DA 3U55A 1HNXO 1AP6A 4O2BF 1N56A 4MW8A 4J9SA 3GIDA 2Q8VA 2F66C 4HBNA 1SZTA 4DR2B 2UUBO 3HKDB 3JATA 3T4DA 4Y8VB 3GJXB 4DL7A 2A0LA 1RSOA 5L1LA 4TWKA 4BAYA 4A3KG 2IW5A 2H8PC 4G2KA 1F4MA 4UB8Z 2JK5C 5C4XG 2IU0A 3K06A 4LF8O 3T54A 4YHHO 1WN7A 2X7RB 2Q7EA 4FZ1A 2B63A 5BWXA 2CAZC 5KFYA 3E83A 5KFWA 2J6TA 5F9LA 4ED1A 1EFRG 1N34B 4LF9B 4MVZA 4HNAA 4FLUA 3CQZA 1ZLZA 3KTMA 3G6BA 4MTXA 2KSWA 5BR8B 3JALA 4RB0A 3IN5A 2QK4A 3LULA 1HR0O 4F4XA 1YHQV 4A3CG 3L4JA 2YIBA 2JA5A 4Z1VA 4TUYA 1PKXA 4GX0A 3W7XA 3APQA 5FL7G 4O2AF 3M7MX 4DR5O 2CUGA 2G38A 1VF6C 2CW8A 2V7QG 3BAAA 5CB4A 2DOSA 4DO2A 2OIGA 1N34O 4LF9O 3OUFA 3W7WA 3AG2B 3HKCA 1WSCA 2XCLA 2ZINA 3E22A 3J80W 1TUBA 3WO1A 3GIPA 5FNVA 2GHYA 1VMGA 3SPIA 4UCRA 5LYJB 2XIGA 4TQRA 2UXDB 4HNVA 1SYXB 3UZOA 4XYMB 3U0GA 1I0HA 2ATKC 4DR5B 3MHSC 4DR6B 2R7MA 1K97A 1KYOF 2PUSA 3W1GA 1WPBA 2GBOA 2XOKG 3C3TA 3S3XA 2YEVA 3K58A 4YY3B 2WTFA 4JXUA 4OXSA 4GKJB 1DK1A 1JX4A 2OTJV 3IC9A 2R8GA 2DYRC 2FK2A 3BJYA 3LP8A 5KFZA 3K5NA 1M7JA 4HQ6A 4A3LG 4CC5A 1IDSA 5KHIA 3OT7A 2XT9A 5LOVA 3VMMA 5T14A 1Z5VA 4IT5A 3K08A 3L75H 4DV5H 4X66H 1NR7A 4JAVA 2EILB 4PI2A 1U97A 3JCUZ 1GMGA 1XNQO 4ZI7F 2V4QA 2QA4V 4NXNO 2X6BA 4EYHB 4ZI7B 2EIMB 2IU3A 2PGGA 4O86A 2AGAA 1BGYH 4UFZA 4CHIA 4JI3B 4RU9A 3PO2G 2W6QA 1UC8A 4YY3O 3J7AK 4ECZA 4ED3A 4BY7G 3JZIA 3K0GA 2QEXV 1JCHA 1AJQA 1MZEA 1I5XA 5KFJA 5H9CA 4JYAH 5CE8A 5DEDA 1TA8A 4DUYO 2DLNA 3T1HO 3PVXA 2ZT9B 5GONF 2P6JA 3RAQA 4XBFA 3J81N 2X5RA 1XNQB 1H2NA 5KAIZ 1RJPA 2W0XA 2XAJA 1H38A 4JI3O 3K3WA 3QG5A 1M1KW 1W0JG 3H4BA 3GB8B 2V58A 2JVDA 1F7YA 4F4ZA 1KECA 2W6MA 3TW6A 2D3OW 2J9GA 1S9FA 1YCIA 3MWMA 1IXMA 2XHBA 3T5JA 3JAWA 5IDJA 4X64B 2LJ2A 4NKGB 4A3GG 2VWKA 3CCLV 3AG2C 1M93A 2ZKOA 4JI2B 4BWSC 1K9MW 1Y1WA 5CA0B 2C00A 1M6VA 1QR8A 2QGNA 3LSQA 1S5HC 3GWOA 5LP6B 4PZ8A 2UXDH 1OV9A 3JSLA 3D36C 4Q44A 3UZBA 4FFBA 1K5QA 3WWIA 2R82A 1YJ9V 1Z2GA 3KXYT 2W6IG 1NJIW 3OGCC 1KUTA 2ZDIA 4HR7A 3W7UA 3ABLB 2QWNB 2W6ZA 2ZNJA 5JVLA 2F4VO 5GTIZ 4JUZA 4F4WA 2EINB 1IZ3A 4DV4H 3P3PA 4FS1A 2JJ2G 3R5XA 2V4DA 1TAEA 4QE9A 3TY5A 4ZHQA 2RDJA 4KP4A 1K83A 3OEEG 3TETA 3ETGA 1WLEA 3BACA 4I55B 4JI2H 5LMUO 4O3PA 2YI9A 4IYIA 2CNQA 3N6RA 2KQXA 4O4JA 4YR0A 1XILA 2C35B 1SQGA 4R8CA 3P32A 4O2AB 1Y14B 4EB6A 1VBGA 2PF4E 5JWPA 3CVZA 1ZSPA 3DGEA 1SQQH 4MVUA 5LXTA 5I47A 1YIJV 1XNRO 1Y1VA 4JYAB 3HKBA 2UU9H 4IR9A 4O4LB 4GKJO 1VQ8V 4DUYH 2W6OA 2UXXA 4B7KA 4LF4H 2W9AA 1VBHA 1GYFA 4JI5B 1T3NA 1EN4A 2ABJA 1F51A 2YYAA 3L71H 1CKOA 3LQSA 5TISZ 4WFBV 3SYCA 1S76D 4C2MA 4K0KB 3FAVA 1PL0A 4MVQA 5J2UF 1GM8A 4DV0O 3V6JA 4NXNB 1TUBB 3PFFA 3UT5A 5KT2A 2FL4A 5F2VO 2W9CB 4O4IF 2COJA 5LHHA 4E6NA 5FD6A 1IBMO 3WB0A 1NH2B 4GT1A 1S77D 3ORRA 1CEZA 3R5FA 4A3BG 1K5SA 3G71V 2UXCO 1Y67A 2EJ0A 2FPGB 1DF4A 4IRKA 5DG8A 3TQTA 1VS0A 4DRFA 1FAFA 5JCOC 4PJ0Z 4DUYB 4MSWC 3T1HB 2B5UA 4DR1B 5JJEB 1R3KC 2XTAA 2WA3A 3OR6C 3SI8A 5LGTA 1IOWA 4B3MH 1W96A 4B3RH 1ZETA 4N21A 2KG7A 4NYEA 4EGJA 3GILA 1MZFA 2LFSA 4LFCH 2R7NA 4G27B 4DW1A 2R7ZA 2YUAA 4QJFB 3H01A 1IX9A 2RDIA 4PA4A 4UUJC 5CA0F 3T5KA 1DIKA 1Y76A 2BCCH 2Q7HA 3ZHTA 4JV0A 3B8NA 1JMKC 1Z2NX 4DV6B 4X64O 5L3CA 4YAKB 4KHPO 2VOBA 3CCRV 3A0HZ 4DR1O 3Q8PB 5I5TA 4AQYH 4AHCA 3VA7A 4OPAA 5K1XA 3QVNA 2ODMA 2JEFA 1K33A 1M56C 4TT3G 1EKVA 1RK5A 5K3WA 2K9PA 4TUYB 4MV3A 1KJJA 3GV8B 4TUYF 4MVMA 4DL3A 3VOTA 4TV9F 5KKNB 2E2HA 5KFCA 1Y66A 3W7TA 4KHPH 5IYBO 5KUMA 4I0XA 3CP1A
chains in the Genus database with same CATH topology
4X1YA 5JQGA 1JJOA 1HNWB 3TY8A 2R70A 2OYQA 1X4TA 2ZIOA 5D5QA 3E22B 1L2ZA 4JI0B 3SJCC 3JASB 1XMOH 1JFFA 4TOIA 3RYCB 3M4IA 4DV5B 4JV5B 5LMUB 5D1OA 3K5MA 4Q0YA 4ZOLB 3RGBA 4DR4B 5BMVB 4LF6B 4TV9A 3U10A 1IBMB 5JVDB 1HW7A 5JJNB 4LR3A 3TY9A 5D1PA 2ZM6H 4LF8H 1N36B 4DV2H 5EIBC 4APMA 2CW7A 1O75A 4JI4H 1XNRH 4DR7B 2Q0AA 4TV8B 5K1PA 1SQFA 4X65H 2UUAH 2FE3A 3T1HH 3JAMW 5JQGB 5EZYA 3W1BA 1TVKA 1XNQH 4TV9B 4FLYA 1XDNA 4JI0H 4CH6A 1IBKB 2UUCH 4ZHQB 5JH7A 1HR0H 4D7TA 3RYFA 5LMUH 1I6UA 4ETSA 3FFQA 1Z2OX 1WH2A 2E5LH 3U0ZA 3RYCA 1P16A 4DV0B 4F6RA 4TV8A 3CHXA 4DV3B 2KKWA 2PYLA 4LFBB 4Q6GA 2UUBH 4ZOLA 4DV1B 1QQCA 1NT2B 4DV7H 3N6XA 4O2AA 4KHPB 1CKNB 1HNZH 4CS2A 3EYYA 2MCTA 2VQFH 4JI4B 5GONB 4JI6H 2OWOA 4IAJA 3RYFB 4DV4B 4LSXA 4WBNB 1VF7A 4X1KA 2P22C 5IYZA 3J81W 2PZSA 2CFMA 1FJGH 1XK5A 1BJTA 3HKDA 3JATB 2VQEB 3F8NA 3ZS8C 2HHHH 2WYOA 1HR0B 1SKVA 1ZHQA 5EYPA 3N40P 1S68A 4LFAB 3JAWB 3RF2A 4TQFA 4U3JB 5A2QW 3GDEA 4FM9A 1HNWH 3IG0A 3KAKA 4FM0A 4WBNA 4RB3C 4DR5H 1O9HA 4J0MA 4DV2B 1E4GT 5KMGB 1E4FT 1N36H 4DR6H 4O4HA 4OX9B 5KX5A 5CA0A 2R9AA 2PYJA 1XMOB 4CH5A 3OTFA 5LP6A 4JV5H 2GV9A 1N34H 1AN7A 4LF9H 4GLXA 2RGRA 4LSAA 1FFXA 2F1MA 2JGUA 4X20B 5LA6B 5ITZA 3UQ8A 4PZ6A 4PDBA 4FVMA 4PHZA 4JI5H 3RIZA 4RAYA 4LF6H 3N43B 3UT5B 4I55A 2YIBD 4X1KB 5IYZB 3RWRD 1IBKH 1IBMH 5FD5A 2F66C 4EFBA 2ZIMA 4HBNA 1SEIA 4DR2B 3DF7A 3HKDB 3JATA 2PY5A 4O4JB 2VPSA 3GJXB 1RSOA 2ZNIA 1M5IA 4DV0H 1WNSA 4DRXB 1XHZA 4JI3H 1ZAUA 3NBYB 3NC0B 5EIBD 3KALA 4EEQA 4DV1H 5EYPB 5IWAH 4LF4B 2WE6A 3QTCA 5J2UB 4YJ3B 3VQXA 3K57A 1FVIA 3BHPA 4NXMH 1WN7A 4JI6B 2Q7EA 1BGWA 4ZIBA 3L4KA 2CAZC 5KMGA 4I50A 3S24A 3KAJA 1N34B 5IJ9B 5LP6C 4LF9B 4MTEA 4HNAA 3N44B 4FLUA 3RYHB 3ZEDA 2KSWA 5BR8B 3JALA 3VNNA 4RB0A 3HKCB 4LFBH 3JAKB 1FFXB 5LA6A 3L4JA 4IIJB 2YIBA 5ITZB 4FM1A 4RB1A 4TUYA 4O2BB 1X9NA 1B04A 3M7MX 4LH6A 2YIAA 5C8YA 3K3VA 2CW8A 3C0FB 3SGIA 3H20A 3BAAA 5CB4A 3BA8A 4DRXA 1O9GA 3IAYA 1Q3EA 5IWAB 4DR1H 2HVRA 4JI7B 4OX9H 2VQEH 3HKCA 4UCTA 3VQVA 3QWUA 2ZINA 3E22A 4B3MB 3J80W 2VUGA 3BRCA 3ETQA 1TUBA 4LH7A 5D5PA 5FNVA 1S03G 4UCRA 5LYJB 4DK1A 2XIGA 2UXDB 3T1YH 1XHXA 4LFCB 1SYXB 1CKMA 2BTOA 1MZBA 4R7RA 5IJ9A 4DR3B 2O03A 4HNAB 4CH4A 4B3SB 2HVSA 4GYCB 4JI1B 5J2TB 4CH3A 4DR5B 4DR2H 4FLZA 4DR6B 1P8LA 4LF5B 2PUSA 4B3TB 1WPBA 3W1GA 4DV6H 4RB2C 4IHJB 4UCSA 1KMIZ 4YY3B 3K58A 5KHKA 1Z5WA 4GKJB 4AQYB 3RTXA 2F95B 4AILC 2RQ6A 4CS3A 3L2PA 5FNVB 4YHHB 2YCHA 3K5NA 1Q43A 1HNXB 4CC5A 4X1IA 4X62H 5KHIA 4NXMB 3N2GB 5LOVA 2HGSA 4CS4A 5CB4B 1I94B 3VQWA 5EZYB 1Z5VA 1XI1A 2Q2TA 4DV5H 4X66H 1FKAH 2BTQB 1XQ8A 3BABA 4PI2A 3RFRA 3HKEB 4ZI7B 4BWAA 2PGGA 4IHJA 5BR8H 3RYIA 2QM4A 4UFZA 4JI3B 4RAZA 1N32H 4B3SH 3SR2C 3SJBC 4F6RB 2F4VB 3J7AK 1SA0A 2ZM6B 4LF8B 4X64H 2EX3A 5LOVB 3K59A 1XNRB 4MV9A 4JYAH 4X1YB 5J2TA 2UUAB 3QF7A 1TA8A 2HEPA 2IM9A 2P5OA 5CA1A 4YHHH 3A2FA 1XMQB 1HNXH 4DR4H 3RYIB 1XNQB 3THOA 2JS5A 5FPOA 4LF7B 5JCOA 1M4UA 4A2BA 4K0KH 1TGOA 3QG5A 4UCVA 1IBLB 5D1OB 3GB8B 2JVDA 3RGZA 3T1YB 3N2KB 2R72A 4NXNH 1CKNA 1G6UA 4TQDA 2UU9B 3HKEA 2HIVA 4GKKB 3MWMA 2XHBA 3JAWA 4X64B 4B3TH 3JASA 2VWKA 1JFFB 1HNZB 2UXCB 4YY3H 1M93A 2Q7GA 2YI8A 1SA0B 4JI2B 4BWSC 1A0IA 5CA0B 1KU9A 1H2SB 5LP6B 2E5LB 4PZ8A 2UXDH 1TVKB 1XMQH 4EB6B 3JSLA 3CB2A 5JVDA 1ZHSA 4LF7H 4FFBA 4DR3H 5JH7B 4JI1H 3KXYT 2QJ1A 4LF5H 4O4LA 2WDTA 4FLXA 3K5LA 2ZNJA 1N32B 4GKJH 3SJAC 1T5EA 1J5EH 2F4VH 4DV4H 1P49A 3N2KA 4UCUA 4GKKH 3DSQA 3CSXA 4O4IB 2V4DA 4X20A 1FJGB 1TAEA 3TY5A 4ZHQA 5GONA 1I94H 4YJ2B 2HHHB 5J2UA 4I55B 4JI2H 2F93B 4X66B 2YI9A 1D5AA 4I9QA 4DK0A 2ZCEA 4O4JA 4I7HA 4LMYA 2HIXA 2YXLA 2VWJA 3OTOB 5LMNH 3RYHA 4LFAH 3KYHC 1SQGA 4O2AB 3JSNA 4EB6A 5KHGA 4O4IA 5IJ0B 3CVZA 3FMAA 4FFBB 5LXTA 1N33B 1M0WA 1S5JA 4YJ3A 4FLVA 4NVPA 4JYAB 3HKBA 2UU9H 4U3JA 4LNUA 3HXLA 4O4LB 3U11A 2E3CA 4FM2A 4DUYH 1Q5OA 4LF4H 3ICXA 1GYFA 4JI5B 5JJJB 4L8JA 4RZQA 4DUZH 4UCOA 5FPRA 1YEWA 1CKOA 3JALB 4K0KB 3NBZB 4B3RB 4MTDA 1IBLH 4JI8H 4A2AA 4PZ7A 3K5OA 4O2BA 4YJ2A 5KHJA 5LL6b 4NXNB 1Q8IA 1TUBB 3HKBB 3UT5A 5LMNB 3OTOH 4E6NA 5C8YB 5FD6A 3LNNA 4O4HB 3WB0A 3MAQA 4I4TB 5KX5B 3B2EE 1I7FA 4K8XA 3JARB 2UXCH 4PI0A 1V9PA 1VS0A 4DRFA 3PN1A 4CC6A 5IJ0A 5JCOC 3RGXA 5LXTB 3WB2A 2UXBB 2RJZA 4DUYB 3RR5A 3N41B 3T1HB 3N42B 4DR1B 5JJEB 4LNUB 5LYJA 2RGVA 4JI7H 1Z2PX 4DUZB 4MV7A 3RJ0A 4I50B 2UUCB 3N2GA 4B3MH 4D7SA 2ZJTA 4B3RH 3BA9A 2BTQA 3JARA 2W57A 4LFCH 4DR7H 4B08A 4EFEA 4IIJA 4X65B 1J5EB 4EQ5A 1QHTA 2Q2UA 2HVQA 2Q7HA 4M7EA 1N33H 5IT9W 5DISC 4FLTA 1JMKC 1Z2NX 4DV6B 4X1IB 2VQFB 2VOBA 4I4TA 3W5OA 4BW9A 4AQYH 4AHCA 3BPZA 5K1XA 2UXBH 1M0TA 3VQYA 3LMLA 4FLWA 3WB1A 5KHHA 4K8ZA 5FLXW 3JAKA 4ZI7A 4X62B 4KL1A 5CA1B 2PTMA 4TUYB 1L8DA 4DV3H 4JI8B 2UUBB 5EOYA 4DV7B 1DGSA 4KHPH 5BMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO B;  1XMO B;  3KYH C;  2Q2T A;  1HNW B;  3TY8 A;  3JSN A;  3BAB A;  4GLX A;  3UQ8 A;  4PZ6 A;  1N33 B;  4JYA B;  4UFZ A;  4JI3 B;  4JI0 B;  4TOI A;  4DV5 B;  4JV5 B;  4EFB A;  2F4V B;  5LMU B;  5D1O A;  4DR2 B;  2ZM6 B;  4LF8 B;  3GJX B;  4JI5 B;  4DR4 B;  4UCO A;  5FPR A;  4LF6 B;  1XNR B;  1CKO A;  1ZAU A;  2UUA B;  1IBM B;  4K0K B;  3NBY B;  3NBZ B;  4B3R B;  1TA8 A;  3NC0 B;  4EEQ A;  4PZ7 A;  3TY9 A;  4LF4 B;  5D1P A;  1N36 B;  1XMQ B;  1FVI A;  4NXN B;  1XNQ B;  5FPO A;  4LF7 B;  4JI6 B;  4DR7 B;  5LMN B;  4E6N A;  3S24 A;  1IBL B;  4UCV A;  5D1O B;  1N34 B;  4LF9 B;  3GB8 B;  3T1Y B;  3W1B A;  1CKN A;  5BR8 B;  3VNN A;  1V9P A;  2UU9 B;  1XDN A;  1VS0 A;  4DRF A;  3PN1 A;  4CC6 A;  2HIV A;  1IBK B;  4GKK B;  2UXB B;  4DUY B;  3RR5 A;  3T1H B;  4X64 B;  4DR1 B;  1X9N A;  1HNZ B;  1P16 A;  4DV0 B;  1B04 A;  2UXC B;  4DUZ B;  4DV3 B;  4LH6 A;  4JI2 B;  4LFB B;  2HIX A;  1A0I A;  2UUC B;  3SGI A;  4DV1 B;  3BAA A;  3BA8 A;  3BA9 A;  5IWA B;  2E5L B;  4PZ8 A;  4KHP B;  1CKN B;  2HVR A;  4JI7 B;  3JSL A;  4JI4 B;  4UCT A;  4EFE A;  2OWO A;  4X65 B;  1J5E B;  3QWU A;  4B3M B;  4EQ5 A;  4DV4 B;  2Q2U A;  2HVQ A;  2VUG A;  4LH7 A;  4UCR A;  5DIS C;  2CFM A;  2UXD B;  1XK5 A;  4DV6 B;  4LFC B;  1CKM A;  2VQF B;  2VQE B;  1N32 B;  4DR3 B;  3W5O A;  4B3S B;  2HVS A;  4JI1 B;  4DR5 B;  1HR0 B;  4UCU A;  1P8L A;  4DR6 B;  4LF5 B;  1FJG B;  4B3T B;  3W1G A;  1TAE A;  4X62 B;  3TY5 A;  1S68 A;  4UCS A;  4YY3 B;  4LFA B;  2HHH B;  4GKJ B;  4AQY B;  4X66 B;  3GDE A;  3RTX A;  4JI8 B;  2UUB B;  3L2P A;  4YHH B;  4DV7 B;  4DV2 B;  1HNX B;  1DGS A;  4CC5 A;  4NXM B;  4OX9 B;  1I94 B; 
#chains in the Genus database with same CATH topology
 3OFN G;  2A1H A;  3ZRX A;  3OMA B;  2DN9 A;  1AUV A;  3TY8 A;  4F50 A;  4PDL A;  2ZR3 A;  1P7G A;  3UM7 A;  4ZHQ F;  2ZIO A;  1COW G;  5CR5 A;  2OH2 A;  3ZMV A;  3T1C A;  2ZQM A;  4JI0 B;  2UXB O;  3SJC C;  1VQM V;  3R66 A;  4DV5 B;  5LMU B;  2HJW A;  5D1O A;  3ABK C;  1XOU A;  1OCO C;  2E75 B;  4ZKI A;  3K5M A;  3OW2 U;  4BR6 A;  5BMV B;  3ZX6 A;  2UUC O;  4LF6 B;  3GIM A;  2EUL A;  2QDO A;  3E86 A;  3U10 A;  2FK1 A;  1HW7 A;  1KB9 F;  1R3I C;  4LR3 A;  2JIZ G;  4HAM A;  1N36 B;  4AYB E;  4YP3 A;  2UXN A;  4APM A;  3CPW U;  2FLN A;  4DV1 O;  2PN1 A;  2LFR A;  3OD4 A;  3SYA A;  1GSO A;  2WLK A;  5CBF A;  1RK6 A;  5L3D A;  2I80 A;  4RCN A;  3JAM W;  3BY6 A;  4FZ0 A;  3RVZ A;  1Y1W G;  2P0A A;  3W1B A;  1CE8 A;  1XNQ H;  4FIP C;  5L1J A;  2CKZ B;  1S97 A;  2OT5 A;  2EIK C;  4ZHQ B;  3TEK A;  1I08 A;  4K0K O;  5IYC G;  5LMU H;  3JD3 A;  4ETS A;  3FFQ A;  2E5L H;  4ED8 A;  1P16 A;  4DV0 B;  4O81 A;  2CK3 G;  2WLI A;  4TV8 A;  2VRZ A;  3CHX A;  4B3S O;  2KKW A;  5IT9 N;  3RV4 A;  4Q8E A;  3TJT A;  1H2L A;  3BCC H;  4DV1 B;  4HZ3 A;  1FS0 G;  4X89 A;  4QSH A;  3N6X A;  2HGW A;  2PVP A;  2NVY A;  1WA8 A;  1I2L A;  4MTF A;  2MCT A;  5GON B;  2FPP B;  4JI6 H;  4H13 B;  1K92 A;  2CQY A;  1Y6X A;  3RYF B;  5BWW A;  3J7A U;  3AG3 C;  2WLL A;  3WNZ A;  1JVM A;  4N23 A;  3PO3 G;  4KFM A;  3ZRS A;  1BJT A;  3HKD A;  3JAT B;  3AG4 B;  2LQT A;  1BHA A;  1Y74 B;  5B1N A;  1Q6U A;  5B1B B;  3U9T A;  1HR0 B;  1IXB A;  2Y48 A;  2M05 A;  1SKV A;  3FAV B;  2GUZ B;  4DXW A;  1ZL8 B;  4YJ2 F;  5CMU A;  1S68 A;  3DTG A;  1SES A;  3EFF K;  3GDE A;  5E79 Z;  3ABM C;  1S0N A;  4IGG A;  5DM6 V;  2HGX A;  2W9C A;  4IIJ F;  1E4G T;  1S72 V;  3ETE A;  3OE7 G;  4O4H A;  4BW5 A;  3OUU A;  1QLE B;  3AK1 A;  1RYS A;  3PR4 A;  5JQW A;  1AN7 A;  1KKC A;  2RGR A;  2F1M A;  3MFH A;  4PZ6 A;  4FVM A;  4RUE A;  4HYO A;  1CPY A;  3AW8 A;  4RAY A;  3RIZ A;  4LF6 H;  2JA8 G;  2UXD O;  4I55 A;  2YIB D;  5A2Q N;  1IBK H;  3FX7 A;  5IYC O;  5FD5 A;  2AQ4 A;  4QPJ A;  2YZG A;  1TWG A;  2PY5 A;  4K6N A;  3H0G G;  1XUQ A;  3CCJ V;  3T5L A;  4LFB O;  4J9N A;  5EWG A;  1XHZ A;  5B3S C;  4WBN F;  3T9B A;  4YR3 A;  1KP3 A;  3NBY B;  5EIB D;  3HT5 A;  1WB7 A;  1OCZ C;  5KFK A;  2WE6 A;  5F9N A;  4LBE C;  2IJK A;  2ZM6 O;  2DYS C;  1VF5 B;  4ECQ A;  1SFO A;  2QTO A;  4O7R A;  4HYK A;  1K34 A;  2XAQ A;  4LP8 A;  1BGW A;  2X6C A;  5IWA O;  3SPG A;  4DV5 O;  2W71 A;  5IJ9 B;  1Q86 W;  3SE7 A;  1PV0 A;  1ORQ C;  2YZL A;  3GB7 C;  4O7L A;  2XGP A;  2EJR A;  5KA5 A;  2NU9 B;  5LGU A;  2J6U A;  3OHA A;  4MV1 A;  5ITZ B;  3RBZ A;  2R6F A;  4RB1 A;  2W8K A;  3Q8R B;  5KFU A;  4QWE A;  1X9N A;  3OUS A;  1N36 O;  2DJV A;  3CXC U;  4O7V A;  5KFX A;  1EM1 A;  1VF6 A;  4RQE A;  4NTY A;  5KFR A;  1O9G A;  5BWV A;  1Q3E A;  5IWA B;  3RAX A;  2LP7 A;  4GZR B;  4MTG A;  4HN2 A;  2VQE H;  1P84 F;  4IL6 Z;  4UCT A;  3OSN A;  3GTP A;  2CE4 A;  1GN4 A;  2D2C B;  3VQV A;  3BQ1 A;  3QWU A;  4B3M B;  2VUG A;  4LH7 A;  5D5P A;  3TW7 A;  4DK1 A;  2AGP A;  4WHX A;  3M9M B;  2IMW P;  1CKM A;  5E25 A;  3MR3 A;  4DR3 B;  2O03 A;  4CH4 A;  4B3S B;  3CX5 F;  1H2K A;  4QIW F;  4JI1 B;  4CH3 A;  5C5J A;  5KT6 A;  3LNM B;  4FLZ A;  3ZHU A;  4RB2 C;  1KMI Z;  3GIQ A;  1Z5W A;  4P9P A;  4AQY B;  2HKO A;  4AIL C;  2RQ6 A;  2ZXW B;  1SRY A;  4J42 A;  4J11 A;  4CS3 A;  3CCU V;  4JI2 O;  2YCH A;  5BY1 A;  1FFT B;  4M0J A;  1GN6 A;  3VPC A;  1Q43 A;  1HNX B;  1QLE C;  2CTQ A;  2Z3Y A;  3N2G B;  3HOY G;  5HFM A;  2XCA A;  2LW7 A;  1XI1 A;  3QZ7 A;  1XQ8 A;  2A3Q A;  3BAB A;  2Q7D A;  1AR1 B;  4IZO A;  2KB1 A;  1FXK A;  1V4Y A;  3N8D A;  2L35 A;  4O3S A;  4IHJ A;  2Q9L A;  5BR8 H;  2VA2 A;  4RAZ A;  2X6A A;  3OR7 C;  3SR2 C;  3ORQ A;  2F4V B;  5KFQ A;  4LF8 B;  2ZDH A;  2UVW A;  1CXZ B;  3APO A;  4JZ2 A;  1Q82 W;  4C5A A;  5H6R A;  3I12 A;  5DQG A;  4J9R A;  2UVV A;  1N33 O;  1B6R A;  2R8H A;  3OEH G;  4MV9 A;  3HB3 B;  1YTF B;  3R5H A;  3I56 V;  4YQW A;  2YDE A;  3QF7 A;  2PI5 A;  5DGA A;  2IM9 A;  5HV6 A;  2P5O A;  1KBL A;  2DMX A;  2WB1 A;  1SET A;  4YHH H;  1EBO A;  3A2F A;  2LGQ A;  2PI4 A;  1HNX H;  3CC2 V;  3RYI B;  5BWU A;  2JS5 A;  5FPO A;  1DV2 A;  1K8A W;  4ED0 A;  1WR2 A;  2IH1 C;  5BWR A;  4A3D G;  2YWV A;  3HOV G;  1IBL B;  2Q69 A;  5EWE A;  4J7J A;  4QW8 A;  3TXS A;  2ALZ A;  3FB6 C;  5KA6 A;  3T1Y B;  1C30 A;  1VAR A;  2QKA A;  3N2K B;  1CS0 A;  3CE2 A;  1G6U A;  3CRM A;  1ARO P;  4LCU C;  3WO0 A;  4JV1 A;  5L3B A;  4I7Z B;  3AG1 B;  3UO3 A;  4JYA O;  5DGH A;  1QBZ A;  5AG2 A;  2JEI A;  3BFR A;  3ZMZ A;  4ECT A;  2FKX A;  4B3T H;  1GM9 A;  3MJF A;  4YY3 H;  3G6Y A;  2R8K A;  1SA0 B;  4NB5 A;  4P30 A;  2DIK A;  2Y0P A;  3OMN B;  3ASO B;  2R93 G;  4HNU A;  4F4Y A;  1KU9 A;  2E5L B;  5LYJ F;  2AW9 A;  4W4L A;  2XAF A;  4EB6 B;  2HVJ C;  4A3I G;  1GM7 A;  5KFO A;  1PK8 A;  4DR3 H;  4RAI A;  2V5A A;  4JI1 H;  2XGQ A;  2ASJ A;  2Y4R A;  3CWB H;  5BMV F;  4GC7 A;  2QJ1 A;  4LF5 H;  2AZ0 A;  4O4L A;  2VA3 A;  3LDC A;  4FLX A;  5IYD G;  3SJA C;  1T5E A;  3CC4 V;  2Y4T A;  2P90 A;  2ODT X;  2F43 G;  1WCM G;  4J10 A;  2GPS A;  1FJG B;  1VIB A;  3H1J H;  1QVF U;  2QE7 G;  2E5L O;  3NXS A;  1AI6 A;  2HHH B;  4JV5 O;  4A5U B;  1ULZ A;  3U54 A;  2V9W A;  4PA6 A;  3IFX A;  4BIO A;  2FML A;  1GSH A;  1CP9 A;  2HFE C;  2YW2 A;  1OCO B;  1NVP D;  1S0V A;  3T2M A;  4Q8F A;  1BE3 H;  2HIX A;  2YXL A;  2IJH A;  3KYH C;  1ENV A;  5B66 Z;  3D8C A;  4O4I A;  4JI1 O;  2ZE8 A;  4ECV A;  5KFB A;  4ICG A;  1S5J A;  4EEY A;  4NVP A;  3F5T A;  1OCZ B;  4QGP A;  1OBD A;  1TWC A;  5I5W A;  1B6S A;  3U11 A;  1IYE A;  4FM2 A;  2HHH O;  4E4E A;  3WU2 Z;  4J9P A;  4JTD B;  1Q5O A;  1SS3 A;  4JPR A;  1PD3 A;  1GN3 A;  4RZQ A;  1Y74 A;  4UCO A;  3JRX A;  1PL4 A;  2CH7 B;  1IBL H;  3Q4H A;  5I60 A;  4RUC A;  3CSW A;  2X0L A;  2GQR A;  4YJ2 A;  4DUZ O;  1I1M A;  4QWB A;  5KHJ A;  2EBO A;  3L9D A;  2DWC A;  5LL6 b;  5KG7 A;  1Q8I A;  4YJ3 F;  1TWH A;  2QWP B;  5DQH A;  1AVM A;  3OTO H;  4DAA A;  3SNO A;  5C8Y B;  3MWE A;  2C2R A;  4O4H B;  1PM9 A;  3MAQ A;  1NTM H;  5BPH A;  4I4T B;  5C8Y F;  1KC7 A;  3T9F A;  1LUV A;  3CS5 A;  5KX5 B;  4I4T F;  1R6N A;  5L3E A;  3SYQ A;  4P2Z A;  4ED2 A;  1V9P A;  1RJR A;  3PN1 A;  5IJ0 A;  1A9X A;  1E79 G;  4JI0 O;  3WB2 A;  2UXB B;  2YXH A;  2Z04 A;  2RJZ A;  1VAJ A;  3N41 B;  1R1B A;  4NLG A;  4EGQ A;  4MTO A;  3NUA A;  4JI7 H;  1Z2P X;  4DUZ B;  1R9T A;  4MV7 A;  1EZ1 A;  2UUC B;  3N2G A;  4LF6 O;  2JEX A;  4MVS A;  4D7S A;  4GLW A;  2ZJT A;  2R92 G;  1XL4 A;  3BA9 A;  4X62 O;  1V55 B;  3K9S A;  2BTQ A;  3JAR A;  2W57 A;  2P7T C;  4LFA O;  1S5L Z;  3KKY A;  4DW0 A;  1HP8 A;  3T1Y O;  4O4L F;  2YZN A;  5IP7 G;  4NR1 A;  4B08 A;  4DR7 H;  3QO8 A;  4EFE A;  4X65 B;  4DV3 O;  1J5E B;  4P9O A;  3GTQ A;  2Q2U A;  2Q6A A;  4O7T A;  1ROP A;  1SC5 B;  4M7E A;  1N0N A;  1N33 H;  5DIS C;  4FLT A;  3WG7 C;  4OX9 O;  4X1I B;  3FKI A;  4M9U A;  2CTW A;  3AX6 A;  3NR7 A;  1B33 N;  2AGO A;  4FGR A;  3VQY A;  2Y69 C;  4FLW A;  3LML A;  5KHH A;  2R9I A;  3DC6 A;  5FLX W;  4X62 B;  2VS0 A;  5CA1 B;  2PTM A;  2ZDG A;  4RQF A;  2EIJ C;  1L8D A;  1BS3 A;  2YSU B;  5H2F Z;  1R3L C;  3MR2 A;  2B9Z A;  2HG8 A;  2I87 A;  1JXL A;  1P4R A;  2FYU H;  4CKE A;  5KLV H;  5C44 G;  3JD2 A;  1EZV H;  4QE7 A;  5DG9 A;  3ZMT A;  2UVU A;  3GTG A;  3K79 A;  5BXZ A;  4ECR A;  2BE3 A;  3SPH A;  1KC8 W;  2C2D A;  2BR0 A;  2YXY A;  5D5Q A;  3E8G A;  1FJG O;  3EPG A;  3JAS B;  5E1A C;  3T9E A;  3RYC B;  3H1K H;  4JV5 B;  5CM0 A;  4XYL B;  2XCP A;  1DTO A;  1VQO V;  1R3J C;  4DR4 B;  3RB6 A;  1D2D A;  1IBM B;  2JA7 G;  1K73 W;  1QCE A;  3HOW G;  4X88 A;  4J9Q A;  4DV2 H;  4XDK A;  3UO2 A;  2WLL B;  1XNR H;  1O75 A;  2WLI B;  4TV8 B;  5KG6 A;  4D6T H;  5BZB A;  1G4Y B;  5CBG A;  4O3N A;  4JI7 O;  1CQI B;  4RO2 A;  5JQG B;  4LF4 O;  4K3A A;  4X9Q A;  2GUZ A;  1GLV A;  3ZN1 A;  1FXK B;  2R7K A;  1IBK B;  5FJ8 G;  2UUC H;  2Y0I A;  3MDS A;  5JH7 A;  2ETN A;  3E89 A;  4D7T A;  1AUX A;  4AYB A;  2HHF A;  4IR1 A;  1PNM A;  3FYI B;  1WH2 A;  2DE0 X;  3U0Z A;  1PX2 A;  3PW7 A;  3ZJZ A;  2JA5 G;  4WFG A;  3CMA V;  4LFB B;  1OBG A;  4ZOL A;  2ILM A;  1QQC A;  3FD9 A;  4O7W A;  4DL6 A;  2ITD C;  3H1H H;  3GTO A;  4DV6 O;  1BL8 A;  2IH3 C;  3G8D A;  2W70 A;  4KHP B;  4HNT A;  2NUA B;  3TIN A;  4MV4 A;  2AXT Z;  2RN9 A;  1JOY A;  4C7U A;  4ZQI A;  1AI5 A;  3LWB A;  2P22 C;  3ASO C;  3J81 W;  5B1A C;  2E2I A;  1YF2 A;  3E8F A;  4E2L A;  3Q2O A;  3MR5 A;  1YZB A;  2Q68 A;  2ZGI A;  4FFM A;  2P4V A;  3HOU G;  1NTZ H;  1S3J A;  1QR9 A;  2HR3 A;  5CA3 A;  1YJW V;  3OSP A;  1BCC H;  4EG0 A;  3G6X A;  2Y0S A;  3I4M G;  5A9G A;  2COG A;  2XAH A;  4JTC B;  1VKZ A;  4RZR A;  2PBZ A;  4LFA B;  4IWX A;  2YU9 A;  4TQF A;  3CEI A;  1RFY A;  5A2Q W;  4FM9 A;  4O7S A;  4FM0 A;  4WBN A;  1IYD A;  1N8R W;  1O9H A;  4J80 A;  1J5E O;  2DPJ A;  4PWQ A;  1RSO B;  1K7D A;  2A06 H;  2DPI A;  3KHG A;  2P4K A;  5I5S A;  3D3I A;  4OX9 B;  5KX5 A;  2QWR B;  1VQ6 V;  3JZ6 A;  3CYO A;  4DQN A;  1XMO B;  5IYB G;  2KSD A;  3OGI B;  3OTF A;  4JV5 H;  1SQV H;  2YS7 A;  2J6S A;  2EIJ B;  4LSA A;  2JGU A;  4B3M O;  5ITZ A;  3ABU A;  4JI6 O;  4PDB A;  4JI5 H;  4PHZ A;  4LF7 O;  5K2M A;  3N43 B;  3V6K A;  5KG3 A;  1H2G A;  1OZ0 A;  2Y69 B;  1K3E A;  2XND G;  3RW0 A;  3ZMU A;  5IYZ B;  5FLM G;  1IBM H;  3EPI A;  5L9X A;  1I50 A;  1SEI A;  2CDY A;  3DF7 A;  4O4J B;  2VPS A;  2OCC C;  1YVW A;  2W6P A;  1ZX3 A;  2ZNI A;  4YR2 A;  4DV0 H;  3ASN B;  4JI3 H;  2LGW A;  2DZD A;  3NC0 B;  4CBC A;  2PMZ E;  3KAL A;  3RVY A;  1GO3 E;  4DV1 H;  5EYP B;  4J9M A;  2Z5U A;  1K1Q A;  3CJH B;  2EJ2 A;  3HB9 A;  3QTC A;  5J2U B;  1FVI A;  4Q20 A;  4NXM H;  4JI6 B;  2BSK A;  3ZCC A;  2DWE C;  4ZIB A;  3L4K A;  5CA1 F;  3ZIA G;  4I50 A;  4B7E A;  2H3O A;  1FKA O;  1VEW A;  3CRC A;  3N44 B;  2EIY A;  1SER A;  3JZF A;  3T9A A;  3G4S V;  2RNB A;  4DR4 O;  3VNN A;  3PZP A;  2CNV A;  3JCZ A;  3HKC B;  3GIJ A;  2CTP A;  4UV9 A;  2NU7 B;  4LFB H;  4FM1 A;  2R85 A;  4R8U B;  1KJQ A;  2OLS A;  3G67 A;  4RWU A;  1A0G A;  3ZHR A;  4LH6 A;  5C8Y A;  3WG7 B;  2UU9 O;  3K3V A;  4QIW A;  4BXX G;  4NYK A;  3OAA G;  3BA8 A;  2N05 A;  4DRX A;  4Z2W A;  2CNU A;  4FFN A;  3IAY A;  4IRC A;  3T9D A;  3AG7 A;  1GK9 A;  2HVR A;  5KFM A;  4JI7 B;  1C3O A;  4XZ3 B;  3AK2 A;  2YEV B;  3CCV V;  4QWC A;  4G28 B;  4PD4 F;  3KRE A;  1IBK O;  3T1Y H;  2RDC A;  5B1B C;  2BTO A;  2FPI B;  1MZB A;  4R7C A;  1B06 A;  4R7R A;  1RYR A;  4HNA B;  4IYH A;  4ZOL F;  2KG7 B;  2WA4 A;  2QF7 A;  1P8L A;  3K03 A;  5DLF A;  4C5B A;  4B3T B;  2DQ3 A;  4IHJ F;  4IHJ B;  4UCS A;  4ECX A;  5KHK A;  2XD4 A;  3WWH A;  1FPO A;  2HJF C;  4MA5 A;  3TIG A;  5FNV B;  3L2P A;  1TUE B;  1NR1 A;  1IVS A;  4X1I A;  4X62 H;  3RT3 C;  4CS4 A;  5CB4 B;  1I94 B;  5EZY F;  4B3R O;  2YID A;  3VQW A;  4FU0 A;  2H94 A;  2BTQ B;  1JDE A;  3CRA A;  2GQS A;  3OHB A;  2ATL A;  1XBL A;  3CME V;  2Z0A A;  2NLJ C;  3W7S A;  1GH6 A;  2QWQ B;  4MVO A;  3T99 A;  4KXR A;  3SJB C;  1VQK V;  4OPH A;  3B4S A;  2W9B A;  1SA0 A;  1YTF D;  2ZM6 B;  2HVK C;  4X64 H;  2EX3 A;  1RJQ A;  3ML0 A;  2Q73 A;  3DTU B;  2DWD C;  3E2E A;  3ZRW B;  5KFE A;  3DXR B;  4BBS G;  2ADQ B;  5J2T A;  3HPL C;  5IYZ F;  2C28 A;  5KFG A;  3GV5 B;  2HEP A;  1OJH A;  3FKS G;  5CA1 A;  3AK3 A;  1A3G A;  5LL6 Y;  2WSS G;  4DR4 H;  1JLL B;  3THO A;  3AYH B;  4LF7 B;  1P7B A;  3ABT A;  2XAS A;  4K0K H;  5I5X A;  1TGO A;  2FB9 A;  5D1O B;  5KFS A;  1NBM G;  2DAA A;  3ABL C;  1V55 C;  3HKZ A;  4JYB A;  3RGZ A;  3GTM A;  2DW4 A;  2R72 A;  3GTJ A;  4NXN H;  5EK0 A;  4DL2 A;  2JA7 A;  4CKC A;  4TQD A;  1OWT A;  3HKE A;  4CKB A;  2R87 A;  4U3F H;  5HBR B;  1VQL V;  3VBB A;  1E1Q G;  3JAS A;  3RBE A;  1JFF B;  3GII A;  1N32 O;  3NGD A;  3LDD A;  1MA1 A;  2Q7G A;  2GPW A;  1W59 A;  5KUK A;  1FXV A;  2W0F C;  3AEI A;  4O7N A;  3FDS A;  4GUN A;  3GTL A;  3STL C;  5I5Y A;  3GV7 B;  4NXM O;  4NZM A;  5KG5 A;  4FFL A;  1H2S B;  1L1F A;  1EKF A;  2FJZ A;  3CB2 A;  1ZHS A;  1Y1V G;  3ETD A;  4X66 O;  1OCC B;  4LF7 H;  4OGQ B;  1THZ A;  4JI8 O;  5JH7 F;  3N27 A;  5JH7 B;  4I9W A;  4H37 A;  1I2K A;  1KT8 A;  4LWS A;  1UC9 A;  1T36 A;  3K5L A;  4QNH B;  4ECY A;  1N32 B;  4GKJ H;  3VPD A;  4Z1M G;  4CMF A;  2IBK A;  4XX0 B;  2F4V H;  1JA8 A;  2OTL V;  2DYR B;  3IC7 A;  4O4I B;  2JGD A;  5B5E Z;  4X20 A;  1NS1 A;  3DC5 A;  2ZR2 A;  5GON A;  1VQN V;  1I94 H;  3FB7 C;  4KUM A;  5J2U A;  5GTH Z;  4X66 B;  1S0M A;  1QU7 A;  1YSC A;  4JGS A;  2FP4 B;  3GQC A;  4I9Q A;  1I1K A;  4DK0 A;  2VUM G;  1UPG A;  3BG5 A;  4G3I A;  1KP2 A;  2VWJ A;  3HO8 A;  5LMN H;  2Q67 A;  4LFA H;  3B09 A;  4CMD A;  4X65 O;  1N33 B;  2IA6 A;  2ZDQ A;  2B1I A;  4YJ3 A;  4FLV A;  4GKK O;  5HFL A;  1SCU B;  2ZD9 A;  1GAX A;  3HXL A;  5DQI A;  2V4R A;  4UVA A;  2E3C A;  2EZP A;  1EUC B;  1K4C C;  3ICX A;  3KCY A;  2W7P A;  4L8J A;  1EHI A;  5FPR A;  3R23 A;  4TVI A;  1IBL O;  2QM8 A;  2R7Z G;  4B3R B;  2Y4U A;  2N04 A;  1US6 A;  4MTD A;  1GO3 F;  1WCM A;  3K5O A;  3TQ1 A;  4FJC C;  4O2B A;  1E4E A;  4O3O A;  5EBL C;  4NZO A;  4MW3 A;  5LMN B;  3OMI B;  3LNN A;  1Q6I A;  3V4Z A;  4J9Y B;  2W8L A;  5KX5 F;  5BYB A;  4JI4 O;  2WAQ A;  2VR1 A;  4O83 A;  4PI0 A;  2DYS B;  4CC6 A;  1QLN A;  3BEH A;  1B6Q A;  2FB5 A;  1TWF A;  3F7Y C;  5KFD A;  3RR5 A;  2RMK B;  1KJ9 A;  1Y76 B;  1WRV A;  4LNU B;  2RGV A;  1AR5 A;  2JEG A;  3OUZ A;  4I50 F;  3RJ0 A;  2ZE5 A;  4I50 B;  3K3P A;  4NZN A;  1ZQ7 A;  3O9O A;  1F4N A;  1L0L H;  1NH2 D;  3H0G A;  1XRE A;  3KZI Z;  1U96 A;  4JYY A;  5FLX N;  3G6E V;  3RB3 A;  4CZZ A;  1R6K A;  2JS3 A;  3QNE A;  1NQT A;  5DN6 G;  2ZDI C;  4EQ5 A;  2JEU A;  1QHT A;  3L70 H;  3SJQ C;  1G2W A;  3SYO A;  5IT9 W;  4EYI B;  2FTK A;  3LDE A;  3G80 A;  2QB5 A;  1Q6H A;  4UB6 Z;  2VQF B;  1HNW O;  4O3R A;  4I0X B;  1EKP A;  2R92 A;  2QYZ A;  5KFN A;  1D5N A;  3OM3 B;  4NTW A;  3T4Z A;  1GGO A;  2K1E A;  3ZRV A;  4DV4 O;  1DF5 A;  4K8Z A;  1G8M A;  4R8U A;  4FE2 A;  4WFH A;  4JV2 A;  4JI8 B;  2EIM C;  2VQD A;  5DGI A;  1K4D C;  2FK3 A;  1V51 A;  4DV7 B;  3V6H A;  5KFT A;  1DGS A;  1MSD A;  1N48 A;  3M99 B;  5I5V A;  3IGA C;  1M5I A;  5BMV A;  4X1Y A;  2YRW A;  5JQG A;  1KKD A;  1JJO A;  1KTA A;  1YXB A;  2VQF O;  1HNW B;  2FMA A;  2WLH A;  4TM5 A;  2OYQ A;  1CQJ B;  1WAZ A;  4ASU G;  4DR7 O;  1IOV A;  1X4T A;  4FFK A;  2JA6 A;  1JX9 A;  1JFF A;  2EZO A;  4TOI A;  3M4I A;  1MAB G;  4WF9 V;  1UNN C;  1VQ7 V;  4Q0Y A;  4J41 A;  5KFV A;  3FKI G;  2R86 A;  1PNL A;  1HDJ A;  5CAE B;  5LHG A;  5JVD B;  2COI A;  1X59 A;  4XDJ A;  3ETJ A;  2ZM6 H;  3H4D A;  4YB8 B;  4EBD A;  5EIB C;  5KFL A;  5KG4 A;  4JI4 H;  4DR7 B;  5K1P A;  1SQF A;  3LSS A;  4X65 H;  2V1D A;  1XMO O;  2FE3 A;  3T1H H;  2A7W A;  3ABK B;  2B63 G;  5EZY A;  3FB5 C;  1RM1 C;  1TVK A;  2NU6 B;  4O7Z A;  2BQ3 A;  1A48 A;  1BT8 A;  2JGD B;  4TV9 B;  2WPD G;  1XDN A;  5FNV F;  4A3M G;  3I55 V;  1VQ5 V;  4JI0 H;  3K04 A;  5DEC A;  1HR0 H;  4WFA V;  4WCE V;  3RYF A;  4O3Q A;  3T7A A;  1Z2O X;  4I55 F;  2AGQ A;  1I7N A;  4GCZ A;  4FFP A;  4F6R A;  4DV3 B;  5BR8 O;  1NZ6 A;  1UJW B;  4Q6G A;  2UUB H;  3L73 H;  5LMN O;  5BYA A;  3KHH A;  3WFV A;  1WP7 A;  2VUM A;  3EYY A;  2VQF H;  4JI4 B;  1PPJ H;  2OWO A;  4Q4C A;  4PBC A;  4FPP A;  1I1L A;  5J2T F;  4WBN B;  2CTR A;  1VF7 A;  5LOV F;  5IYZ A;  5KFH A;  3CC7 V;  1M56 B;  1UFI A;  2HLD G;  1EYZ A;  1FJG H;  5C1O A;  3B8M A;  2VQE B;  3DTF A;  3ZS8 C;  4QW9 A;  2NNU A;  1G1X B;  2HHH H;  2R93 A;  1GKF A;  4U7O A;  4DL4 A;  2JJ1 G;  3SYP A;  2ITC C;  3H1I H;  4E4T A;  5EYP A;  3EHB B;  3BVO A;  4ECS A;  1E4E B;  1ZUQ A;  3RF2 A;  5KG1 A;  4LC1 A;  4U3J B;  3CRR A;  3WWJ A;  4WFF A;  4QWA A;  1HNW H;  4K35 A;  3VOU A;  5JQG F;  2E74 B;  3IG0 A;  4RB3 C;  5H5N A;  4Q45 A;  2A79 B;  2QKS A;  3RV3 A;  4DV2 B;  1JQ0 A;  4DR6 O;  2VPQ A;  2R9A A;  2PYJ A;  4CH5 A;  2VQE O;  2GV9 A;  3PR5 B;  1WA8 B;  4GLX A;  1I5Y A;  1MMM A;  1SQP H;  4UVB A;  3MFI A;  1K1S A;  4WFE A;  3KG2 A;  3UT5 B;  4X1K B;  3MHH C;  4JAU A;  4PDR A;  3RWR D;  3ETH A;  1JIH A;  4EFB A;  2IP4 A;  2Q4P A;  2ZIM A;  3V4S A;  1ET0 A;  1Q81 W;  2QSA A;  3FYE B;  4H0L B;  1AI4 A;  2JEJ A;  4MVR A;  3TXQ A;  2EIN C;  1WNS A;  2BOC C;  4DRX B;  4B3T O;  1ZAU A;  2O57 A;  2C2E A;  4EEQ A;  1KJ8 A;  4FFR A;  3H40 A;  2F23 A;  4J7Z A;  5IWA H;  4LF4 B;  3ZBH A;  3P3N A;  1HNZ O;  1KUQ A;  3MWD A;  4YJ3 B;  4GX1 A;  3VQX A;  4ZBM A;  3BHP A;  3K57 A;  5H80 A;  5KMG A;  1AIL A;  3S24 A;  2N74 A;  4PDM A;  1XL6 A;  3UKM A;  4JTA B;  2HJD A;  5LP6 C;  3KAJ A;  4UUG A;  4QIW E;  4MTE A;  3AG4 C;  1KD1 W;  5BWT A;  3RYH B;  3L72 H;  1DAA A;  2BQU A;  3ZED A;  5L1K A;  1R73 A;  1LR1 A;  3B40 A;  2GSM B;  4BIU A;  1PP9 H;  3JAM N;  4DIM A;  3JAK B;  1FFX B;  5LA6 A;  1YIT V;  4IIJ B;  3DAA A;  2ASL A;  4O84 A;  3GTK A;  4O2B B;  3B77 A;  3P30 A;  3LUT B;  2P67 A;  3R65 A;  1B04 A;  1SZX A;  4RNM A;  2GLT A;  2A9H A;  3SPJ A;  2YIA A;  4ED6 A;  3C0F B;  3MR6 A;  2NVX A;  4PEL A;  5EBW C;  3SGI A;  1RM1 B;  3H20 A;  4PA9 A;  4H44 B;  4ME6 A;  4DR1 H;  4FS2 A;  3HBL A;  2NU8 B;  4OX9 H;  3TCU A;  2DQ0 A;  4R50 A;  1AB3 A;  4RNO A;  1PNK A;  4YBZ B;  5J9P C;  2W6N A;  4EBE A;  3M9N B;  5C3E G;  2IJJ A;  2W6J G;  4FFO A;  1I3Q A;  3BRC A;  3ETQ A;  3X2Q B;  3UYY A;  5JVD F;  1S03 G;  3F7V C;  2CGN A;  2CGO A;  1XHX A;  2OCH A;  4LFC B;  5KG2 A;  3U9S A;  3JYC A;  5IJ9 A;  4GC6 A;  2HVS A;  4GYC B;  5J2T B;  4X8A A;  4DR2 H;  3ABM B;  1JDB B;  2QM7 A;  2L6L A;  3E8H A;  4LF5 B;  4PA3 A;  3CEB A;  1Y4M A;  4DV6 H;  5DMX A;  4YAJ B;  2WLJ A;  5BPF A;  3JD0 A;  3EVK A;  3EXA A;  5HNE A;  3RTX A;  2YIC A;  2F95 B;  3CD6 V;  4QPK A;  4YHH B;  3HOX G;  2W9B B;  3KHL A;  1DV1 A;  1M57 B;  4NXM B;  2ADP A;  3ZRW A;  2HGS A;  5C93 A;  5EZY B;  2Q2T A;  1FKA H;  1DLB A;  1OHH G;  5L1I A;  3JD4 A;  1XMQ O;  4EBC A;  1NU1 H;  3RFR A;  3HKE B;  3PW5 A;  2FLP A;  3TII A;  4BWA A;  4BY1 G;  3RYI A;  2QM4 A;  4LF5 O;  5B3S B;  3F5W C;  1N32 H;  1FD9 A;  4B3S H;  3D3Q A;  1VP7 A;  1VQP V;  4F6R B;  2R8J A;  3O65 A;  3ZHS A;  4NTX A;  5DLG A;  2M6Y A;  5LOV B;  4DV2 O;  3K59 A;  4F4L A;  1XNR B;  5DAA A;  4X1Y B;  2MW2 B;  1QNM A;  3HR0 A;  3C3S A;  1MSW D;  3STZ C;  1RPR A;  1AJN A;  2UUA B;  2IBZ H;  4AI8 A;  3E35 A;  1OCC C;  3JRW A;  1XMQ B;  3PW0 A;  4L87 A;  4JI5 O;  2XUM A;  5JCO A;  3ZHV A;  4IRD A;  1M4U A;  4A2B A;  1S0O A;  4UXN A;  4GX5 A;  2YZM A;  4PV1 B;  1W0K G;  4UCV A;  5C1P A;  2ASD A;  4A93 G;  3E5N A;  3GLK A;  1CKN A;  2Q0O C;  1JR9 A;  1QVG U;  2AZ2 A;  2UU9 B;  4MAM A;  2OIE A;  2HIV A;  2WB1 E;  4EKW A;  2I8C A;  4GKK B;  2M7W A;  2UUA O;  2ARH A;  2WAM A;  1V54 B;  2NR5 A;  3QO5 A;  1HNZ B;  1YJN V;  2UXC B;  1IUR A;  4C5C A;  2YI8 A;  1H2M A;  1A0I A;  3HKZ E;  3FB8 C;  2WWW A;  4ABM A;  5LP6 F;  1BMF G;  3T9C A;  1TVK B;  5KS8 A;  1XMQ H;  5KFF A;  5JVD A;  1GN2 A;  1EN6 A;  2V59 A;  2ZE7 A;  2ZE6 A;  1EZJ A;  1S10 A;  1AR4 A;  2SCU B;  5D8D A;  4UVC A;  2WDT A;  2AHY A;  1NTK H;  3H1L H;  3A0R A;  1OCR C;  2FLL A;  5LHI A;  3PJS K;  3E8B A;  3ASN C;  1J5E H;  4YXW G;  5KFI A;  1P49 A;  3N2K A;  4UCU A;  4GKK H;  2LW1 A;  2CH7 A;  2ZXW C;  3DSQ A;  4MA0 A;  1MNG A;  3CSX A;  3Q4H B;  4RNN A;  4A3E G;  1BSM A;  1I94 O;  1FYJ A;  1XDC A;  2AHZ A;  4YJ2 B;  3K0D A;  2EIL C;  2C22 A;  2F93 B;  1AI7 A;  2GTS A;  4JAS A;  3UCS C;  1D5A A;  3RB0 A;  3TGU H;  4F6E A;  4PDV A;  2ZCE A;  4LMY A;  4I7H A;  1M57 C;  1SQB H;  2JRI A;  3GVM A;  3OTO B;  3RYH A;  4LFC O;  3A8T A;  1WP8 A;  3H9V A;  1ZWI C;  3JSN A;  5KHG A;  1BNC A;  3PW2 A;  5IJ0 B;  3FMA A;  3KCX A;  4FFB B;  5IY5 B;  1M0W A;  5LXT F;  4RUF A;  5CB4 F;  2LO1 A;  4U3J A;  4LNU A;  2HDK A;  4ECW A;  2GTA A;  3CCE V;  1EUD B;  3H3V H;  2R7L A;  1MOF A;  4MT8 A;  4O4J F;  5JJJ B;  2AU0 A;  3CCQ V;  4DUZ H;  3LSU A;  5KAF Z;  1YEW A;  3JAL B;  3QQM A;  5L3G A;  3NBZ B;  3K5H A;  4JI8 H;  1KBH A;  1FXH A;  4A2A A;  4PZ7 A;  3QFF A;  1URF A;  2QWO B;  4DLK A;  3ZHQ A;  1XEQ A;  5KT5 A;  2BQR A;  4WD3 A;  5CN0 A;  3HKB B;  4DV7 O;  4TSF G;  5KFA A;  2YRX A;  3M9O B;  3RUP A;  1T94 A;  5KT7 A;  3K5I A;  4MS2 A;  1BQZ A;  1N4C A;  3B2E E;  1I7F A;  4K8X A;  1OCR B;  1MG1 A;  1H8H G;  3JAR B;  2UXC H;  1NI8 A;  1YI2 V;  5B1O A;  4BIZ A;  1Q7Y W;  3RFC A;  3RGX A;  1KJI A;  3JD1 A;  1WJZ A;  3K9A A;  5LXT B;  3AG3 B;  1V54 C;  4U7N A;  2EJ3 A;  3N42 B;  4YIO A;  5LYJ A;  2P06 A;  1NVP B;  2YC0 A;  2X0S A;  2IJI A;  4GX2 A;  5KT4 A;  5LGN A;  3A0B Z;  4Q43 A;  1F23 A;  2R8I A;  2WAQ E;  1KQS U;  3M8A A;  1W2B U;  5KFP A;  3ZN0 A;  1A32 A;  4IIJ A;  3C90 A;  5KG0 A;  5KT3 A;  2EJ7 A;  2HVQ A;  2QTS A;  2XAG A;  1N0J A;  1VQ4 V;  3AG1 C;  1SF9 A;  1JJ2 U;  2WLN A;  1Q90 D;  3SPC A;  2JA6 G;  4I5S A;  4I4T A;  5JUM A;  3W5O A;  4BW9 A;  1H8E G;  2B1G A;  3BPZ A;  2UXB H;  1M0T A;  5EDW A;  3QO7 A;  4U6P A;  3WB1 A;  5B1A B;  1M90 W;  1JKJ B;  4J7K A;  3JAK A;  4RUA A;  4ZI7 A;  4KL1 A;  4QWD A;  3RB4 A;  3L74 H;  1L0N H;  4DV3 H;  3UFX B;  5EWF A;  4DR2 O;  2UUB B;  2W7O A;  1AJP A;  1RPO A;  1M9N A;  4O7Y A;  5EOY A;  2XC9 A;  3GIK A;  5I5U A;  1WB8 A;  1KEE A;  4XDL A;  1JPX A;  4J9O A;  1VQ9 V;  4FK5 C;  3I4N G;  3SDL A;  4MV8 A;  2HG5 C;  4J9K A;  5L3F A;  4MV6 A;  2R70 A;  3RBD A;  2HP8 A;  2MK3 A;  4L1K A;  4UV8 A;  5IY5 C;  3GWK C;  4J9Z B;  4QJF A;  4IWY A;  3E22 B;  4BBR G;  1BQ0 A;  1FXK C;  1L2Z A;  1XMO H;  3QZ8 A;  4JF3 A;  5GW7 A;  3J80 N;  4ED7 A;  2GDS A;  1HWY A;  2NN4 A;  5LA6 F;  1BZK A;  1EN5 A;  4ZOL B;  3RGB A;  5IYD O;  2FKL A;  2Z02 A;  4O82 A;  4FBT A;  3HOZ G;  1TWA A;  4DYL A;  4TV9 A;  3OTO O;  4FMT A;  3CCS V;  5JJN B;  3Q1K A;  3TY9 A;  3MD0 A;  5D1P A;  4LF8 H;  2CW7 A;  2RF4 A;  3CCM V;  2Q0A A;  2DAB A;  1NKD A;  3VPB A;  2UUA H;  3S3W A;  4ECU A;  3IJ4 A;  4CE5 A;  4JAA A;  3BQ0 A;  1GTO A;  3DXR A;  4FLY A;  4CH6 A;  2C2A A;  3R9R A;  3BQ2 A;  4J9L A;  1I6U A;  1ZTE A;  5CBH A;  3RYC A;  4PA7 A;  3Q8Q B;  2PYL A;  3CRQ A;  2R9R B;  1SQX H;  3Q8S B;  3T5H A;  1BHB A;  2WLM A;  1NT2 B;  2YS8 A;  4R6Z A;  4DV7 H;  1LUW A;  4O2A A;  3RN4 A;  2UVR A;  2Y0S E;  1CKN B;  1HNZ H;  4CS2 A;  5IE9 A;  2Q5Z A;  3TK1 A;  4U7C A;  4H33 A;  4IAJ A;  3ZMS A;  5IP9 G;  2QR4 A;  2JDI G;  4Q4D A;  4YIP A;  4DV4 B;  2HHF B;  4LSX A;  1RP3 B;  4X1K A;  1GSA A;  2PZS A;  2CFM A;  1XK5 A;  1W93 A;  2BOB C;  4TQS A;  4FBU A;  2YS6 A;  3F8N A;  4A3F G;  5EC1 C;  2WYO A;  5DGB A;  5H6Q A;  2OCC B;  5LBQ A;  1ZHQ A;  2EIK B;  4TV8 F;  2CZG A;  3G8C A;  3N40 P;  4DL5 A;  3D36 A;  4A3J G;  3CXH F;  2RCV A;  3JAW B;  2R84 A;  4DR3 O;  4JZG A;  5DG7 A;  3KAK A;  1YDX A;  1BXR A;  4DR5 H;  2BSK B;  4LWS B;  4J0M A;  3PW4 A;  1N36 H;  1E4F T;  1R6T A;  5KMG B;  5FR9 A;  4DR6 H;  4W4K A;  1E1R G;  1I7L A;  4O4H F;  1WPX A;  5CA0 A;  5EBM C;  1GRJ A;  2E76 B;  2QKC A;  4JYC A;  2YL2 A;  5LP6 A;  1J95 A;  3KHR A;  4AQY O;  1N34 H;  1B3Q A;  3X2Q C;  4LF9 H;  3G6V A;  2PMZ A;  1FFX A;  5LA6 B;  3UQ8 A;  4X20 B;  5EC2 C;  1ZL8 A;  1AP5 A;  1LNQ A;  3CJH A;  3I5D A;  3U55 A;  1HNX O;  1AP6 A;  4O2B F;  1N56 A;  4MW8 A;  4J9S A;  3GID A;  2Q8V A;  2F66 C;  4HBN A;  1SZT A;  4DR2 B;  2UUB O;  3HKD B;  3JAT A;  3T4D A;  4Y8V B;  3GJX B;  4DL7 A;  2A0L A;  1RSO A;  5L1L A;  4TWK A;  4BAY A;  4A3K G;  2IW5 A;  2H8P C;  4G2K A;  1F4M A;  4UB8 Z;  2JK5 C;  5C4X G;  2IU0 A;  3K06 A;  4LF8 O;  3T54 A;  4YHH O;  1WN7 A;  2X7R B;  2Q7E A;  4FZ1 A;  2B63 A;  5BWX A;  2CAZ C;  5KFY A;  3E83 A;  5KFW A;  2J6T A;  5F9L A;  4ED1 A;  1EFR G;  1N34 B;  4LF9 B;  4MVZ A;  4HNA A;  4FLU A;  3CQZ A;  1ZLZ A;  3KTM A;  3G6B A;  4MTX A;  2KSW A;  5BR8 B;  3JAL A;  4RB0 A;  3IN5 A;  2QK4 A;  3LUL A;  1HR0 O;  4F4X A;  1YHQ V;  4A3C G;  3L4J A;  2YIB A;  2JA5 A;  4Z1V A;  4TUY A;  1PKX A;  4GX0 A;  3W7X A;  3APQ A;  5FL7 G;  4O2A F;  3M7M X;  4DR5 O;  2CUG A;  2G38 A;  1VF6 C;  2CW8 A;  2V7Q G;  3BAA A;  5CB4 A;  2DOS A;  4DO2 A;  2OIG A;  1N34 O;  4LF9 O;  3OUF A;  3W7W A;  3AG2 B;  3HKC A;  1WSC A;  2XCL A;  2ZIN A;  3E22 A;  3J80 W;  1TUB A;  3WO1 A;  3GIP A;  5FNV A;  2GHY A;  1VMG A;  3SPI A;  4UCR A;  5LYJ B;  2XIG A;  4TQR A;  2UXD B;  4HNV A;  1SYX B;  3UZO A;  4XYM B;  3U0G A;  1I0H A;  2ATK C;  4DR5 B;  3MHS C;  4DR6 B;  2R7M A;  1K97 A;  1KYO F;  2PUS A;  3W1G A;  1WPB A;  2GBO A;  2XOK G;  3C3T A;  3S3X A;  2YEV A;  3K58 A;  4YY3 B;  2WTF A;  4JXU A;  4OXS A;  4GKJ B;  1DK1 A;  1JX4 A;  2OTJ V;  3IC9 A;  2R8G A;  2DYR C;  2FK2 A;  3BJY A;  3LP8 A;  5KFZ A;  3K5N A;  1M7J A;  4HQ6 A;  4A3L G;  4CC5 A;  1IDS A;  5KHI A;  3OT7 A;  2XT9 A;  5LOV A;  3VMM A;  5T14 A;  1Z5V A;  4IT5 A;  3K08 A;  3L75 H;  4DV5 H;  4X66 H;  1NR7 A;  4JAV A;  2EIL B;  4PI2 A;  1U97 A;  3JCU Z;  1GMG A;  1XNQ O;  4ZI7 F;  2V4Q A;  2QA4 V;  4NXN O;  2X6B A;  4EYH B;  4ZI7 B;  2EIM B;  2IU3 A;  2PGG A;  4O86 A;  2AGA A;  1BGY H;  4UFZ A;  4CHI A;  4JI3 B;  4RU9 A;  3PO2 G;  2W6Q A;  1UC8 A;  4YY3 O;  3J7A K;  4ECZ A;  4ED3 A;  4BY7 G;  3JZI A;  3K0G A;  2QEX V;  1JCH A;  1AJQ A;  1MZE A;  1I5X A;  5KFJ A;  5H9C A;  4JYA H;  5CE8 A;  5DED A;  1TA8 A;  4DUY O;  2DLN A;  3T1H O;  3PVX A;  2ZT9 B;  5GON F;  2P6J A;  3RAQ A;  4XBF A;  3J81 N;  2X5R A;  1XNQ B;  1H2N A;  5KAI Z;  1RJP A;  2W0X A;  2XAJ A;  1H38 A;  4JI3 O;  3K3W A;  3QG5 A;  1M1K W;  1W0J G;  3H4B A;  3GB8 B;  2V58 A;  2JVD A;  1F7Y A;  4F4Z A;  1KEC A;  2W6M A;  3TW6 A;  2D3O W;  2J9G A;  1S9F A;  1YCI A;  3MWM A;  1IXM A;  2XHB A;  3T5J A;  3JAW A;  5IDJ A;  4X64 B;  2LJ2 A;  4NKG B;  4A3G G;  2VWK A;  3CCL V;  3AG2 C;  1M93 A;  2ZKO A;  4JI2 B;  4BWS C;  1K9M W;  1Y1W A;  5CA0 B;  2C00 A;  1M6V A;  1QR8 A;  2QGN A;  3LSQ A;  1S5H C;  3GWO A;  5LP6 B;  4PZ8 A;  2UXD H;  1OV9 A;  3JSL A;  3D36 C;  4Q44 A;  3UZB A;  4FFB A;  1K5Q A;  3WWI A;  2R82 A;  1YJ9 V;  1Z2G A;  3KXY T;  2W6I G;  1NJI W;  3OGC C;  1KUT A;  2ZDI A;  4HR7 A;  3W7U A;  3ABL B;  2QWN B;  2W6Z A;  2ZNJ A;  5JVL A;  2F4V O;  5GTI Z;  4JUZ A;  4F4W A;  2EIN B;  1IZ3 A;  4DV4 H;  3P3P A;  4FS1 A;  2JJ2 G;  3R5X A;  2V4D A;  1TAE A;  4QE9 A;  3TY5 A;  4ZHQ A;  2RDJ A;  4KP4 A;  1K83 A;  3OEE G;  3TET A;  3ETG A;  1WLE A;  3BAC A;  4I55 B;  4JI2 H;  5LMU O;  4O3P A;  2YI9 A;  4IYI A;  2CNQ A;  3N6R A;  2KQX A;  4O4J A;  4YR0 A;  1XIL A;  2C35 B;  1SQG A;  4R8C A;  3P32 A;  4O2A B;  1Y14 B;  4EB6 A;  1VBG A;  2PF4 E;  5JWP A;  3CVZ A;  1ZSP A;  3DGE A;  1SQQ H;  4MVU A;  5LXT A;  5I47 A;  1YIJ V;  1XNR O;  1Y1V A;  4JYA B;  3HKB A;  2UU9 H;  4IR9 A;  4O4L B;  4GKJ O;  1VQ8 V;  4DUY H;  2W6O A;  2UXX A;  4B7K A;  4LF4 H;  2W9A A;  1VBH A;  1GYF A;  4JI5 B;  1T3N A;  1EN4 A;  2ABJ A;  1F51 A;  2YYA A;  3L71 H;  1CKO A;  3LQS A;  5TIS Z;  4WFB V;  3SYC A;  1S76 D;  4C2M A;  4K0K B;  3FAV A;  1PL0 A;  4MVQ A;  5J2U F;  1GM8 A;  4DV0 O;  3V6J A;  4NXN B;  1TUB B;  3PFF A;  3UT5 A;  5KT2 A;  2FL4 A;  5F2V O;  2W9C B;  4O4I F;  2COJ A;  5LHH A;  4E6N A;  5FD6 A;  1IBM O;  3WB0 A;  1NH2 B;  4GT1 A;  1S77 D;  3ORR A;  1CEZ A;  3R5F A;  4A3B G;  1K5S A;  3G71 V;  2UXC O;  1Y67 A;  2EJ0 A;  2FPG B;  1DF4 A;  4IRK A;  5DG8 A;  3TQT A;  1VS0 A;  4DRF A;  1FAF A;  5JCO C;  4PJ0 Z;  4DUY B;  4MSW C;  3T1H B;  2B5U A;  4DR1 B;  5JJE B;  1R3K C;  2XTA A;  2WA3 A;  3OR6 C;  3SI8 A;  5LGT A;  1IOW A;  4B3M H;  1W96 A;  4B3R H;  1ZET A;  4N21 A;  2KG7 A;  4NYE A;  4EGJ A;  3GIL A;  1MZF A;  2LFS A;  4LFC H;  2R7N A;  4G27 B;  4DW1 A;  2R7Z A;  2YUA A;  4QJF B;  3H01 A;  1IX9 A;  2RDI A;  4PA4 A;  4UUJ C;  5CA0 F;  3T5K A;  1DIK A;  1Y76 A;  2BCC H;  2Q7H A;  3ZHT A;  4JV0 A;  3B8N A;  1JMK C;  1Z2N X;  4DV6 B;  4X64 O;  5L3C A;  4YAK B;  4KHP O;  2VOB A;  3CCR V;  3A0H Z;  4DR1 O;  3Q8P B;  5I5T A;  4AQY H;  4AHC A;  3VA7 A;  4OPA A;  5K1X A;  3QVN A;  2ODM A;  2JEF A;  1K33 A;  1M56 C;  4TT3 G;  1EKV A;  1RK5 A;  5K3W A;  2K9P A;  4TUY B;  4MV3 A;  1KJJ A;  3GV8 B;  4TUY F;  4MVM A;  4DL3 A;  3VOT A;  4TV9 F;  5KKN B;  2E2H A;  5KFC A;  1Y66 A;  3W7T A;  4KHP H;  5IYB O;  5KUM A;  4I0X A;  3CP1 A; 
#chains in the Genus database with same CATH homology
 4X1Y A;  5JQG A;  1JJO A;  1HNW B;  3TY8 A;  2R70 A;  2OYQ A;  1X4T A;  2ZIO A;  5D5Q A;  3E22 B;  1L2Z A;  4JI0 B;  3SJC C;  3JAS B;  1XMO H;  1JFF A;  4TOI A;  3RYC B;  3M4I A;  4DV5 B;  4JV5 B;  5LMU B;  5D1O A;  3K5M A;  4Q0Y A;  4ZOL B;  3RGB A;  4DR4 B;  5BMV B;  4LF6 B;  4TV9 A;  3U10 A;  1IBM B;  5JVD B;  1HW7 A;  5JJN B;  4LR3 A;  3TY9 A;  5D1P A;  2ZM6 H;  4LF8 H;  1N36 B;  4DV2 H;  5EIB C;  4APM A;  2CW7 A;  1O75 A;  4JI4 H;  1XNR H;  4DR7 B;  2Q0A A;  4TV8 B;  5K1P A;  1SQF A;  4X65 H;  2UUA H;  2FE3 A;  3T1H H;  3JAM W;  5JQG B;  5EZY A;  3W1B A;  1TVK A;  1XNQ H;  4TV9 B;  4FLY A;  1XDN A;  4JI0 H;  4CH6 A;  1IBK B;  2UUC H;  4ZHQ B;  5JH7 A;  1HR0 H;  4D7T A;  3RYF A;  5LMU H;  1I6U A;  4ETS A;  3FFQ A;  1Z2O X;  1WH2 A;  2E5L H;  3U0Z A;  3RYC A;  1P16 A;  4DV0 B;  4F6R A;  4TV8 A;  3CHX A;  4DV3 B;  2KKW A;  2PYL A;  4LFB B;  4Q6G A;  2UUB H;  4ZOL A;  4DV1 B;  1QQC A;  1NT2 B;  4DV7 H;  3N6X A;  4O2A A;  4KHP B;  1CKN B;  1HNZ H;  4CS2 A;  3EYY A;  2MCT A;  2VQF H;  4JI4 B;  5GON B;  4JI6 H;  2OWO A;  4IAJ A;  3RYF B;  4DV4 B;  4LSX A;  4WBN B;  1VF7 A;  4X1K A;  2P22 C;  5IYZ A;  3J81 W;  2PZS A;  2CFM A;  1FJG H;  1XK5 A;  1BJT A;  3HKD A;  3JAT B;  2VQE B;  3F8N A;  3ZS8 C;  2HHH H;  2WYO A;  1HR0 B;  1SKV A;  1ZHQ A;  5EYP A;  3N40 P;  1S68 A;  4LFA B;  3JAW B;  3RF2 A;  4TQF A;  4U3J B;  5A2Q W;  3GDE A;  4FM9 A;  1HNW H;  3IG0 A;  3KAK A;  4FM0 A;  4WBN A;  4RB3 C;  4DR5 H;  1O9H A;  4J0M A;  4DV2 B;  1E4G T;  5KMG B;  1E4F T;  1N36 H;  4DR6 H;  4O4H A;  4OX9 B;  5KX5 A;  5CA0 A;  2R9A A;  2PYJ A;  1XMO B;  4CH5 A;  3OTF A;  5LP6 A;  4JV5 H;  2GV9 A;  1N34 H;  1AN7 A;  4LF9 H;  4GLX A;  2RGR A;  4LSA A;  1FFX A;  2F1M A;  2JGU A;  4X20 B;  5LA6 B;  5ITZ A;  3UQ8 A;  4PZ6 A;  4PDB A;  4FVM A;  4PHZ A;  4JI5 H;  3RIZ A;  4RAY A;  4LF6 H;  3N43 B;  3UT5 B;  4I55 A;  2YIB D;  4X1K B;  5IYZ B;  3RWR D;  1IBK H;  1IBM H;  5FD5 A;  2F66 C;  4EFB A;  2ZIM A;  4HBN A;  1SEI A;  4DR2 B;  3DF7 A;  3HKD B;  3JAT A;  2PY5 A;  4O4J B;  2VPS A;  3GJX B;  1RSO A;  2ZNI A;  1M5I A;  4DV0 H;  1WNS A;  4DRX B;  1XHZ A;  4JI3 H;  1ZAU A;  3NBY B;  3NC0 B;  5EIB D;  3KAL A;  4EEQ A;  4DV1 H;  5EYP B;  5IWA H;  4LF4 B;  2WE6 A;  3QTC A;  5J2U B;  4YJ3 B;  3VQX A;  3K57 A;  1FVI A;  3BHP A;  4NXM H;  1WN7 A;  4JI6 B;  2Q7E A;  1BGW A;  4ZIB A;  3L4K A;  2CAZ C;  5KMG A;  4I50 A;  3S24 A;  3KAJ A;  1N34 B;  5IJ9 B;  5LP6 C;  4LF9 B;  4MTE A;  4HNA A;  3N44 B;  4FLU A;  3RYH B;  3ZED A;  2KSW A;  5BR8 B;  3JAL A;  3VNN A;  4RB0 A;  3HKC B;  4LFB H;  3JAK B;  1FFX B;  5LA6 A;  3L4J A;  4IIJ B;  2YIB A;  5ITZ B;  4FM1 A;  4RB1 A;  4TUY A;  4O2B B;  1X9N A;  1B04 A;  3M7M X;  4LH6 A;  2YIA A;  5C8Y A;  3K3V A;  2CW8 A;  3C0F B;  3SGI A;  3H20 A;  3BAA A;  5CB4 A;  3BA8 A;  4DRX A;  1O9G A;  3IAY A;  1Q3E A;  5IWA B;  4DR1 H;  2HVR A;  4JI7 B;  4OX9 H;  2VQE H;  3HKC A;  4UCT A;  3VQV A;  3QWU A;  2ZIN A;  3E22 A;  4B3M B;  3J80 W;  2VUG A;  3BRC A;  3ETQ A;  1TUB A;  4LH7 A;  5D5P A;  5FNV A;  1S03 G;  4UCR A;  5LYJ B;  4DK1 A;  2XIG A;  2UXD B;  3T1Y H;  1XHX A;  4LFC B;  1SYX B;  1CKM A;  2BTO A;  1MZB A;  4R7R A;  5IJ9 A;  4DR3 B;  2O03 A;  4HNA B;  4CH4 A;  4B3S B;  2HVS A;  4GYC B;  4JI1 B;  5J2T B;  4CH3 A;  4DR5 B;  4DR2 H;  4FLZ A;  4DR6 B;  1P8L A;  4LF5 B;  2PUS A;  4B3T B;  1WPB A;  3W1G A;  4DV6 H;  4RB2 C;  4IHJ B;  4UCS A;  1KMI Z;  4YY3 B;  3K58 A;  5KHK A;  1Z5W A;  4GKJ B;  4AQY B;  3RTX A;  2F95 B;  4AIL C;  2RQ6 A;  4CS3 A;  3L2P A;  5FNV B;  4YHH B;  2YCH A;  3K5N A;  1Q43 A;  1HNX B;  4CC5 A;  4X1I A;  4X62 H;  5KHI A;  4NXM B;  3N2G B;  5LOV A;  2HGS A;  4CS4 A;  5CB4 B;  1I94 B;  3VQW A;  5EZY B;  1Z5V A;  1XI1 A;  2Q2T A;  4DV5 H;  4X66 H;  1FKA H;  2BTQ B;  1XQ8 A;  3BAB A;  4PI2 A;  3RFR A;  3HKE B;  4ZI7 B;  4BWA A;  2PGG A;  4IHJ A;  5BR8 H;  3RYI A;  2QM4 A;  4UFZ A;  4JI3 B;  4RAZ A;  1N32 H;  4B3S H;  3SR2 C;  3SJB C;  4F6R B;  2F4V B;  3J7A K;  1SA0 A;  2ZM6 B;  4LF8 B;  4X64 H;  2EX3 A;  5LOV B;  3K59 A;  1XNR B;  4MV9 A;  4JYA H;  4X1Y B;  5J2T A;  2UUA B;  3QF7 A;  1TA8 A;  2HEP A;  2IM9 A;  2P5O A;  5CA1 A;  4YHH H;  3A2F A;  1XMQ B;  1HNX H;  4DR4 H;  3RYI B;  1XNQ B;  3THO A;  2JS5 A;  5FPO A;  4LF7 B;  5JCO A;  1M4U A;  4A2B A;  4K0K H;  1TGO A;  3QG5 A;  4UCV A;  1IBL B;  5D1O B;  3GB8 B;  2JVD A;  3RGZ A;  3T1Y B;  3N2K B;  2R72 A;  4NXN H;  1CKN A;  1G6U A;  4TQD A;  2UU9 B;  3HKE A;  2HIV A;  4GKK B;  3MWM A;  2XHB A;  3JAW A;  4X64 B;  4B3T H;  3JAS A;  2VWK A;  1JFF B;  1HNZ B;  2UXC B;  4YY3 H;  1M93 A;  2Q7G A;  2YI8 A;  1SA0 B;  4JI2 B;  4BWS C;  1A0I A;  5CA0 B;  1KU9 A;  1H2S B;  5LP6 B;  2E5L B;  4PZ8 A;  2UXD H;  1TVK B;  1XMQ H;  4EB6 B;  3JSL A;  3CB2 A;  5JVD A;  1ZHS A;  4LF7 H;  4FFB A;  4DR3 H;  5JH7 B;  4JI1 H;  3KXY T;  2QJ1 A;  4LF5 H;  4O4L A;  2WDT A;  4FLX A;  3K5L A;  2ZNJ A;  1N32 B;  4GKJ H;  3SJA C;  1T5E A;  1J5E H;  2F4V H;  4DV4 H;  1P49 A;  3N2K A;  4UCU A;  4GKK H;  3DSQ A;  3CSX A;  4O4I B;  2V4D A;  4X20 A;  1FJG B;  1TAE A;  3TY5 A;  4ZHQ A;  5GON A;  1I94 H;  4YJ2 B;  2HHH B;  5J2U A;  4I55 B;  4JI2 H;  2F93 B;  4X66 B;  2YI9 A;  1D5A A;  4I9Q A;  4DK0 A;  2ZCE A;  4O4J A;  4I7H A;  4LMY A;  2HIX A;  2YXL A;  2VWJ A;  3OTO B;  5LMN H;  3RYH A;  4LFA H;  3KYH C;  1SQG A;  4O2A B;  3JSN A;  4EB6 A;  5KHG A;  4O4I A;  5IJ0 B;  3CVZ A;  3FMA A;  4FFB B;  5LXT A;  1N33 B;  1M0W A;  1S5J A;  4YJ3 A;  4FLV A;  4NVP A;  4JYA B;  3HKB A;  2UU9 H;  4U3J A;  4LNU A;  3HXL A;  4O4L B;  3U11 A;  2E3C A;  4FM2 A;  4DUY H;  1Q5O A;  4LF4 H;  3ICX A;  1GYF A;  4JI5 B;  5JJJ B;  4L8J A;  4RZQ A;  4DUZ H;  4UCO A;  5FPR A;  1YEW A;  1CKO A;  3JAL B;  4K0K B;  3NBZ B;  4B3R B;  4MTD A;  1IBL H;  4JI8 H;  4A2A A;  4PZ7 A;  3K5O A;  4O2B A;  4YJ2 A;  5KHJ A;  5LL6 b;  4NXN B;  1Q8I A;  1TUB B;  3HKB B;  3UT5 A;  5LMN B;  3OTO H;  4E6N A;  5C8Y B;  5FD6 A;  3LNN A;  4O4H B;  3WB0 A;  3MAQ A;  4I4T B;  5KX5 B;  3B2E E;  1I7F A;  4K8X A;  3JAR B;  2UXC H;  4PI0 A;  1V9P A;  1VS0 A;  4DRF A;  3PN1 A;  4CC6 A;  5IJ0 A;  5JCO C;  3RGX A;  5LXT B;  3WB2 A;  2UXB B;  2RJZ A;  4DUY B;  3RR5 A;  3N41 B;  3T1H B;  3N42 B;  4DR1 B;  5JJE B;  4LNU B;  5LYJ A;  2RGV A;  4JI7 H;  1Z2P X;  4DUZ B;  4MV7 A;  3RJ0 A;  4I50 B;  2UUC B;  3N2G A;  4B3M H;  4D7S A;  2ZJT A;  4B3R H;  3BA9 A;  2BTQ A;  3JAR A;  2W57 A;  4LFC H;  4DR7 H;  4B08 A;  4EFE A;  4IIJ A;  4X65 B;  1J5E B;  4EQ5 A;  1QHT A;  2Q2U A;  2HVQ A;  2Q7H A;  4M7E A;  1N33 H;  5IT9 W;  5DIS C;  4FLT A;  1JMK C;  1Z2N X;  4DV6 B;  4X1I B;  2VQF B;  2VOB A;  4I4T A;  3W5O A;  4BW9 A;  4AQY H;  4AHC A;  3BPZ A;  5K1X A;  2UXB H;  1M0T A;  3VQY A;  3LML A;  4FLW A;  3WB1 A;  5KHH A;  4K8Z A;  5FLX W;  3JAK A;  4ZI7 A;  4X62 B;  4KL1 A;  5CA1 B;  2PTM A;  4TUY B;  1L8D A;  4DV3 H;  4JI8 B;  2UUB B;  5EOY A;  4DV7 B;  1DGS A;  4KHP H;  5BMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...